FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22645

FusionGeneSummary for MSI2_TRIM25

check button Fusion gene summary
Fusion gene informationFusion gene name: MSI2_TRIM25
Fusion gene ID: 22645
HgeneTgene
Gene symbol

MSI2

TRIM25

Gene ID

124540

7706

Gene namemusashi RNA binding protein 2tripartite motif containing 25
SynonymsMSI2HEFP|RNF147|Z147|ZNF147
Cytomap

17q22

17q22

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein Musashi homolog 2musashi homolog 2musashi-2E3 ubiquitin/ISG15 ligase TRIM25RING finger protein 147RING-type E3 ubiquitin transferaseRING-type E3 ubiquitin transferase TRIM25estrogen-responsive finger proteintripartite motif protein TRIM25tripartite motif-containing protein 25ubiquitin/ISG15
Modification date2018052320180522
UniProtAcc

Q96DH6

Q14258

Ensembl transtripts involved in fusion geneENST00000416426, ENST00000284073, 
ENST00000322684, ENST00000442934, 
ENST00000579180, ENST00000579505, 
ENST00000316881, ENST00000573108, 
ENST00000537230, 
Fusion gene scores* DoF score29 X 8 X 12=27844 X 5 X 2=40
# samples 295
** MAII scorelog2(29/2784*10)=-3.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/40*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MSI2 [Title/Abstract] AND TRIM25 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTRIM25

GO:0043123

positive regulation of I-kappaB kinase/NF-kappaB signaling

23077300

TgeneTRIM25

GO:0043627

response to estrogen

22452784

TgeneTRIM25

GO:0045087

innate immune response

18248090

TgeneTRIM25

GO:0046596

regulation of viral entry into host cell

18248090


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12M-01AMSI2chr17

55339553

+TRIM25chr17

54985924

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000416426ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000416426ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000416426ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-
In-frameENST00000284073ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000284073ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000284073ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-
In-frameENST00000322684ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000322684ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
5CDS-intronENST00000322684ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-3CDSENST00000442934ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000442934ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000442934ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-3CDSENST00000579180ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000579180ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000579180ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-3CDSENST00000579505ENST00000316881MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000579505ENST00000573108MSI2chr17

55339553

+TRIM25chr17

54985924

-
intron-intronENST00000579505ENST00000537230MSI2chr17

55339553

+TRIM25chr17

54985924

-

Top

FusionProtFeatures for MSI2_TRIM25


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MSI2

Q96DH6

TRIM25

Q14258

RNA binding protein that regulates the expression oftarget mRNAs at the translation level. May play a role in theproliferation and maintenance of stem cells in the central nervoussystem (By similarity). {ECO:0000250}. Functions as a ubiquitin E3 ligase and as an ISG15 E3ligase. Involved in innate immune defense against viruses bymediating ubiquitination of DDX58. Mediates 'Lys-63'-linkedpolyubiquitination of the DDX58 N-terminal CARD-like region whichis crucial for triggering the cytosolic signal transduction thatleads to the production of interferons in response to viralinfection. Promotes ISGylation of 14-3-3 sigma (SFN), an adapterprotein implicated in the regulation of a large spectrum signalingpathway. Mediates estrogen action in various target organs.Mediates the ubiquitination and subsequent proteasomal degradationof ZFHX3 (PubMed:22452784). {ECO:0000269|PubMed:16352599,ECO:0000269|PubMed:17069755, ECO:0000269|PubMed:17392790,ECO:0000269|PubMed:22452784}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTRIM25chr17:55339553chr17:54985924ENST00000316881-09217_307199631Coiled coilOntology_term=ECO:0000255
TgeneTRIM25chr17:55339553chr17:54985924ENST00000537230-010217_307199684Coiled coilOntology_term=ECO:0000255
TgeneTRIM25chr17:55339553chr17:54985924ENST00000316881-09439_630199631DomainB30.2/SPRY
TgeneTRIM25chr17:55339553chr17:54985924ENST00000537230-010439_630199684DomainB30.2/SPRY

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMSI2chr17:55339553chr17:54985924ENST00000284073+514253_2601041951Compositional biasNote=Poly-Ala
HgeneMSI2chr17:55339553chr17:54985924ENST00000322684+410253_260100252Compositional biasNote=Poly-Ala
HgeneMSI2chr17:55339553chr17:54985924ENST00000579180+17253_260-35152Compositional biasNote=Poly-Ala
HgeneMSI2chr17:55339553chr17:54985924ENST00000284073+514110_1871041951DomainRRM 2
HgeneMSI2chr17:55339553chr17:54985924ENST00000284073+51421_1111041951DomainRRM 1
HgeneMSI2chr17:55339553chr17:54985924ENST00000322684+410110_187100252DomainRRM 2
HgeneMSI2chr17:55339553chr17:54985924ENST00000322684+41021_111100252DomainRRM 1
HgeneMSI2chr17:55339553chr17:54985924ENST00000579180+17110_187-35152DomainRRM 2
HgeneMSI2chr17:55339553chr17:54985924ENST00000579180+1721_111-35152DomainRRM 1
TgeneTRIM25chr17:55339553chr17:54985924ENST00000316881-0913_54199631Zinc fingerRING-type
TgeneTRIM25chr17:55339553chr17:54985924ENST00000537230-01013_54199684Zinc fingerRING-type


Top

FusionGeneSequence for MSI2_TRIM25


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MSI2_ENST00000416426_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_514aa
MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKATLRHKLT
VMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQ
SLTKRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTPSSGDPGEHDPASTHKSTRPVKKVSKEE
KKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGLEAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYT
VASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISAWHNNVEK

>In-frame_MSI2_ENST00000284073_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_536aa
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKT
IDPKVAFPRRAQPKATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFD
TIYQILLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTPSSGDP
GEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGLEAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEY
YIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRN

>In-frame_MSI2_ENST00000322684_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_532aa
MADLTSVLTSVMFSPSSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPK
VAFPRRAQPKATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQ
ILLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTPSSGDPGEHD
PASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGLEAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKV
ILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MSI2_ENST00000416426_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_1542nt
ATGTTTATCGGTGGACTGAGCTGGCAGACCTCACCAGATAGCCTTAGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTATGGTC
ATGAGAGATCCCACTACGAAACGCTCCAGAGGCTTCGGTTTCGTCACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTCAGCCC
CACCATGAGTTAGATTCCAAGACGATTGACCCCAAAGTTGCATTTCCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAACTAACT
GTCATGTACAGTCAGATCAACGGGGCGTCGAGAGCACTGGATGATGTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACAGAAAG
GTGGAGCAGCTACAACAAGAATACACGGAAATGAAGGCTCTCTTGGACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAGAGGAG
AAGAGGGTCAACAGCAAGTTTGACACCATTTATCAGATTCTCCTCAAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTGAACAG
AGCCTGACCAAGAGGGATGAGTTCGAGTTTCTGGAGAAAGCATCAAAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCGAGGTG
GAACTGAACCACAAGCTGATAAAAGGCATCCACCAGAGCACCATAGACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCCAGGAG
CCCACCCCCAGTTCAGGTGACCCTGGAGAGCATGACCCAGCGTCCACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAGAGGAA
AAGAAATCCAAGAAACCTCCCCCTGTCCCTGCCTTACCCAGCAAGCTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAAAACAA
GCTGGCTTGGAGGCTGCAGCCAAAGCCACCAGCTCACATCCGAACTCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGGCCAAG
TCCAGACCTGAGCTCCTGGAGTATTACATTAAAGTCATCCTGGACTACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCTATACA
GTAGCTTCTGTGGCTGAGATGCCTCAGAACTACCGGCCGCATCCCCAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACTGCTAC
AAGAAGGGGATCCACTACTGGGAGGTGGAGCTGCAGAAGAACAACTTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGCAGGGC
CCAGAAAGCAGGCTCGGCCGCAACAGCGCCTCCTGGTGCGTGGAGTGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGGAGAAA
ACCCTGCCCTCCACCAAGGCCACGCGGGTGGGCGTGCTTCTCAACTGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACAAGGTC
CACCTGATGTATAAGTTCAGGGTGGACTTTACTGAGGCTTTGTACCCGGCTTTCTGGGTATTTTCTGCTGGTGCCACACTCTCCATCTGC

>In-frame_MSI2_ENST00000284073_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_1608nt
ATGGAGGCAAATGGGAGCCAAGGCACCTCGGGCAGCGCCAACGACTCCCAGCACGACCCCGGTAAAATGTTTATCGGTGGACTGAGCTGG
CAGACCTCACCAGATAGCCTTAGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTATGGTCATGAGAGATCCCACTACGAAACGC
TCCAGAGGCTTCGGTTTCGTCACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTCAGCCCCACCATGAGTTAGATTCCAAGACG
ATTGACCCCAAAGTTGCATTTCCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAACTAACTGTCATGTACAGTCAGATCAACGGG
GCGTCGAGAGCACTGGATGATGTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACAGAAAGGTGGAGCAGCTACAACAAGAATAC
ACGGAAATGAAGGCTCTCTTGGACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAGAGGAGAAGAGGGTCAACAGCAAGTTTGAC
ACCATTTATCAGATTCTCCTCAAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTGAACAGAGCCTGACCAAGAGGGATGAGTTC
GAGTTTCTGGAGAAAGCATCAAAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCGAGGTGGAACTGAACCACAAGCTGATAAAA
GGCATCCACCAGAGCACCATAGACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCCAGGAGCCCACCCCCAGTTCAGGTGACCCT
GGAGAGCATGACCCAGCGTCCACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAGAGGAAAAGAAATCCAAGAAACCTCCCCCT
GTCCCTGCCTTACCCAGCAAGCTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAAAACAAGCTGGCTTGGAGGCTGCAGCCAAA
GCCACCAGCTCACATCCGAACTCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGGCCAAGTCCAGACCTGAGCTCCTGGAGTAT
TACATTAAAGTCATCCTGGACTACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCTATACAGTAGCTTCTGTGGCTGAGATGCCT
CAGAACTACCGGCCGCATCCCCAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACTGCTACAAGAAGGGGATCCACTACTGGGAG
GTGGAGCTGCAGAAGAACAACTTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGCAGGGCCCAGAAAGCAGGCTCGGCCGCAAC
AGCGCCTCCTGGTGCGTGGAGTGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGGAGAAAACCCTGCCCTCCACCAAGGCCACG
CGGGTGGGCGTGCTTCTCAACTGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACAAGGTCCACCTGATGTATAAGTTCAGGGTG

