FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22828

FusionGeneSummary for MTRR_SLC30A5

check button Fusion gene summary
Fusion gene informationFusion gene name: MTRR_SLC30A5
Fusion gene ID: 22828
HgeneTgene
Gene symbol

MTRR

SLC30A5

Gene ID

4552

64924

Gene name5-methyltetrahydrofolate-homocysteine methyltransferase reductasesolute carrier family 30 member 5
SynonymsMSR|cblEZNT5|ZNTL1|ZTL1|ZnT-5
Cytomap

5p15.31

5q13.1-q13.2

Type of geneprotein-codingprotein-coding
Descriptionmethionine synthase reductase[methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)methionine synthase reductase, mitochondrialzinc transporter 5solute carrier family 30 (zinc transporter), member 5zinc transporter ZTL1znT-like transporter 1
Modification date2018052320180523
UniProtAcc

Q9UBK8

Q8TAD4

Ensembl transtripts involved in fusion geneENST00000502509, ENST00000264668, 
ENST00000341013, ENST00000440940, 
ENST00000396591, ENST00000380860, 
ENST00000502979, 
Fusion gene scores* DoF score3 X 2 X 3=183 X 3 X 3=27
# samples 33
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MTRR [Title/Abstract] AND SLC30A5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMTRR

GO:0009086

methionine biosynthetic process

11466310

HgeneMTRR

GO:0043418

homocysteine catabolic process

11466310

HgeneMTRR

GO:0046655

folic acid metabolic process

11466310

HgeneMTRR

GO:1904042

negative regulation of cystathionine beta-synthase activity

24416422

TgeneSLC30A5

GO:0006824

cobalt ion transport

10330022|11937503

TgeneSLC30A5

GO:0006829

zinc ion transport

10330022|11937503

TgeneSLC30A5

GO:0006882

cellular zinc ion homeostasis

11937503

TgeneSLC30A5

GO:0010043

response to zinc ion

11937503


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-HC-8260-01AMTRRchr5

7878435

+SLC30A5chr5

68413066

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000502509ENST00000396591MTRRchr5

7878435

+SLC30A5chr5

68413066

+
intron-intronENST00000502509ENST00000380860MTRRchr5

7878435

+SLC30A5chr5

68413066

+
intron-intronENST00000502509ENST00000502979MTRRchr5

7878435

+SLC30A5chr5

68413066

+
In-frameENST00000264668ENST00000396591MTRRchr5

7878435

+SLC30A5chr5

68413066

+
5CDS-intronENST00000264668ENST00000380860MTRRchr5

7878435

+SLC30A5chr5

68413066

+
5CDS-intronENST00000264668ENST00000502979MTRRchr5

7878435

+SLC30A5chr5

68413066

+
3UTR-3CDSENST00000341013ENST00000396591MTRRchr5

7878435

+SLC30A5chr5

68413066

+
3UTR-intronENST00000341013ENST00000380860MTRRchr5

7878435

+SLC30A5chr5

68413066

+
3UTR-intronENST00000341013ENST00000502979MTRRchr5

7878435

+SLC30A5chr5

68413066

+
In-frameENST00000440940ENST00000396591MTRRchr5

7878435

+SLC30A5chr5

68413066

+
5CDS-intronENST00000440940ENST00000380860MTRRchr5

7878435

+SLC30A5chr5

68413066

+
5CDS-intronENST00000440940ENST00000502979MTRRchr5

7878435

+SLC30A5chr5

68413066

+

Top

FusionProtFeatures for MTRR_SLC30A5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MTRR