>In-frame_MSI2_ENST00000322684_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_1596nt
ATGGCCGATCTGACATCGGTGCTCACTTCTGTTATGTTTTCTCCCTCTAGTAAAATGTTTATCGGTGGACTGAGCTGGCAGACCTCACCA
GATAGCCTTAGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTATGGTCATGAGAGATCCCACTACGAAACGCTCCAGAGGCTTC
GGTTTCGTCACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTCAGCCCCACCATGAGTTAGATTCCAAGACGATTGACCCCAAA
GTTGCATTTCCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAACTAACTGTCATGTACAGTCAGATCAACGGGGCGTCGAGAGCA
CTGGATGATGTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACAGAAAGGTGGAGCAGCTACAACAAGAATACACGGAAATGAAG
GCTCTCTTGGACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAGAGGAGAAGAGGGTCAACAGCAAGTTTGACACCATTTATCAG
ATTCTCCTCAAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTGAACAGAGCCTGACCAAGAGGGATGAGTTCGAGTTTCTGGAG
AAAGCATCAAAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCGAGGTGGAACTGAACCACAAGCTGATAAAAGGCATCCACCAG
AGCACCATAGACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCCAGGAGCCCACCCCCAGTTCAGGTGACCCTGGAGAGCATGAC
CCAGCGTCCACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAGAGGAAAAGAAATCCAAGAAACCTCCCCCTGTCCCTGCCTTA
CCCAGCAAGCTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAAAACAAGCTGGCTTGGAGGCTGCAGCCAAAGCCACCAGCTCA
CATCCGAACTCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGGCCAAGTCCAGACCTGAGCTCCTGGAGTATTACATTAAAGTC
ATCCTGGACTACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCTATACAGTAGCTTCTGTGGCTGAGATGCCTCAGAACTACCGG
CCGCATCCCCAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACTGCTACAAGAAGGGGATCCACTACTGGGAGGTGGAGCTGCAG
AAGAACAACTTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGCAGGGCCCAGAAAGCAGGCTCGGCCGCAACAGCGCCTCCTGG
TGCGTGGAGTGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGGAGAAAACCCTGCCCTCCACCAAGGCCACGCGGGTGGGCGTG
CTTCTCAACTGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACAAGGTCCACCTGATGTATAAGTTCAGGGTGGACTTTACTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MSI2_ENST00000416426_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_5468nt
AGAGCCAGAGAGAACTTCCAGCGCAAAAGGAAAATAAAACTTGTGGCTGGTGTTTGTGCAGGAGGGTCTCCGCCATCCTGAAGCCCCCCG
ATCCTGGGGCGTCTCGGGGGCCGCCAAAGGAGCGCCAGGGTTAAAATGTTTATCGGTGGACTGAGCTGGCAGACCTCACCAGATAGCCTT
AGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTATGGTCATGAGAGATCCCACTACGAAACGCTCCAGAGGCTTCGGTTTCGTC
ACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTCAGCCCCACCATGAGTTAGATTCCAAGACGATTGACCCCAAAGTTGCATTT
CCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAACTAACTGTCATGTACAGTCAGATCAACGGGGCGTCGAGAGCACTGGATGAT
GTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACAGAAAGGTGGAGCAGCTACAACAAGAATACACGGAAATGAAGGCTCTCTTG
GACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAGAGGAGAAGAGGGTCAACAGCAAGTTTGACACCATTTATCAGATTCTCCTC
AAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTGAACAGAGCCTGACCAAGAGGGATGAGTTCGAGTTTCTGGAGAAAGCATCA
AAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCGAGGTGGAACTGAACCACAAGCTGATAAAAGGCATCCACCAGAGCACCATA
GACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCCAGGAGCCCACCCCCAGTTCAGGTGACCCTGGAGAGCATGACCCAGCGTCC
ACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAGAGGAAAAGAAATCCAAGAAACCTCCCCCTGTCCCTGCCTTACCCAGCAAG
CTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAAAACAAGCTGGCTTGGAGGCTGCAGCCAAAGCCACCAGCTCACATCCGAAC
TCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGGCCAAGTCCAGACCTGAGCTCCTGGAGTATTACATTAAAGTCATCCTGGAC
TACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCTATACAGTAGCTTCTGTGGCTGAGATGCCTCAGAACTACCGGCCGCATCCC
CAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACTGCTACAAGAAGGGGATCCACTACTGGGAGGTGGAGCTGCAGAAGAACAAC
TTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGCAGGGCCCAGAAAGCAGGCTCGGCCGCAACAGCGCCTCCTGGTGCGTGGAG
TGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGGAGAAAACCCTGCCCTCCACCAAGGCCACGCGGGTGGGCGTGCTTCTCAAC
TGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACAAGGTCCACCTGATGTATAAGTTCAGGGTGGACTTTACTGAGGCTTTGTAC
CCGGCTTTCTGGGTATTTTCTGCTGGTGCCACACTCTCCATCTGCTCCCCCAAGTAGGCAGGCTGTAGGCACTTGGGCTGACTGCCTGCA
GAAGTCCCAAGACCCTAGTGAAAATACAGCAGGCAGAACTCTCCTTGGATAATTCCCCAAGAGGTCCCAAGGATTGGGAGCATGGGAGGG
GAGCTGGCGGGAGGGTGGGAGGTGGGATTTAGCCAGGAAAGGGGTGAGAGTGATTGTGTTGTGGGCGAGGAGGCGTTTCCACCCCCTGGT
GCCTATCAGGGCAGGGTGACCTACTCCCCATTGTTCTGGAAATCTCCAGGCTGCTGGGCAGCTGGGCAGAGCTCTGGGAAGTGAAGTCAT
GAGTGCCCGATTCCTCTTAGAGAAAATCCATAGCTACTGTAGGTTCTGTCTTGGGCCACTTGGATCTGAAGGCTGCCCCTTTGCTCTCTG
GGGTAGCCTTCAGATCTTGGTGTTTTGAATTCTTACTATAGATGTTTTTAAAGTTCCAAAGTCATTGAGTTTCAATGTTACATAAACTCC
ATTACCCGCATGTTGGGGCTTGATCTCCTGGTTATTATCTGTGCTTGAGGAAACACCCACAGCAGTCTCTACCCAGAACAGTTTCCTAAA
GAGGCATACCCTCTTCCTCCACTGGAAAATAGTGCGTTCCCTTCCTACCCTGCACACCCATCGCCCCCACATTGATGGTTTTCAAACAGC
AAACTTTTCAGCTAAAGCTTCAAACCATGATTGGAATCAGCCTGTGTTGGATTTGTGATTCAGGGTCATGGTGACCCTGATCCAGTTTGG
GTGGAAATCCTTCCTAAGTATCATAAGAAGCATCTTGGCAGAGATGCTTTGGTGGCAGCCATGAGCTTTGCTGGAGGCCTTGCTTCCCAT
AGCCTTGGCTGTGGGGCAAGGAACTCTGCCAGGCGAGGGGGATGCTGCCCTGGATCAACAGAAGCCTGGTGGGTTTGCTCGTGTTAGAGT
GTCCTGCCTTCTTACTGACAACTCTTCTCGGTGATAGCCTCTCTTCCCTGGATTGTGACATATGGAATGACAGTGCAGGTACCACCGAGG
CTAGCACAGTCAAGCCTCCAGCTAAGCTGGATCCCTGAAGCCTGCTATCATGCAGACAGGCTATGCGGCTGCCTCGGACCATGCTAGGCC
ACTTGCTGGGGTGTCAACCTACCACCAAAGGGGTCTTTTAGCAAACCTCATGGGGAACAGGAACATTCCTGTTCATCCCTGGCCACAGGC
TGCAGACCCAGCACTGGCCCTTGCGTGAGTCAGAGCCTGGGGCTGGCCCTAGCCCCTTCTACTGACTTCCTCATTTAAGCCAATTATATA
AGCTCACATTGATCAGGGAGGGAGGGAAAGAGCTAAAGAGGGTCACACAAGTGGCTATTTTCCCTGCAGTGTTTCTGTGTGGTGAAAATA
ACCCAGTCCACTAAGGGGCGGGAGTGAATGGATGGCTGGATTTTCCCCAAGCTCCTTATAGCCTAATGTTGTCAGGATGTGAGTATGAGG
AATTTAGCCTCTTATAGTGAAATGAGTCCAACTCTGGGCTTTGCTTAGAGGAGAGCTCCTGTCAGGCTTCCTATAATATGAAAAGAAGTC
ACCATTGGGGAACTAGAGACCCCAGACCTTTTCATATGGATATTTGAGAATGTAATGCATCTCAGGCCTCGTGCTGGAACTCTAGGGCAC
TCTAGGCAGGCTCAGAACACTTGATATTCCTGACAGCTACACACCTGACATGCAGGTACATACCTGATCGGTGTCATCTCCTAACAAGGA
TTTTCAGTTCCTCGGGAGAGCAATAATCTTTGTAGGAAAGACATCCCTGCAATAGGTGATATGTGGTCCTTAGAAGTTTTATTCCTTTAC
TACTTGGAAGAAAAGTTCTTTGGTGATTCTTCTCTGCTTTTGAAGATGATCAAAAGCATCTTCATTGATTTTCTGAAACGAAAGCCTTGT
CTGAAACCAATTAATACTTGGGAAACAGCTGGGCTTGGAGGAGTAGAATGCCAGAGATAAATCCATGGCTCCTGCTCTGGCTCTCTTCTG
CAGAAATGAGGGCAACAGTGAGGCCACTTCCCTGGCAAATGTGCAGCTCAGGATAGGGAAGCATAAGACCCTCTGTTTAAAAGAGAGTCA
AGTAGGTAACCAAAGCCAAGCTCTGTGCAAGGTGCTTTGGAGTTGTAAATTGAGGAGTGCATCCTTGCTGTCTTGAACCATTCTGTTTGC
AATGGTGAGACCTTACATAACCTAGCCTTGCAGGGCCGCCACACAACCCTGGAGTCCTAGAGTTGGAGGAACCTTTGTATCCATCTGACT
TCTCATTTTGCAGAATATGATGAGAAAGTAGAGGATCGCTCTGTTCACCACTCTTGCTATTCCATTAGTGGGGAGATGCCTGCTAGCATG
TGTGAGGGGAACACTCTGATACACTGGGAAGTATCGGAAATTCCCAGAAACACAAACATAAAATAACTCTCCTAGACCCAGGTACTGGGG
ACTGTCTCAGTCCGTGTGGCATGATAAATAAAAGGTTAGGATCAAGTCTTTGTATTTTTCAAGATGTGGTAGCTGATTATTCCTGTTTTA
AGTACTCTGAAATTGATCTGTGATCAATAATACTAATATGTTATCTTTTACCGTATTCTGCCTCTCACTATTGATTTTAATTAGTTAGGA
GTATTTGAGCTGTTATTTCTTGAGCTTAATATTTTTTTAGAGTTAACTCTTTAAGGAGATAATCATGGCTGTAGACAAGGCCAGGGCTGG
CTGACGTGCCTTAGAAGGTTTGAATGCAATAAAGCGGTGTTTGGCGTTCTCCTGCATTGTAGTGCGGGTACAAAATGCTATTTGTTCGTC
ATACTGTTGTCAGCAGATGAGCCGCCCACTACAGACGGCTACTGCCCAGGGACCTGCCCAGGCCCCACCCAAGGGCTCCCAAGGGTTGAG
ATTTCTGCAGACCTATAGCCAGCACACTTAGTCCTGCCCTATATAGAGTTCCTCTTCGGGAAGCTTTTGATAAGGAATTCTCAGACCGAT
AGGATGTCTGTCTGGGCTTTGCTGCGGGACAGTCTAACTGTGGGGGCTAGGGGAAAGCAGGAGAGTATCGATCAAAGAGTAAGCCACACA
CGGATAATCAGTTACTAGGGATGGAGGTGTGAGGGTTCATTATATTATTCATTTTACTGTTGTATATGTTTGAAAATGTCTATAATAAAA
AGCTTTAAAAAAAAAAAAGAAACAAAAATAGTTCAGGCCAGCAATGGGCCCTCCATGTTCAGTGGATTTTATCCTTGTTTCAATTGGGGT
AGGAGTTCCAGGAGGTGTGGATTGGAGGTTGTCTAAAGAATTGAACTGGCCTTTGTCCCTGCTTCCTGGGAGGGAGACTTTCAGTCCTTG
ACATTTCCAGGGTAATAGGAGTGTCTTTGTTATTTGTGAGGCCATGGGATCACACCTGAGCTTATGCTAAAAGGTGGGATGACTCAGAGC
TGGGGCTGGTCACCAGACAGACTGACCATGTGATTAGAGGTTTGAGGCTTTGAGTCAGCCTGACCTATGGGGCGGGGGACTGGAGGCTGA
GTTTAATCATCTGGCCAGTGCTTTAATCAGTACATCATGAAACCCTAATAAAAACTCTGGACACTAAAGCTCAGCATAGCTTCCTGGGTG
GTGAAGCTGTGGCTATGCCGGCAGGGCAGTGTGCCCTAATTCCACGAAGAGGGGGCATGGGAGCACTGTGCTCAAGACCCTTCCAGACCT