Q9UBK8

SLC30A5

Q8TAD4

Involved in the reductive regeneration of cob(I)alamin(vitamin B12) cofactor required for the maintenance of methioninesynthase in a functional state. Necessary for utilization ofmethylgroups from the folate cycle, thereby affectingtransgenerational epigenetic inheritance. Folate pathway donatesmethyl groups necessary for cellular methylation and affectsdifferent pathways such as DNA methylation, possibly explainingthe transgenerational epigenetic inheritance effects.{ECO:0000269|PubMed:17892308}. Functions as a zinc transporter. May be a transporter ofzinc into beta cells in order to form insulin crystals. Partlyregulates cellular zinc homeostasis. Required with ZNT7 for theactivation of zinc-requiring enzymes, alkaline phosphatases(ALPs). Transports zinc into the lumens of the Golgi apparatus andvesicular compartments where ALPs locate, thus, converting apoALPsto holoALPs. Required with ZNT6 and ZNT7 for the activation ofTNAP. {ECO:0000269|PubMed:11904301, ECO:0000269|PubMed:11937503,ECO:0000269|PubMed:15276077, ECO:0000269|PubMed:15525635,ECO:0000269|PubMed:15994300}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MTRR_SLC30A5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MTRR_ENST00000264668_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_626aa
MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLTATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKTDLKTETAPLVVVVSTTGTG
DPPDTARKFVKEIQNQTLPVDFFAHLRTGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFTDTGHADDCVGLELVVEPWIAGLWPALRKH
FRSSRGQEEISGALPVASPASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIP
GLPPETLQVHLQESLGQLFTFVELFTGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSTGYGRIEILSGFINGLFLIVIA
FFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAFSHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMR
GVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPETEKELHIALEKIQKIEGLISYRDPH

>In-frame_MTRR_ENST00000440940_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_599aa
MRRFLLLTATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKTDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLR
TGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFTDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLV
KSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPETLQVHLQESLGQLFTFVELFTG
VLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSTGYGRIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSV
GGLIVNLIGICAFSHAHSHAHGASQGSCHSSDHSHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFG
WFIADPLCSLFIAILIFLSVVPLIKDACQVLLLRLPPETEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSDVLEQRIV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MTRR_ENST00000264668_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_1878nt
ATGGGCGCTGCGTCAGTGCGCGCTGGCGCAAGGTTGGTGGAAGTCGCGTTGTGCAGTTTCACTGTTACATGCCTTGAAGTGATGAGGAGG
TTTCTGTTACTATATGCTACACAGCAGGGACAGGCAAAGGCCATCGCAGAAGAAATATGTGAGCAAGCTGTGGTACATGGATTTTCTGCA
GATCTTCACTGTATTAGTGAATCCGATAAGTATGACCTAAAAACCGAAACAGCTCCTCTTGTTGTTGTGGTTTCTACCACGGGCACCGGA
GACCCACCCGACACAGCCCGCAAGTTTGTTAAGGAAATACAGAACCAAACACTGCCGGTTGATTTCTTTGCTCACCTGCGGTATGGGTTA
CTGGGTCTCGGTGATTCAGAATACACCTACTTTTGCAATGGGGGGAAGATAATTGATAAACGACTTCAAGAGCTTGGAGCCCGGCATTTC
TATGACACTGGACATGCAGATGACTGTGTAGGTTTAGAACTTGTGGTTGAGCCGTGGATTGCTGGACTCTGGCCAGCCCTCAGAAAGCAT
TTTAGGTCAAGCAGAGGACAAGAGGAGATAAGTGGCGCACTCCCGGTGGCATCACCTGCATCCTCGAGGACAGACCTTGTGAAGTCAGAG
CTGCTACACATTGAATCTCAAGTCGAGCTTCTGAGATTCGATGATTCAGGAAGAAAGGATTCTGAGGTTTTGAAGCAAAATGCAGTGAAC
AGCAACCAATCCAATGTTGTAATTGAAGACTTTGAGTCCTCACTTACCCGTTCGGTACCCCCACTCTCACAAGCCTCTCTGAATATTCCT
GGTTTACCCCCAGAATATTTACAGGTACATCTGCAGGAGTCTCTTGGCCAGCTTTTTACCTTTGTGGAATTATTCTATGGCGTGCTGACC
AATAGTCTGGGCCTGATCTCGGATGGATTCCACATGCTTTTTGACTGCTCTGCTTTAGTCATGGGACTTTTTGCTGCCCTGATGAGTAGG
TGGAAAGCCACTCGGATTTTCTCCTATGGGTACGGCCGAATAGAAATTCTGTCTGGATTTATTAATGGACTTTTTCTAATAGTAATAGCG
TTTTTTGTGTTTATGGAGTCAGTGGCTAGATTGATTGATCCTCCAGAATTAGACACTCACATGTTAACACCAGTCTCAGTTGGAGGGCTG
ATAGTAAACCTTATTGGTATCTGTGCCTTTAGCCATGCCCATAGCCATGCCCATGGAGCTTCTCAAGGAAGCTGTCACTCATCTGATCAC
AGCCATTCACACCATATGCATGGACACAGTGACCATGGGCATGGTCACAGCCACGGATCTGCGGGTGGAGGCATGAATGCTAACATGAGG
GGTGTATTTCTACATGTTTTGGCAGATACACTTGGCAGCATTGGTGTGATCGTATCCACAGTTCTTATAGAGCAGTTTGGATGGTTCATC
GCTGACCCACTCTGTTCTCTTTTTATTGCTATATTAATATTTCTCAGTGTTGTTCCACTGATTAAAGATGCCTGCCAGGTTCTACTCCTG
AGATTGCCACCAGAATATGAAAAAGAACTACATATTGCTTTAGAAAAGATACAGAAAATTGAAGGATTAATATCATACCGAGACCCTCAT
TTTTGGCGTCATTCTGCTAGTATTGTGGCAGGAACAATTCATATACAGGTGACATCTGATGTGCTAGAACAAAGAATAGTACAGCAGGTT
ACAGGAATACTTAAAGATGCTGGAGTAAACAATTTAACAATTCAAGTGGAAAAGGAGGCATACTTTCAACATATGTCTGGCCTAAGTACT