>In-frame_MSI2_ENST00000284073_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_5608nt
CGGGGCTGAGCTAAGCCGAGCCCACGTGTGACGGCTCTCGCCGCTGCCCCGGCTCCGCCGCTCGCAGAGAGATTCGGAGGAGCCCGGGCG
GGGGGGAGGAGGAGGGGGAGGAGGGAGCGGAGATCTCGGGGCTCGGAGCCGGCCGCCGCTCCGCTCCGATCGCTGTGGGGCTTGGTTTTT
TGGGGGTGGGGGGGCGGGGGGGCTCAGATATGGAGGCAAATGGGAGCCAAGGCACCTCGGGCAGCGCCAACGACTCCCAGCACGACCCCG
GTAAAATGTTTATCGGTGGACTGAGCTGGCAGACCTCACCAGATAGCCTTAGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTA
TGGTCATGAGAGATCCCACTACGAAACGCTCCAGAGGCTTCGGTTTCGTCACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTC
AGCCCCACCATGAGTTAGATTCCAAGACGATTGACCCCAAAGTTGCATTTCCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAAC
TAACTGTCATGTACAGTCAGATCAACGGGGCGTCGAGAGCACTGGATGATGTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACA
GAAAGGTGGAGCAGCTACAACAAGAATACACGGAAATGAAGGCTCTCTTGGACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAG
AGGAGAAGAGGGTCAACAGCAAGTTTGACACCATTTATCAGATTCTCCTCAAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTG
AACAGAGCCTGACCAAGAGGGATGAGTTCGAGTTTCTGGAGAAAGCATCAAAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCG
AGGTGGAACTGAACCACAAGCTGATAAAAGGCATCCACCAGAGCACCATAGACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCC
AGGAGCCCACCCCCAGTTCAGGTGACCCTGGAGAGCATGACCCAGCGTCCACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAG
AGGAAAAGAAATCCAAGAAACCTCCCCCTGTCCCTGCCTTACCCAGCAAGCTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAA
AACAAGCTGGCTTGGAGGCTGCAGCCAAAGCCACCAGCTCACATCCGAACTCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGG
CCAAGTCCAGACCTGAGCTCCTGGAGTATTACATTAAAGTCATCCTGGACTACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCT
ATACAGTAGCTTCTGTGGCTGAGATGCCTCAGAACTACCGGCCGCATCCCCAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACT
GCTACAAGAAGGGGATCCACTACTGGGAGGTGGAGCTGCAGAAGAACAACTTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGC
AGGGCCCAGAAAGCAGGCTCGGCCGCAACAGCGCCTCCTGGTGCGTGGAGTGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGG
AGAAAACCCTGCCCTCCACCAAGGCCACGCGGGTGGGCGTGCTTCTCAACTGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACA
AGGTCCACCTGATGTATAAGTTCAGGGTGGACTTTACTGAGGCTTTGTACCCGGCTTTCTGGGTATTTTCTGCTGGTGCCACACTCTCCA
TCTGCTCCCCCAAGTAGGCAGGCTGTAGGCACTTGGGCTGACTGCCTGCAGAAGTCCCAAGACCCTAGTGAAAATACAGCAGGCAGAACT
CTCCTTGGATAATTCCCCAAGAGGTCCCAAGGATTGGGAGCATGGGAGGGGAGCTGGCGGGAGGGTGGGAGGTGGGATTTAGCCAGGAAA
GGGGTGAGAGTGATTGTGTTGTGGGCGAGGAGGCGTTTCCACCCCCTGGTGCCTATCAGGGCAGGGTGACCTACTCCCCATTGTTCTGGA
AATCTCCAGGCTGCTGGGCAGCTGGGCAGAGCTCTGGGAAGTGAAGTCATGAGTGCCCGATTCCTCTTAGAGAAAATCCATAGCTACTGT
AGGTTCTGTCTTGGGCCACTTGGATCTGAAGGCTGCCCCTTTGCTCTCTGGGGTAGCCTTCAGATCTTGGTGTTTTGAATTCTTACTATA
GATGTTTTTAAAGTTCCAAAGTCATTGAGTTTCAATGTTACATAAACTCCATTACCCGCATGTTGGGGCTTGATCTCCTGGTTATTATCT
GTGCTTGAGGAAACACCCACAGCAGTCTCTACCCAGAACAGTTTCCTAAAGAGGCATACCCTCTTCCTCCACTGGAAAATAGTGCGTTCC
CTTCCTACCCTGCACACCCATCGCCCCCACATTGATGGTTTTCAAACAGCAAACTTTTCAGCTAAAGCTTCAAACCATGATTGGAATCAG
CCTGTGTTGGATTTGTGATTCAGGGTCATGGTGACCCTGATCCAGTTTGGGTGGAAATCCTTCCTAAGTATCATAAGAAGCATCTTGGCA
GAGATGCTTTGGTGGCAGCCATGAGCTTTGCTGGAGGCCTTGCTTCCCATAGCCTTGGCTGTGGGGCAAGGAACTCTGCCAGGCGAGGGG
GATGCTGCCCTGGATCAACAGAAGCCTGGTGGGTTTGCTCGTGTTAGAGTGTCCTGCCTTCTTACTGACAACTCTTCTCGGTGATAGCCT
CTCTTCCCTGGATTGTGACATATGGAATGACAGTGCAGGTACCACCGAGGCTAGCACAGTCAAGCCTCCAGCTAAGCTGGATCCCTGAAG
CCTGCTATCATGCAGACAGGCTATGCGGCTGCCTCGGACCATGCTAGGCCACTTGCTGGGGTGTCAACCTACCACCAAAGGGGTCTTTTA
GCAAACCTCATGGGGAACAGGAACATTCCTGTTCATCCCTGGCCACAGGCTGCAGACCCAGCACTGGCCCTTGCGTGAGTCAGAGCCTGG
GGCTGGCCCTAGCCCCTTCTACTGACTTCCTCATTTAAGCCAATTATATAAGCTCACATTGATCAGGGAGGGAGGGAAAGAGCTAAAGAG
GGTCACACAAGTGGCTATTTTCCCTGCAGTGTTTCTGTGTGGTGAAAATAACCCAGTCCACTAAGGGGCGGGAGTGAATGGATGGCTGGA
TTTTCCCCAAGCTCCTTATAGCCTAATGTTGTCAGGATGTGAGTATGAGGAATTTAGCCTCTTATAGTGAAATGAGTCCAACTCTGGGCT
TTGCTTAGAGGAGAGCTCCTGTCAGGCTTCCTATAATATGAAAAGAAGTCACCATTGGGGAACTAGAGACCCCAGACCTTTTCATATGGA
TATTTGAGAATGTAATGCATCTCAGGCCTCGTGCTGGAACTCTAGGGCACTCTAGGCAGGCTCAGAACACTTGATATTCCTGACAGCTAC
ACACCTGACATGCAGGTACATACCTGATCGGTGTCATCTCCTAACAAGGATTTTCAGTTCCTCGGGAGAGCAATAATCTTTGTAGGAAAG
ACATCCCTGCAATAGGTGATATGTGGTCCTTAGAAGTTTTATTCCTTTACTACTTGGAAGAAAAGTTCTTTGGTGATTCTTCTCTGCTTT
TGAAGATGATCAAAAGCATCTTCATTGATTTTCTGAAACGAAAGCCTTGTCTGAAACCAATTAATACTTGGGAAACAGCTGGGCTTGGAG
GAGTAGAATGCCAGAGATAAATCCATGGCTCCTGCTCTGGCTCTCTTCTGCAGAAATGAGGGCAACAGTGAGGCCACTTCCCTGGCAAAT
GTGCAGCTCAGGATAGGGAAGCATAAGACCCTCTGTTTAAAAGAGAGTCAAGTAGGTAACCAAAGCCAAGCTCTGTGCAAGGTGCTTTGG
AGTTGTAAATTGAGGAGTGCATCCTTGCTGTCTTGAACCATTCTGTTTGCAATGGTGAGACCTTACATAACCTAGCCTTGCAGGGCCGCC
ACACAACCCTGGAGTCCTAGAGTTGGAGGAACCTTTGTATCCATCTGACTTCTCATTTTGCAGAATATGATGAGAAAGTAGAGGATCGCT
CTGTTCACCACTCTTGCTATTCCATTAGTGGGGAGATGCCTGCTAGCATGTGTGAGGGGAACACTCTGATACACTGGGAAGTATCGGAAA
TTCCCAGAAACACAAACATAAAATAACTCTCCTAGACCCAGGTACTGGGGACTGTCTCAGTCCGTGTGGCATGATAAATAAAAGGTTAGG
ATCAAGTCTTTGTATTTTTCAAGATGTGGTAGCTGATTATTCCTGTTTTAAGTACTCTGAAATTGATCTGTGATCAATAATACTAATATG
TTATCTTTTACCGTATTCTGCCTCTCACTATTGATTTTAATTAGTTAGGAGTATTTGAGCTGTTATTTCTTGAGCTTAATATTTTTTTAG
AGTTAACTCTTTAAGGAGATAATCATGGCTGTAGACAAGGCCAGGGCTGGCTGACGTGCCTTAGAAGGTTTGAATGCAATAAAGCGGTGT
TTGGCGTTCTCCTGCATTGTAGTGCGGGTACAAAATGCTATTTGTTCGTCATACTGTTGTCAGCAGATGAGCCGCCCACTACAGACGGCT
ACTGCCCAGGGACCTGCCCAGGCCCCACCCAAGGGCTCCCAAGGGTTGAGATTTCTGCAGACCTATAGCCAGCACACTTAGTCCTGCCCT
ATATAGAGTTCCTCTTCGGGAAGCTTTTGATAAGGAATTCTCAGACCGATAGGATGTCTGTCTGGGCTTTGCTGCGGGACAGTCTAACTG
TGGGGGCTAGGGGAAAGCAGGAGAGTATCGATCAAAGAGTAAGCCACACACGGATAATCAGTTACTAGGGATGGAGGTGTGAGGGTTCAT
TATATTATTCATTTTACTGTTGTATATGTTTGAAAATGTCTATAATAAAAAGCTTTAAAAAAAAAAAAGAAACAAAAATAGTTCAGGCCA
GCAATGGGCCCTCCATGTTCAGTGGATTTTATCCTTGTTTCAATTGGGGTAGGAGTTCCAGGAGGTGTGGATTGGAGGTTGTCTAAAGAA
TTGAACTGGCCTTTGTCCCTGCTTCCTGGGAGGGAGACTTTCAGTCCTTGACATTTCCAGGGTAATAGGAGTGTCTTTGTTATTTGTGAG
GCCATGGGATCACACCTGAGCTTATGCTAAAAGGTGGGATGACTCAGAGCTGGGGCTGGTCACCAGACAGACTGACCATGTGATTAGAGG
TTTGAGGCTTTGAGTCAGCCTGACCTATGGGGCGGGGGACTGGAGGCTGAGTTTAATCATCTGGCCAGTGCTTTAATCAGTACATCATGA
AACCCTAATAAAAACTCTGGACACTAAAGCTCAGCATAGCTTCCTGGGTGGTGAAGCTGTGGCTATGCCGGCAGGGCAGTGTGCCCTAAT
TCCACGAAGAGGGGGCATGGGAGCACTGTGCTCAAGACCCTTCCAGACCTTTCCCTGTGTCTTCCTTGGCTTGTGGAGCTGATTTGTATC