>In-frame_MTRR_ENST00000440940_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_1797nt
ATGAGGAGGTTTCTGTTACTATATGCTACACAGCAGGGACAGGCAAAGGCCATCGCAGAAGAAATATGTGAGCAAGCTGTGGTACATGGA
TTTTCTGCAGATCTTCACTGTATTAGTGAATCCGATAAGTATGACCTAAAAACCGAAACAGCTCCTCTTGTTGTTGTGGTTTCTACCACG
GGCACCGGAGACCCACCCGACACAGCCCGCAAGTTTGTTAAGGAAATACAGAACCAAACACTGCCGGTTGATTTCTTTGCTCACCTGCGG
TATGGGTTACTGGGTCTCGGTGATTCAGAATACACCTACTTTTGCAATGGGGGGAAGATAATTGATAAACGACTTCAAGAGCTTGGAGCC
CGGCATTTCTATGACACTGGACATGCAGATGACTGTGTAGGTTTAGAACTTGTGGTTGAGCCGTGGATTGCTGGACTCTGGCCAGCCCTC
AGAAAGCATTTTAGGTCAAGCAGAGGACAAGAGGAGATAAGTGGCGCACTCCCGGTGGCATCACCTGCATCCTCGAGGACAGACCTTGTG
AAGTCAGAGCTGCTACACATTGAATCTCAAGTCGAGCTTCTGAGATTCGATGATTCAGGAAGAAAGGATTCTGAGGTTTTGAAGCAAAAT
GCAGTGAACAGCAACCAATCCAATGTTGTAATTGAAGACTTTGAGTCCTCACTTACCCGTTCGGTACCCCCACTCTCACAAGCCTCTCTG
AATATTCCTGGTTTACCCCCAGAATATTTACAGGTACATCTGCAGGAGTCTCTTGGCCAGCTTTTTACCTTTGTGGAATTATTCTATGGC
GTGCTGACCAATAGTCTGGGCCTGATCTCGGATGGATTCCACATGCTTTTTGACTGCTCTGCTTTAGTCATGGGACTTTTTGCTGCCCTG
ATGAGTAGGTGGAAAGCCACTCGGATTTTCTCCTATGGGTACGGCCGAATAGAAATTCTGTCTGGATTTATTAATGGACTTTTTCTAATA
GTAATAGCGTTTTTTGTGTTTATGGAGTCAGTGGCTAGATTGATTGATCCTCCAGAATTAGACACTCACATGTTAACACCAGTCTCAGTT
GGAGGGCTGATAGTAAACCTTATTGGTATCTGTGCCTTTAGCCATGCCCATAGCCATGCCCATGGAGCTTCTCAAGGAAGCTGTCACTCA
TCTGATCACAGCCATTCACACCATATGCATGGACACAGTGACCATGGGCATGGTCACAGCCACGGATCTGCGGGTGGAGGCATGAATGCT
AACATGAGGGGTGTATTTCTACATGTTTTGGCAGATACACTTGGCAGCATTGGTGTGATCGTATCCACAGTTCTTATAGAGCAGTTTGGA
TGGTTCATCGCTGACCCACTCTGTTCTCTTTTTATTGCTATATTAATATTTCTCAGTGTTGTTCCACTGATTAAAGATGCCTGCCAGGTT
CTACTCCTGAGATTGCCACCAGAATATGAAAAAGAACTACATATTGCTTTAGAAAAGATACAGAAAATTGAAGGATTAATATCATACCGA
GACCCTCATTTTTGGCGTCATTCTGCTAGTATTGTGGCAGGAACAATTCATATACAGGTGACATCTGATGTGCTAGAACAAAGAATAGTA
CAGCAGGTTACAGGAATACTTAAAGATGCTGGAGTAAACAATTTAACAATTCAAGTGGAAAAGGAGGCATACTTTCAACATATGTCTGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MTRR_ENST00000264668_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_3360nt
GGAGCTTTCTATTGGTCCTGGGTACCGAGCATGGGCGCTGCGTCAGTGCGCGCTGGCGCAAGGTTGGTGGAAGTCGCGTTGTGCAGTTTC
ACTGTTACATGCCTTGAAGTGATGAGGAGGTTTCTGTTACTATATGCTACACAGCAGGGACAGGCAAAGGCCATCGCAGAAGAAATATGT
GAGCAAGCTGTGGTACATGGATTTTCTGCAGATCTTCACTGTATTAGTGAATCCGATAAGTATGACCTAAAAACCGAAACAGCTCCTCTT
GTTGTTGTGGTTTCTACCACGGGCACCGGAGACCCACCCGACACAGCCCGCAAGTTTGTTAAGGAAATACAGAACCAAACACTGCCGGTT
GATTTCTTTGCTCACCTGCGGTATGGGTTACTGGGTCTCGGTGATTCAGAATACACCTACTTTTGCAATGGGGGGAAGATAATTGATAAA
CGACTTCAAGAGCTTGGAGCCCGGCATTTCTATGACACTGGACATGCAGATGACTGTGTAGGTTTAGAACTTGTGGTTGAGCCGTGGATT
GCTGGACTCTGGCCAGCCCTCAGAAAGCATTTTAGGTCAAGCAGAGGACAAGAGGAGATAAGTGGCGCACTCCCGGTGGCATCACCTGCA
TCCTCGAGGACAGACCTTGTGAAGTCAGAGCTGCTACACATTGAATCTCAAGTCGAGCTTCTGAGATTCGATGATTCAGGAAGAAAGGAT
TCTGAGGTTTTGAAGCAAAATGCAGTGAACAGCAACCAATCCAATGTTGTAATTGAAGACTTTGAGTCCTCACTTACCCGTTCGGTACCC
CCACTCTCACAAGCCTCTCTGAATATTCCTGGTTTACCCCCAGAATATTTACAGGTACATCTGCAGGAGTCTCTTGGCCAGCTTTTTACC
TTTGTGGAATTATTCTATGGCGTGCTGACCAATAGTCTGGGCCTGATCTCGGATGGATTCCACATGCTTTTTGACTGCTCTGCTTTAGTC
ATGGGACTTTTTGCTGCCCTGATGAGTAGGTGGAAAGCCACTCGGATTTTCTCCTATGGGTACGGCCGAATAGAAATTCTGTCTGGATTT
ATTAATGGACTTTTTCTAATAGTAATAGCGTTTTTTGTGTTTATGGAGTCAGTGGCTAGATTGATTGATCCTCCAGAATTAGACACTCAC
ATGTTAACACCAGTCTCAGTTGGAGGGCTGATAGTAAACCTTATTGGTATCTGTGCCTTTAGCCATGCCCATAGCCATGCCCATGGAGCT
TCTCAAGGAAGCTGTCACTCATCTGATCACAGCCATTCACACCATATGCATGGACACAGTGACCATGGGCATGGTCACAGCCACGGATCT
GCGGGTGGAGGCATGAATGCTAACATGAGGGGTGTATTTCTACATGTTTTGGCAGATACACTTGGCAGCATTGGTGTGATCGTATCCACA
GTTCTTATAGAGCAGTTTGGATGGTTCATCGCTGACCCACTCTGTTCTCTTTTTATTGCTATATTAATATTTCTCAGTGTTGTTCCACTG
ATTAAAGATGCCTGCCAGGTTCTACTCCTGAGATTGCCACCAGAATATGAAAAAGAACTACATATTGCTTTAGAAAAGATACAGAAAATT
GAAGGATTAATATCATACCGAGACCCTCATTTTTGGCGTCATTCTGCTAGTATTGTGGCAGGAACAATTCATATACAGGTGACATCTGAT
GTGCTAGAACAAAGAATAGTACAGCAGGTTACAGGAATACTTAAAGATGCTGGAGTAAACAATTTAACAATTCAAGTGGAAAAGGAGGCA
TACTTTCAACATATGTCTGGCCTAAGTACTGGATTTCATGATGTTCTGGCTATGACAAAACAAATGGAATCCATGAAATACTGCAAAGAT
GGTACTTACATCATGTGAGATAACTCAAGAATTACCCCTGGAGAATAAACAATGAAGATTAAATGACTCAGTATTTGTAATATTGCCAGA
AGGATAAAAATTACACATTAACTGTACAGAAACAGAGTTCCCTACTACTGGATCAAGGAATCTTTCTTGAAGGAAATTTAAATACAGAAT
GAAACATTAATGGTAAAAGTGGAGTAATTATTTAAATTATGTGTATAAAAGGAATCAAATTTTGAGTAAACATGATGTATTACATCATCT
TCAAAAATAGATATGATGGATTCTAGTGAAGACCAAAATTACTTCTGTTTACTTTCTATCAGGAAGCATCTCCATTGTAAATATGTATTT
ACATGTTTATTACAAAGACCCAAATGAAAAATTTTTAGTCCATTTTTTGCATAGCCTAAAGATAAAATAGGAATAAAAGTTCTATATTTA
TGGATTTTCTGTATATAAAACTGGTTTCTAATTATAACTTAAGTCCATTAAGTAAAATCTGTATTGCCACTTTAAATGTAAACTAAATTA
TTTGGGAGAAACTTCAACCACTGATATGAGATAAGCAATGAGAATAGGGAAGTGTATAACATCACAGTTTTTGATGTATTACAAAAATCA
ACCACTCTATAAAATAAATTTTTTTTACTTTTGGTAATATTTGCAAATGAATAATTAATTTATTAGGGTAAAGAACTTATACTAAGTTGT
GTCCATGTTATTCATTTACTTACCATGTTCCTTTAAAGTAGAATATTTCCTTTCTTGTTATATATTTGACATTCCAAGCTGCTTATCAAG
CTGGTATCCAAGCAGTGGTAAGCTTTCATCCTTTCTTAGCTCCATAACGTTGTGAAACAGCCAGTTAAGAGAATCGTAAATAATTGTCAA
CTCACAGTTGAATTCTCTGCCTATGTAGGTAACTTTTTTCTAATTTCTGGAACATATAGATATATAAGAAATATCAAAGAATAGGTAGTT
ATTTCAAAGTTTAATAAGTAAAACTTGTTCATAAACATTTGAGCACCATGAAATCAAAATACCCTATAACTACTTTCTATAGTCATATCT
AATTTATATTTTTTTCATTTCCAGTTGTAACTAGATATGTAGTAAAGTCTGAAAAGACTTTACCATAGACAATAACATGCAGTTTTATCA
GCACCAAAGAATGTTGTCCAAAAGAAACTTTTTAATACCTGTCTTTCTATTTATAACATCTGAATATTTTCATTCTTATATTAAGAATTT
TGATAAGTAGATTGAATTTAGTATGAGTACTATTTTCTTATATATACCACAATGGCAAACATGTATTATAAATCATATTTTTGTCTTACC
AATTTTAATATATGAGGGGTTTTAGAAATTTGTTGTAAGTTATTTTTATATTCCTTGTCTTTTGCATATTTTTTGGCCAAAATCTTCAAT