>In-frame_MSI2_ENST00000322684_chr17_55339553_+_TRIM25_ENST00000316881_chr17_54985924_-_5422nt
GCTTTCCTTTTAGCTTTTGTAAGTTACACGTCAAAATGGCCGATCTGACATCGGTGCTCACTTCTGTTATGTTTTCTCCCTCTAGTAAAA
TGTTTATCGGTGGACTGAGCTGGCAGACCTCACCAGATAGCCTTAGAGACTATTTTAGCAAATTTGGAGAAATTAGAGAATGTATGGTCA
TGAGAGATCCCACTACGAAACGCTCCAGAGGCTTCGGTTTCGTCACGTTCGCAGACCCAGCAAGTGTAGATAAAGTATTAGGTCAGCCCC
ACCATGAGTTAGATTCCAAGACGATTGACCCCAAAGTTGCATTTCCTCGTCGAGCGCAACCCAAGGCCACCCTGAGGCACAAACTAACTG
TCATGTACAGTCAGATCAACGGGGCGTCGAGAGCACTGGATGATGTGAGAAACAGGCAGCAGGATGTGCGGATGACTGCAAACAGAAAGG
TGGAGCAGCTACAACAAGAATACACGGAAATGAAGGCTCTCTTGGACGCCTCAGAGACCACCTCGACAAGGAAGATAAAGGAAGAGGAGA
AGAGGGTCAACAGCAAGTTTGACACCATTTATCAGATTCTCCTCAAGAAGAAGAGTGAGATCCAGACCTTGAAGGAGGAGATTGAACAGA
GCCTGACCAAGAGGGATGAGTTCGAGTTTCTGGAGAAAGCATCAAAACTGCGAGGAATCTCAACAAAGCCAGTCTACATCCCCGAGGTGG
AACTGAACCACAAGCTGATAAAAGGCATCCACCAGAGCACCATAGACCTCAAAAACGAGCTGAAGCAGTGCATCGGGCGGCTCCAGGAGC
CCACCCCCAGTTCAGGTGACCCTGGAGAGCATGACCCAGCGTCCACACACAAATCCACACGCCCTGTGAAGAAGGTCTCCAAAGAGGAAA
AGAAATCCAAGAAACCTCCCCCTGTCCCTGCCTTACCCAGCAAGCTTCCCACGTTTGGAGCCCCGGAACAGTTAGTGGATTTAAAACAAG
CTGGCTTGGAGGCTGCAGCCAAAGCCACCAGCTCACATCCGAACTCAACATCTCTCAAGGCCAAGGTGCTGGAGACCTTCCTGGCCAAGT
CCAGACCTGAGCTCCTGGAGTATTACATTAAAGTCATCCTGGACTACAACACCGCCCACAACAAAGTGGCTCTGTCAGAGTGCTATACAG
TAGCTTCTGTGGCTGAGATGCCTCAGAACTACCGGCCGCATCCCCAGAGGTTCACATACTGCTCTCAGGTGCTGGGCCTGCACTGCTACA
AGAAGGGGATCCACTACTGGGAGGTGGAGCTGCAGAAGAACAACTTCTGTGGGGTAGGCATCTGCTACGGAAGCATGAACCGGCAGGGCC
CAGAAAGCAGGCTCGGCCGCAACAGCGCCTCCTGGTGCGTGGAGTGGTTCAACACCAAGATCTCTGCCTGGCACAATAACGTGGAGAAAA
CCCTGCCCTCCACCAAGGCCACGCGGGTGGGCGTGCTTCTCAACTGTGACCACGGCTTTGTCATCTTCTTCGCTGTTGCCGACAAGGTCC
ACCTGATGTATAAGTTCAGGGTGGACTTTACTGAGGCTTTGTACCCGGCTTTCTGGGTATTTTCTGCTGGTGCCACACTCTCCATCTGCT
CCCCCAAGTAGGCAGGCTGTAGGCACTTGGGCTGACTGCCTGCAGAAGTCCCAAGACCCTAGTGAAAATACAGCAGGCAGAACTCTCCTT
GGATAATTCCCCAAGAGGTCCCAAGGATTGGGAGCATGGGAGGGGAGCTGGCGGGAGGGTGGGAGGTGGGATTTAGCCAGGAAAGGGGTG
AGAGTGATTGTGTTGTGGGCGAGGAGGCGTTTCCACCCCCTGGTGCCTATCAGGGCAGGGTGACCTACTCCCCATTGTTCTGGAAATCTC
CAGGCTGCTGGGCAGCTGGGCAGAGCTCTGGGAAGTGAAGTCATGAGTGCCCGATTCCTCTTAGAGAAAATCCATAGCTACTGTAGGTTC
TGTCTTGGGCCACTTGGATCTGAAGGCTGCCCCTTTGCTCTCTGGGGTAGCCTTCAGATCTTGGTGTTTTGAATTCTTACTATAGATGTT
TTTAAAGTTCCAAAGTCATTGAGTTTCAATGTTACATAAACTCCATTACCCGCATGTTGGGGCTTGATCTCCTGGTTATTATCTGTGCTT
GAGGAAACACCCACAGCAGTCTCTACCCAGAACAGTTTCCTAAAGAGGCATACCCTCTTCCTCCACTGGAAAATAGTGCGTTCCCTTCCT
ACCCTGCACACCCATCGCCCCCACATTGATGGTTTTCAAACAGCAAACTTTTCAGCTAAAGCTTCAAACCATGATTGGAATCAGCCTGTG
TTGGATTTGTGATTCAGGGTCATGGTGACCCTGATCCAGTTTGGGTGGAAATCCTTCCTAAGTATCATAAGAAGCATCTTGGCAGAGATG
CTTTGGTGGCAGCCATGAGCTTTGCTGGAGGCCTTGCTTCCCATAGCCTTGGCTGTGGGGCAAGGAACTCTGCCAGGCGAGGGGGATGCT
GCCCTGGATCAACAGAAGCCTGGTGGGTTTGCTCGTGTTAGAGTGTCCTGCCTTCTTACTGACAACTCTTCTCGGTGATAGCCTCTCTTC
CCTGGATTGTGACATATGGAATGACAGTGCAGGTACCACCGAGGCTAGCACAGTCAAGCCTCCAGCTAAGCTGGATCCCTGAAGCCTGCT
ATCATGCAGACAGGCTATGCGGCTGCCTCGGACCATGCTAGGCCACTTGCTGGGGTGTCAACCTACCACCAAAGGGGTCTTTTAGCAAAC
CTCATGGGGAACAGGAACATTCCTGTTCATCCCTGGCCACAGGCTGCAGACCCAGCACTGGCCCTTGCGTGAGTCAGAGCCTGGGGCTGG
CCCTAGCCCCTTCTACTGACTTCCTCATTTAAGCCAATTATATAAGCTCACATTGATCAGGGAGGGAGGGAAAGAGCTAAAGAGGGTCAC
ACAAGTGGCTATTTTCCCTGCAGTGTTTCTGTGTGGTGAAAATAACCCAGTCCACTAAGGGGCGGGAGTGAATGGATGGCTGGATTTTCC
CCAAGCTCCTTATAGCCTAATGTTGTCAGGATGTGAGTATGAGGAATTTAGCCTCTTATAGTGAAATGAGTCCAACTCTGGGCTTTGCTT
AGAGGAGAGCTCCTGTCAGGCTTCCTATAATATGAAAAGAAGTCACCATTGGGGAACTAGAGACCCCAGACCTTTTCATATGGATATTTG
AGAATGTAATGCATCTCAGGCCTCGTGCTGGAACTCTAGGGCACTCTAGGCAGGCTCAGAACACTTGATATTCCTGACAGCTACACACCT
GACATGCAGGTACATACCTGATCGGTGTCATCTCCTAACAAGGATTTTCAGTTCCTCGGGAGAGCAATAATCTTTGTAGGAAAGACATCC
CTGCAATAGGTGATATGTGGTCCTTAGAAGTTTTATTCCTTTACTACTTGGAAGAAAAGTTCTTTGGTGATTCTTCTCTGCTTTTGAAGA
TGATCAAAAGCATCTTCATTGATTTTCTGAAACGAAAGCCTTGTCTGAAACCAATTAATACTTGGGAAACAGCTGGGCTTGGAGGAGTAG
AATGCCAGAGATAAATCCATGGCTCCTGCTCTGGCTCTCTTCTGCAGAAATGAGGGCAACAGTGAGGCCACTTCCCTGGCAAATGTGCAG
CTCAGGATAGGGAAGCATAAGACCCTCTGTTTAAAAGAGAGTCAAGTAGGTAACCAAAGCCAAGCTCTGTGCAAGGTGCTTTGGAGTTGT
AAATTGAGGAGTGCATCCTTGCTGTCTTGAACCATTCTGTTTGCAATGGTGAGACCTTACATAACCTAGCCTTGCAGGGCCGCCACACAA
CCCTGGAGTCCTAGAGTTGGAGGAACCTTTGTATCCATCTGACTTCTCATTTTGCAGAATATGATGAGAAAGTAGAGGATCGCTCTGTTC
ACCACTCTTGCTATTCCATTAGTGGGGAGATGCCTGCTAGCATGTGTGAGGGGAACACTCTGATACACTGGGAAGTATCGGAAATTCCCA
GAAACACAAACATAAAATAACTCTCCTAGACCCAGGTACTGGGGACTGTCTCAGTCCGTGTGGCATGATAAATAAAAGGTTAGGATCAAG
TCTTTGTATTTTTCAAGATGTGGTAGCTGATTATTCCTGTTTTAAGTACTCTGAAATTGATCTGTGATCAATAATACTAATATGTTATCT
TTTACCGTATTCTGCCTCTCACTATTGATTTTAATTAGTTAGGAGTATTTGAGCTGTTATTTCTTGAGCTTAATATTTTTTTAGAGTTAA
CTCTTTAAGGAGATAATCATGGCTGTAGACAAGGCCAGGGCTGGCTGACGTGCCTTAGAAGGTTTGAATGCAATAAAGCGGTGTTTGGCG
TTCTCCTGCATTGTAGTGCGGGTACAAAATGCTATTTGTTCGTCATACTGTTGTCAGCAGATGAGCCGCCCACTACAGACGGCTACTGCC
CAGGGACCTGCCCAGGCCCCACCCAAGGGCTCCCAAGGGTTGAGATTTCTGCAGACCTATAGCCAGCACACTTAGTCCTGCCCTATATAG
AGTTCCTCTTCGGGAAGCTTTTGATAAGGAATTCTCAGACCGATAGGATGTCTGTCTGGGCTTTGCTGCGGGACAGTCTAACTGTGGGGG
CTAGGGGAAAGCAGGAGAGTATCGATCAAAGAGTAAGCCACACACGGATAATCAGTTACTAGGGATGGAGGTGTGAGGGTTCATTATATT
ATTCATTTTACTGTTGTATATGTTTGAAAATGTCTATAATAAAAAGCTTTAAAAAAAAAAAAGAAACAAAAATAGTTCAGGCCAGCAATG
GGCCCTCCATGTTCAGTGGATTTTATCCTTGTTTCAATTGGGGTAGGAGTTCCAGGAGGTGTGGATTGGAGGTTGTCTAAAGAATTGAAC
TGGCCTTTGTCCCTGCTTCCTGGGAGGGAGACTTTCAGTCCTTGACATTTCCAGGGTAATAGGAGTGTCTTTGTTATTTGTGAGGCCATG
GGATCACACCTGAGCTTATGCTAAAAGGTGGGATGACTCAGAGCTGGGGCTGGTCACCAGACAGACTGACCATGTGATTAGAGGTTTGAG
GCTTTGAGTCAGCCTGACCTATGGGGCGGGGGACTGGAGGCTGAGTTTAATCATCTGGCCAGTGCTTTAATCAGTACATCATGAAACCCT
AATAAAAACTCTGGACACTAAAGCTCAGCATAGCTTCCTGGGTGGTGAAGCTGTGGCTATGCCGGCAGGGCAGTGTGCCCTAATTCCACG
AAGAGGGGGCATGGGAGCACTGTGCTCAAGACCCTTCCAGACCTTTCCCTGTGTCTTCCTTGGCTTGTGGAGCTGATTTGTATCCTTTAT