>In-frame_MTRR_ENST00000440940_chr5_7878435_+_SLC30A5_ENST00000396591_chr5_68413066_+_3301nt
GGTTCGTGCCCGGCTGGCGCGGCGTGGTTTCACTGTTACATGCCTTGAAGTGATGAGGAGGTTTCTGTTACTATATGCTACACAGCAGGG
ACAGGCAAAGGCCATCGCAGAAGAAATATGTGAGCAAGCTGTGGTACATGGATTTTCTGCAGATCTTCACTGTATTAGTGAATCCGATAA
GTATGACCTAAAAACCGAAACAGCTCCTCTTGTTGTTGTGGTTTCTACCACGGGCACCGGAGACCCACCCGACACAGCCCGCAAGTTTGT
TAAGGAAATACAGAACCAAACACTGCCGGTTGATTTCTTTGCTCACCTGCGGTATGGGTTACTGGGTCTCGGTGATTCAGAATACACCTA
CTTTTGCAATGGGGGGAAGATAATTGATAAACGACTTCAAGAGCTTGGAGCCCGGCATTTCTATGACACTGGACATGCAGATGACTGTGT
AGGTTTAGAACTTGTGGTTGAGCCGTGGATTGCTGGACTCTGGCCAGCCCTCAGAAAGCATTTTAGGTCAAGCAGAGGACAAGAGGAGAT
AAGTGGCGCACTCCCGGTGGCATCACCTGCATCCTCGAGGACAGACCTTGTGAAGTCAGAGCTGCTACACATTGAATCTCAAGTCGAGCT
TCTGAGATTCGATGATTCAGGAAGAAAGGATTCTGAGGTTTTGAAGCAAAATGCAGTGAACAGCAACCAATCCAATGTTGTAATTGAAGA
CTTTGAGTCCTCACTTACCCGTTCGGTACCCCCACTCTCACAAGCCTCTCTGAATATTCCTGGTTTACCCCCAGAATATTTACAGGTACA
TCTGCAGGAGTCTCTTGGCCAGCTTTTTACCTTTGTGGAATTATTCTATGGCGTGCTGACCAATAGTCTGGGCCTGATCTCGGATGGATT
CCACATGCTTTTTGACTGCTCTGCTTTAGTCATGGGACTTTTTGCTGCCCTGATGAGTAGGTGGAAAGCCACTCGGATTTTCTCCTATGG
GTACGGCCGAATAGAAATTCTGTCTGGATTTATTAATGGACTTTTTCTAATAGTAATAGCGTTTTTTGTGTTTATGGAGTCAGTGGCTAG
ATTGATTGATCCTCCAGAATTAGACACTCACATGTTAACACCAGTCTCAGTTGGAGGGCTGATAGTAAACCTTATTGGTATCTGTGCCTT
TAGCCATGCCCATAGCCATGCCCATGGAGCTTCTCAAGGAAGCTGTCACTCATCTGATCACAGCCATTCACACCATATGCATGGACACAG
TGACCATGGGCATGGTCACAGCCACGGATCTGCGGGTGGAGGCATGAATGCTAACATGAGGGGTGTATTTCTACATGTTTTGGCAGATAC
ACTTGGCAGCATTGGTGTGATCGTATCCACAGTTCTTATAGAGCAGTTTGGATGGTTCATCGCTGACCCACTCTGTTCTCTTTTTATTGC
TATATTAATATTTCTCAGTGTTGTTCCACTGATTAAAGATGCCTGCCAGGTTCTACTCCTGAGATTGCCACCAGAATATGAAAAAGAACT
ACATATTGCTTTAGAAAAGATACAGAAAATTGAAGGATTAATATCATACCGAGACCCTCATTTTTGGCGTCATTCTGCTAGTATTGTGGC
AGGAACAATTCATATACAGGTGACATCTGATGTGCTAGAACAAAGAATAGTACAGCAGGTTACAGGAATACTTAAAGATGCTGGAGTAAA
CAATTTAACAATTCAAGTGGAAAAGGAGGCATACTTTCAACATATGTCTGGCCTAAGTACTGGATTTCATGATGTTCTGGCTATGACAAA
ACAAATGGAATCCATGAAATACTGCAAAGATGGTACTTACATCATGTGAGATAACTCAAGAATTACCCCTGGAGAATAAACAATGAAGAT
TAAATGACTCAGTATTTGTAATATTGCCAGAAGGATAAAAATTACACATTAACTGTACAGAAACAGAGTTCCCTACTACTGGATCAAGGA
ATCTTTCTTGAAGGAAATTTAAATACAGAATGAAACATTAATGGTAAAAGTGGAGTAATTATTTAAATTATGTGTATAAAAGGAATCAAA
TTTTGAGTAAACATGATGTATTACATCATCTTCAAAAATAGATATGATGGATTCTAGTGAAGACCAAAATTACTTCTGTTTACTTTCTAT
CAGGAAGCATCTCCATTGTAAATATGTATTTACATGTTTATTACAAAGACCCAAATGAAAAATTTTTAGTCCATTTTTTGCATAGCCTAA
AGATAAAATAGGAATAAAAGTTCTATATTTATGGATTTTCTGTATATAAAACTGGTTTCTAATTATAACTTAAGTCCATTAAGTAAAATC
TGTATTGCCACTTTAAATGTAAACTAAATTATTTGGGAGAAACTTCAACCACTGATATGAGATAAGCAATGAGAATAGGGAAGTGTATAA
CATCACAGTTTTTGATGTATTACAAAAATCAACCACTCTATAAAATAAATTTTTTTTACTTTTGGTAATATTTGCAAATGAATAATTAAT
TTATTAGGGTAAAGAACTTATACTAAGTTGTGTCCATGTTATTCATTTACTTACCATGTTCCTTTAAAGTAGAATATTTCCTTTCTTGTT
ATATATTTGACATTCCAAGCTGCTTATCAAGCTGGTATCCAAGCAGTGGTAAGCTTTCATCCTTTCTTAGCTCCATAACGTTGTGAAACA
GCCAGTTAAGAGAATCGTAAATAATTGTCAACTCACAGTTGAATTCTCTGCCTATGTAGGTAACTTTTTTCTAATTTCTGGAACATATAG
ATATATAAGAAATATCAAAGAATAGGTAGTTATTTCAAAGTTTAATAAGTAAAACTTGTTCATAAACATTTGAGCACCATGAAATCAAAA
TACCCTATAACTACTTTCTATAGTCATATCTAATTTATATTTTTTTCATTTCCAGTTGTAACTAGATATGTAGTAAAGTCTGAAAAGACT
TTACCATAGACAATAACATGCAGTTTTATCAGCACCAAAGAATGTTGTCCAAAAGAAACTTTTTAATACCTGTCTTTCTATTTATAACAT
CTGAATATTTTCATTCTTATATTAAGAATTTTGATAAGTAGATTGAATTTAGTATGAGTACTATTTTCTTATATATACCACAATGGCAAA
CATGTATTATAAATCATATTTTTGTCTTACCAATTTTAATATATGAGGGGTTTTAGAAATTTGTTGTAAGTTATTTTTATATTCCTTGTC


Top

FusionGenePPI for MTRR_SLC30A5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MTRRELAVL1, FH, HIST1H2AG, PAPSS1, GMCL1, SMS, UBA6, ATM, KIF2A, TSNAXSLC30A5ELAVL1, SRSF1, ATP6V1B1, ATP6V0A1, TCIRG1, NT5E, HNRNPD, ABCC2, VAMP2, ATP6V1E1, DNM2, SLC30A6, RIC3, B3GNT3, LPAR1, CHRNA9, CLPSL1, TCTN3, TMEM17, TMEM216, SPPL2B, CSGALNACT2, FPR2, CYB5D2, TPRA1, CD79B, CD70, MAS1, IPPK, FUT3, DPEP1, CD83, IL1R2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MTRR_SLC30A5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneMTRRQ9UBK8DB00200HydroxocobalaminMethionine synthase reductasesmall moleculeapproved
HgeneMTRRQ9UBK8DB00115CyanocobalaminMethionine synthase reductasesmall moleculeapproved|nutraceutical
HgeneMTRRQ9UBK8DB00134MethionineMethionine synthase reductasesmall moleculeapproved|nutraceutical

Top

RelatedDiseases for MTRR_SLC30A5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMTRRC0009404Colorectal Neoplasms2CTD_human
HgeneMTRRC0019880Homocystinuria2CTD_human;HPO
HgeneMTRRC0598608Hyperhomocysteinemia2CTD_human
HgeneMTRRC0001430Adenoma1CTD_human
HgeneMTRRC0021364Male infertility1CTD_human
HgeneMTRRC0027765nervous system disorder1CTD_human
HgeneMTRRC0041755Adverse reaction to drug1CTD_human
HgeneMTRRC1856057Homocystinuria-Megaloblastic Anemia due to Defect in Cobalamin Metabolism, CblE Complementation Type1CTD_human;ORPHANET;UNIPROT
HgeneMTRRC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human