Top

FusionGenePPI for MSI2_TRIM25


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MSI2GRB2, H2AFX, CUL3, VCAM1, SOX2, TARDBP, RPA3, RPA2, RPA1, HNRNPH2, MEOX2, SUZ12, RNF2, BMI1, MRPL4, ICK, ANXA13, TIMM10B, RBFOX2, FKBP1A, CRIP1, CTSB, EIF3G, HNRNPA1, PABPC1, PABPC4, PIN1, STIP1, UFM1, WDR1, RAB7A, UBE2L3, NTRK1, CDK1, KIF21A, RHOBTB2, MDM2, TP53, ANKRD40, LOXL3, G3BP1, RNF157TRIM25TRIM25, SFN, UBE2L6, RARRES3, ESR1, DDX58, ERCC2, STK38, PITX2, UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2N, UBE2J2, GATA1, MEIS2, ZNF24, KLF5, RBCK1, RNF31, ZFHX3, ISG15, UBE2S, UBXN6, WARS, UAP1, USP39, OTUB2, VCP, TFG, TRAF6, TRIM8, GRIK2, HECW2, USP15, ACLY, KIF5B, UBA1, HSPA1L, EEF1A2, RPS27A, RPA1, HSPA1A, HSPA1B, PCNA, AMFR, CUL7, CCDC8, EZH2, SUZ12, RNF2, BMI1, SIRT6, DDX19B, TCEAL1, C9orf78, EEF1A1, FAM98B, LIX1L, PFKM, RNPEP, SCLY, SEC31A, C14orf166, C16orf62, CCDC22, CDA, COMMD4, PICALM, SARS, SMCHD1, TPD52L2, TSG101, TXNRD1, UROS, APC, FBXW7, IGF1R, PAX2, PTPRJ, STK11, XRCC3, MED4, MED20, LIN28A, MCM2, KMT2E, MIR363, MIRLET7A1, ZC3HAV1, UBC, UBE2V1, DERL1, ZNF746, CDH1, MAVS, CDK15, G3BP2, NCL, ERG, ARG1, RPL35, HIST1H1C, G3BP1, FAU, DSG1, RPS12, ELAVL1, HNRNPR, RPS17, CMSS1, RPL19, IGF2BP3, HNRNPAB, HNRNPA0, SERPINB12, TPI1, PRDX2, YBX1, LRPPRC, RPS9, RAP1A, AZGP1, RPL36AL, RPL13, RPL23A, RPL3, FAM83B, BLMH, RPL31, RPL36, RPL4, RPL37A, GAPDH, RPL6, RPS8, RPL17, DDX23, LTV1, RPL22, RPL15, SLC25A13, HAL, GNL3, HNRNPF, RPL27A, NOP16, RPS24, RPS13, HNRNPUL2, PPIA, SLC25A6, RPL7, RPS7, RPS3A, RPL18, RPL27, CD55, RPS4X, RPS15, RPL5, PABPC1, TAGLN2, IMPDH2, RPL30, RPL18A, MDH1, RPL32, RPL14, RPS15A, ASS1, ANXA5, MYL1, RPL13A, RPL8, RPS2, RPS25, PRPF19, GPRC5A, RPS23, RPS6, RPS16, JUP, SYNCRIP, ENO1, RPL35A, RPL7A, RPL10, FSCN1, HNRNPUL1, RPS14, PGAM1, PSMC5, PABPC4, ILF2, RPL10A, XPOT, PKP3, DHX9, ANXA2, POLR2B, HNRNPD, LDHB, TARS, DCAF13, UBTF, RPS26, ALPP, HNRNPC, MYO5C, RPL12, MAGED2, RBMX, NAP1L1, TRIP13, RPS19, DDX56, KLHDC10, LDHA, MAGEB2, DNTTIP2, PGK1, ILF3, RPL21, HNRNPL, NAT10, RPLP0, CHD4, GPC1, RPL11, PRPF6, WDR46, DDX5, GDI2, RPS11, PRDX1, EIF2S2, SF3B2, EEF2, HNRNPU, ALYREF, CUL4A, DDX27, AP3B1, PPP2CA, FAM83H, KPNA2, RPL9, PFN1, RPL34, DNAJA2, HNRNPA1, TOP1, RPSA, RBM39, IGF2BP1, ANXA1, FDPS, PKM, SLC1A5, ALDOA, EIF2S3, DDX10, RPS20, TRIM28, BRIX1, MYBBP1A, RPL38, MYO5A, RPL28, MCM7, MATR3, TGM1, RBBP4, GLTSCR2, EEF1G, RSL1D1, UPF1, ABCF2, EFTUD2, CCT3, S100A9, BAG6, TBL1X, BAG2, SERPINB3, HUWE1, LGALS7B, NPEPPS, HSPA8, CALML5, S100A8, CASP14, SQSTM1, ANKHD1, DNAJA1, EP300, SEC23A, TUBB2B, CDK1, DDB1, S100A7, DNAJB6, HSPA2, TUBB4B, TUBB2A, HSPB1, TMED10, ILK, IGHG1, RPS29, AHNAK, WDR77, PGAM2, PSMD1, CREBBP, EIF2B4, RPS10, YWHAZ, TUBB6, TUBB3, TNPO3, XPO7, TUBB4A, IGKC, LYZ, TMEM33, DDX20, SNRPD3, USP5, TCOF1, RAB5B, FUS, MYO5B, XRCC5, FCF1, TMED9, SYPL1, XRCC6, MYL12B, BCL9, UTP11L, PRKDC, MSH2, PRPF8, MYC, SLC7A5, MALAT1, MKNK2, RNU12, MIR3648-1, AACS, ABCA13, ABCB7, ABCC1, ABCC4, ABCD1, ABCD3, ABCF1, ABHD12, ABHD15-AS1, ABI2, ABL1, ABL2, ABLIM1, ABR, ABTB2, ACACA, ACADVL, ACO2, ACOT13, ACOT9, ACSL1, ACSL3, ACTG1P14, ACTN1, ACTN4, ADAM10, ADAM15, ADAP2, ADARB1, ADAT1, ADCY6, ADD1, GPR125, CD97, GPR113, LPHN1, ADIPOR1, ADNP, ADPGK, ADPGK-AS1, ADPRHL2, ADRA2C, ADRM1, ADSL, ADSS, AFAP1, AFAP1-AS1, AFAP1L1, AFF1, AFF4, AFG3L2, AGAP1, AGAP3, AGBL5, AGFG1, AGFG2, AGK, AGO2, AGPAT1, AGPAT2, AGTRAP, AHDC1, AHR, AIFM1, AK4, AKAP10, AKAP13, AKAP8L, AKIRIN1, AKT1S1, ALDH1L2, ALG8, ALG9, ALG9-IT1, ALKBH5, ALMS1, AMBRA1, ANAPC1, ANAPC11, ANAPC7, ANGEL2, ANKH, ANKHD1-EIF4EBP3, ANKLE2, ANKRD11, ANKRD13C, ANKRD19P, ANKRD28, ANKRD30BL, ANKRD33B, ANKRD52, ANKS1A, ANKS3, ANKS6, ANKUB1, ANLN, ANP32E, ANTXR1, ANXA6, ANXA8L1, AP1B1, AP1S1, AP2A1, AP2B1, AP2M1, AP3S2, APBB3, API5, APLP2, APOL2, APOLD1, APP, ARAP1, ARAP1-AS2, ARF3, ARFGEF2, ARFRP1, ARHGAP1, ARHGAP11A, ARHGAP27, ARHGAP32, ARHGAP39, ARHGAP4, ARHGEF11, ARHGEF12, ARHGEF34P, ARHGEF4, ARID1A, ARID1B, ARID2, ARID4B, ARIH1, ARL5A, ARPC1A, ARPC1B, ARPC4, ARPC4-TTLL3, ARPC5, ARPIN, ARPP19, ASAP1, ASB13, ASNS, ASPH, ASXL2, ATAD2, ATAD3A, ATAD3C, ATE1, ATF3, ATF6, ATG2A, ATG7, ATL3, ATN1, ATOX1, ATP11A, ATP1B1, ATP1B3, ATP2A2, ATP2B1, ATP2B4, ATP5F1, ATP6V1G2-DDX39B, ATXN7L3B, AXIN1, B3GALNT2, B4GALNT1, B4GALT1, B4GALT1-AS1, B4GALT3, B4GALT5, B4GALT7, BABAM1, BACE2, BAHCC1, BAIAP2, BANP, BAX, BBX, BCAR1, BCAR3, BCAT2, BCL2L2-PABPN1, BCL7B, BCOR, BCR, BID, BIN1, BIRC2, BLCAP, BLOC1S3, BLOC1S6, BLVRA, BMP6, BMPR1A, BOP1, BRD1, BRD3, BRD4, BRD9, BRI3BP, BRSK2, BSG, BST2, BTAF1, BTBD1, BTBD3, BTRC, C10orf76, C11orf84, C12orf45, C12orf57, C14orf37, C15orf38-AP3S2, C15orf41, C16orf45, C17orf51, C18orf25, C19orf44, C1orf228, C1QBP, C20orf24, C22orf29, C22orf39, C2CD3, C2orf61, C2orf82, C2orf88, C4orf19, C6orf106, C6orf223, C7orf50, C7orf55-LUC7L2, CABLES1, CACNA2D1, CALR, CAMKK2, CAMTA1, CAND1, CANX, CAPN15, CAPZA2, CAPZB, CARS, CARS-AS1, CASC4, CASZ1, CBL, CBR4, LOC102724560, CBY1, CCDC134, CCDC144NL-AS1, CCDC174, CCDC47, CCDC6, CCDC85C, CCDC88A, CCM2, CCNC, CCND1, CCNF, CCNG1, CCNK, CCNT2, CCT4, CCT5, CCT6A, CD109, CD151, CD276, CD320, CD44, CD81, CDC123, CDC26, CDC42SE2, CDCA5, CDCP1, CDIP1, CDK13, CDK17, CDK6, CDKL5, CEACAM19, CEBPB, CELF1, CELSR1, CENPO, CENPT, CEP250, KIAA1731NL, CEP72, CEP85, CERK, CERS2, CERS6, CERS6-AS1, CGN, CHADL, CHCHD3, CHD3, CHD7, CHERP, CHFR, CHML, CHMP1B, CHN1, CHPF, CHRNB4, CHST11, CHTF8, CIDEB, CIRH1A, CITED4, CLASP1, CLCN3, CLCN7, CLDN12, CLIC4, CLK3, CLN6, CLNS1A, CLPTM1, CLSTN1, CLTA, CMC2, CMIP, CMPK1, CMTM4, CMTM8, CNNM2, CNNM3, CNNM4, CNOT1, CNPY2, CNPY3, COBL, COCH, COG8, COL5A1, COL6A1, COLGALT1, COMMD1, COMTD1, COPE, COPS2, COPZ1, COX15, COX6A1, COX7A2L, CPA4, CPNE1, CPSF3L, CPT1A, CREB3L2, CREG2, CRIM1, CRLF3, CROCC, CROCCP4, CRTAP, CRTC2, CRTC3, CRTC3-AS1, CS, CSDE1, CSF1, CSNK1A1, CSNK1D, CSNK1G3, CSTF3, CTBP1, CTBP1-AS, CTBP2, CTC1, CTCF, CTDNEP1, CTNNA1, CTNNA3, CTNNAL1, CTNNB1, CTPS1, CTSB, CTSD, CTTNBP2NL, CUEDC1, CUL5, CUTC, CUX1, CYB561, CYFIP1, CYTH3, DAB2IP, DAG1, DAGLB, DALRD3, DANCR, DAZAP1, DAZAP2, DCAF10, DCAF5, DCAF6, DCAF7, DCP1A, DCTN1, DCTN4, DCUN1D4, DCXR, DDAH1, DDHD1, DDX1, DDX24, DDX39B, DDX3P3, DDX42, DDX46, DDX47, DDX6, DEDD, DEF8, DENND5A, DENND5B, DGKD, DHFR, DHX16, DHX33, DHX34, DHX36, DHX8, DIAPH1, DICER1, DIDO1, DIO2, DIP2B, DIP2C, DISC1FP1, DLAT, DLGAP4, DLGAP4-AS1, DMD, DMTF1, DMWD, DMXL1, DNAJB4, DNAJC11, DNAJC14, DNAJC3, DNAJC5, DNAJC6, DNASE1, DNASE2, DNER, DNM2, DNMT3A, DOCK5, DPP7, DPP9, DR1, DST, DSTYK, DTX2, DVL3, DYNC1LI1, DYRK1A, DZIP1, E2F3, ECHS1, ECI1, EDA, EDC3, EDF1, EEF1A1P3, EEF1A1P6, EEF1D, EFEMP1, EFHC2, EGFL7, EGLN2, EGLN3, EHBP1, EHBP1L1, EIF2B5, EIF3D, EIF3M, EIF4A1, EIF4A2, EIF4B, EIF4EBP1, EIF4G1, EIF6, ELF2, ELK4, ELL, ELOVL6, ELP5, EMC6, EMC8, ENAH, ENOSF1, EPAS1, EPB41, EPB41L4A, EPB41L4A-AS1, EPB41L4B, EPHA1, EPS15L1, EPT1, ERC1, ERCC3, ERCC8, ERGIC1, ERGIC2, ERGIC3, ERI1, ERLIN1, ERMP1, ERP29, ESCO1, ESR2, ESRRA, ESYT2, ETFA, ETV4, ETV5, EXO1, EXOC3, EXOC4, EXOC6B, EXOSC3, EYA3, EZR, FADS1, FADS2, FAF1, FAF2, FAM102A, FAM102B, FAM105A, FAM107B, FAM120A, FAM120AOS, FAM129B, FAM131A, FAM134A, FAM168A, FAM168B, FAM173B, FAM195A, FAM19A2, FAM207A, FAM208A, FAM20C, FAM219A, FAM35A, FAM49B, FAM53B, FAM65A, FANCI, FARP1, FARP2, FASTK, FBLN1, FBRSL1, FBXL18, FBXL6, FBXO11, FBXO2, FBXO22, FBXO46, FBXO7, FEM1B, FERMT2, FEZ2, FGD6, FIS1, FKBP10, FKBP5, FKRP, FLNB, FLNB-AS1, FNBP1, FNBP4, FNDC3A, FNIP1, FOXJ3, FOXK2, FOXM1, FPGS, FRAS1, FRS2, FSTL3, FTH1P23, FTSJ3, FUBP1, FYCO1, FZD10, FZR1, GACAT2, GADD45GIP1, GAK, GALNT1, GALNT10, GALNT2, GAS2L3, GAS5, GATAD2A, GATAD2B, GCNT2, GDAP1, GDAP2, GEMIN7, GET4, GFOD1, GFOD2, GGA1, GGCX, GGPS1, GHDC, GIGYF2, GIPC1, GIPC2, GLIS2, GLO1, GLRX, GLRX3, GLUL, GNA11, GNA13, GNAI3, GNAL, GNAQ, GNAS, GNB1, GNB1L, GNL2, GNL3L, GNL3LP1, GOLGA1, GOLGA2P7, GOLGA3, GOLM1, GOLPH3, GON4L, GOSR2, AGPAT9, AGPAT6, GPATCH8, GPBP1L1, GPM6A, GPR161, GPRIN3, GPSM2, GPX4, GRAMD1B, GRAMD3, GRB2, GREB1, GRPEL1, GRSF1, GSE1, GSK3A, GSKIP, GSPT1, GTF2E2, GTF2F1, GTF2H1, GTF2IRD1, GTF2IRD1P1, GTF3C2, GTF3C2-AS1, GTF3C5, GTPBP1, GTPBP4, GTPBP6, GUSBP1, GXYLT2, H1F0, H2AFV, H2AFY, HECTD1, HECTD4, HELLS, HERC2, HERC4, HERPUD1, HFM1, HIATL1, HIC1, HINT1, HIP1, HIP1R, HIPK2, HIPK3, HIRA, HIST1H2AI, HIST1H2BB, HIVEP3, HM13, HM13-AS1, HMG20A, HMGA1P3, HNRNPA1P33, HNRNPA2B1, HNRNPA3, HNRNPCP2, HNRNPH1, HNRNPH3, HOMER3, HOMEZ, HOOK2, HORMAD2-AS1, HOXA10, HOXA10-AS, HOXA10-HOXA9, HOXA9, HOXC10, HP1BP3, HPCAL1, HPDL, HPS5, HS2ST1, HS6ST1, HSD17B12, HSP90AA1, HSP90AA2P, HSP90AB4P, HSPA4, HSPA4L, HSPA5, HSPD1, HSPD1P11, HSPG2, HTATIP2, IARS, IBTK, ICMT, IFNAR1, IFNGR2, IGF2BP2, IGF2R, IGHV3-49, IKBKAP, IKZF3, IL11, IL6ST, ILKAP, IMPA2, INCENP, INF2, ING5, INPPL1, INSR, INTS3, INTS6, INTS6-AS1, INTS7, IP6K1, IP6K2, IPO11, IPO7, IQGAP1, IQSEC1, IRAK2, IRF2BP2, IRF3, ISYNA1, ITFG2, ITGA6, ITGAE, ITGAV, ITGB1BP1, ITPK1, ITPR1, ITPR3, ITPRIP, ITSN1, IWS1, JADE1, JAG2, JDP2, JPH1, JPX, JSRP1, KANK1, KANSL1, KANSL2, KANSL3, KAZN, KCMF1, KCNG3, KCNQ2, KCTD20, KCTD3, KCTD7, KDELR2, KDM2A, KDM2B, KDM4B, KDM4C, KDM5A, KDM5B, KHDRBS1, KIAA0100, KIAA0430, KIAA0907, KIAA1147, KIAA1191, KIAA1522, KIAA1549, KIAA1644, KIF13A, KIF1C, KIF21A, KLC1, KLF12, KLF16, KLF3, KLF6, KLHDC3, KLHL15, KLHL18, KLHL23, KLHL26, KLHL29, KMT2C, KNOP1, KRT18P11, KRT18P15, KRT8P34, KRT8P39, KRT8P48, KTN1, L1CAM, L3MBTL2, PRR35, LAMA5, LANCL1, LANCL1-AS1, LARP1, LARP4B, LARP4P, LASP1, LEMD3, LGMN, LIFR, LIMCH1, LINC00094, LINC00294, LINC00324, LINC00854, LINC00969, LINC01588, LITAF, LMNA, LMNB2, LMTK2, LNX2, LONP1, LONP2, LOXL2, LPCAT1, LPGAT1, LPIN1, LRBA, LRP1B, LRP5, LRP8, LRPAP1, LRRC41, LRRC61, LRRC8D, LRRC8E, LRRTM3, LSM12, LTB4R2, LTBR, LUC7L2, LUZP1, LY6E, LYN, LYPLA1, MAD2L2, MALSU1, MAN2A1, MANBA, MAP2K1, MAP2K2, MAP2K3, MAP2K4, MAP3K2, MAP4K4, MAP7, MAPK1, MAPK12, MAPK14, MAPK6, MAPK9, MARK3, MARK4, MAST3, MAT2A, MAX, MCCC2, MCF2L, MCM4, MCU, MDGA2, MDH2, MDM2, MED12, MED12L, MED13, MED13L, MED26, MED29, METAP1, METAP2, METRN, METTL8, MFSD11, MGAT5, MGST1, MICA, MICAL3, MICALL1, MICB, MIF-AS1, MINK1, MINOS1, MINOS1-NBL1, MIR1248, MIR27A, MIR3648-2, MIR3687-1, MIR3687-2, MIR4449, MIR589, MIR6087, MIR614, MIR663A, MIR663AHG, MIR663B, MIR6775, MIR7705, MIRLET7BHG, MISP, MITF, MKL1, MKLN1, MKNK1, MKNK1-AS1, MKRN2OS, MLEC, MLF2, MLLT1, MLLT4, MLST8, MMACHC, MMP17, MNX1, MOB3C, MORC3, MPC2, MPP3, MPRIP, MREG, MRI1, MROH7-TTC4, MRPL3, MRPL37, MRPL46, MRPS11, MRPS18A, MRPS25, MRPS6, MSH6, MSL2, MSLN, MSTO2P, MTA1, MTAP, MTCL1, MTHFD1, MTMR3, MTMR4, ND1, ND4, ND4L, ND5, MTOR, RNR1, RNR2, MTRNR2L8, TRNE, TRNV, MUC13, MUC16, MVD, MYADM, MYH10, MYH9, MYL6, MYO10, MYO19, MYO1E, MYO9B, MYOF, MYPN, MZT2B, NAA10, NAA25, NAA40, NAB1, NACC1, NACC2, NAP1L4, NAT9, NBPF1, NBPF19, NBPF25P, NBPF26, NCAPD2, NCAPH, C17orf85, NCOA2, NCOR1, NCOR2, NDFIP2, NDRG1, NDRG3, NDUFA13, NDUFB9, NDUFS1, NDUFS7, NDUFV1, NEAT1, NEDD4L, NEK7, NELL1, NETO2, NFAT5, NFIC, NFIX, NGRN, NHSL1, NIPBL, NIT1, NKTR, NKX2-3, NLE1, NLGN2, NLRP1, NMNAT1, NMRAL1, NNT, NOL10, NOL4L, NOL9, NONO, NOP56, NOTCH1, NOTCH2NL, NPDC1, NPEPL1, NPIPA1, NPLOC4, NPM3, NPR3, NPRL3, NPTX1, NQO1, NR1D2, NR2C2, NR2F1-AS1, NR2F2, NRIP3, NSD1, NSUN5P2, NT5C2, NUB1, NUBP2, NUCB2, NUDC, NUDCD3, NUP107, NUP155, NUP188, NUP205, NUP88, NUP98, NUTF2, NXN, NXPE3, OAZ1, OAZ2, OGDH, OGFOD1, OGT, OPHN1, OPN3, OR2A1-AS1, ORAOV1, ORC5, ORMDL2, OSBP2, OSBPL1A, OSMR, OTUD3, OTUD5, OVOL2, OXA1L, P2RX5-TAX1BP3, P2RY11, LEPREL2, P4HA3, PABPC1L, PABPC3, PABPN1, PACSIN2, PAFAH1B1, PAICS, PAIP2, PALLD, PALM, PAM16, PANK2, PAPD5, PAPD7, PAQR4, PARD3, PARD3B, PARP12, PARP16, PCCB, PCDH11X, PCGF3, PCGF6, PCID2, PCMT1, PCNXL3, PCSK9, PDAP1, PDCD6, PDE3A, PDE4A, PDE4D, PDE8A, PDHA1, PDIA4, PDPR, PDS5A, PDS5B, PDXDC1, PELP1, PER1, PERP, PEX10, PFAS, PFKFB2, PFKFB3, PFKP, PFN2, PGAM1P5, PGAM5, PGRMC1, PHACTR1, PHACTR2, PHACTR4, PHC3, PHF20, PHF3, PHF8, PHGDH, PHLPP1, PHTF1, PHTF2, PI4K2B, PI4KA, PID1, PIEZO1, PIGQ, PIGT, PIK3C2A, PIK3C2B, PIKFYVE, PIP5K1A, PITPNM1, PKDCC, PKMYT1, PKP4, PLA2G12A, PLA2G15, PLA2G4A, PLAGL1, PLBD2, PLCG2, PLEKHA2, PLEKHA6, PLEKHB2, PLK1, PLOD3, PLP2, PPAP2C, PLS1, PLXNA2, PLXNB2, PLXND1, PMEPA1, PMF1, PMF1-BGLAP, PML, PMM2, PMPCB, PNKP, PNPLA2, POLA1, POLD2, POLR1B, POLR1D, POLR2L, POLR3E, POM121, POMGNT2, PON2, POTEF, POU2F1, PPAN-P2RY11, PPARD, PPARGC1B, PPFIA1, PPFIA3, PPIP5K1, PPME1, PPP1CA, PPP1CB, PPP1CC, PPP1R13B, PPP1R13L, PPP1R14BP3, PPP1R16B, PPP1R9B, PPP2CB, PPP2R1A, PPP2R1B, PPP2R2B, PPP2R4, PPP2R5A, PPP2R5C, PPP2R5E, PPP3CB-AS1, PPP3R1, PPP4R1, PPP4R2, PPP5C, PPP6R2, PPP6R3, PPT2-EGFL8, PQLC1, PRC1, PRC1-AS1, PRCC, PRDX4, PRICKLE3, PRKACB, PRKAR1B, PRKAR2B, PRKCI, PRKCSH, PRKD3, PRKRIP1, PRMT1, PRMT3, PRPF31, PRR14L, PRRC2C, PSMA3, PSMA5, PSMB7, PSMC3IP, PSMD2, PSMD8, PSME3, PSMG3, PSPH, PSTPIP2, PTBP1, PTCH2, PTDSS1, PTDSS2, PTGES3, PTK2, PTK6, PTMA, PTMS, PTP4A2, PTPN11, PTPN12, PTPN3, PTPRD, PTPRF, PTPRM, PTPRS, PTTG1IP, PUM1, PUM2, PUS7, PVR, PVT1, PWWP2A, PXN-AS1, QPCTL, QSOX1, QSOX2, R3HDM1, RAB10, RAB11FIP1, RAB11FIP3, RAB11FIP5, RAB13, RAB21, RAB2A, RAB31, RAB3GAP1, RAB3GAP2, RAB4B-EGLN2, RAB6A, RAB7A, RABEP1, RABEP2, RABGEF1, RAD23A, RAD23B, RAD51C, RAD9A, RAF1, RAI14, RALA, RALB, RALGDS, RALY, RALY-AS1, RANBP1, RANGAP1, RAP1B, RAP1GAP2, RAP1GDS1, RAPGEF2, RAPGEF6, RAPH1, RARA, RARS, RASAL2, RASGEF1C, RASL10B, RB1CC1, RBAK-RBAKDN, RBFOX2, RBM12, RBM19, RBM27, RBM33, RBM47, RBM6, RBSN, RC3H1, RC3H2, RCAN1, RCC1, RCC2, RCL1, RCOR1, RDX, RELL1, RELN, RER1, RERE, RFC2, RFFL, RFWD2, RGPD5, RHEB, RHOBTB2, RHOBTB3, RHOD, RHOF, RHOG, RHOT2, RHPN2, RIC1, RICTOR, RMND5B, RN7SK, RN7SL2, RN7SL3, RN7SL4P, RN7SL5P, RNA5S1, RNA5S10, RNA5S11, RNA5S12, RNA5S13, RNA5S15, RNA5S16, RNA5S17, RNA5S2, RNA5S3, RNA5S4, RNA5S5, RNA5S6, RNA5S7, RNA5S8, RNA5S9, RNA5SP145, RNA5SP162, RNA5SP191, RNA5SP202, RNA5SP259, RNA5SP352, RNA5SP506, RNA5SP74, RNASEH1, RNASEH2A, RNASEK, RNASEK-C17orf49, RNASET2, RNF121, RNF216, RNF216P1, RNF220, RNF34, RNF38, RNF4, RNF8, RNGTT, RNPEPL1, RNU1-1, RNU1-11P, RNU1-18P, RNU1-19P, RNU1-2, RNU1-27P, RNU1-28P, RNU1-3, RNU1-4, RNU4-1, RNU4-2, RNU4ATAC, RNU5A-1, RNU5E-6P, RNU5F-1, RNU6-8, RNU6ATAC, RNU7-1, RNVU1-10, RNVU1-14, RNVU1-17, RNVU1-18, RNVU1-19, RNVU1-6, RNVU1-7, ROBO1, RPL13AP2, RPL18AP3, RPL18P11, RPL26, RPL37, RPL7AP66, RPL7L1, RPLP1, RPLP2, RPRD1B, RPS10-NUDT3, RPS20P14, RPS2P46, RPS2P5, RPS3, RPS3P6, RPS3P7, RPS4XP17, RPS6KA2, RPS6KB1, RPSAP14, RPSAP26, RPTOR, RRBP1, RREB1, RRM2, RSBN1L, RSPH9, RTCB, RTN3, RTN4, RTN4RL1, RUSC2, RXRA, RYBP, RYR2, S100A6, SAAL1, SACM1L, SACS, SAMD11, SAMD4A, SAMHD1, SAP30BP, SAP30L-AS1, SAPCD2, SART1, SART3, SBNO2, SCAMP3, SCAMP4, SCARB1, SDHAF2, SDHAP1, SDHAP2, SEC22B, SEC23B, SEC24B, SEC63, SECISBP2, SEL1L, SEMA3B, SEMA4C, SEMA6D, SENP3, SENP3-EIF4A1, SERINC5, SERTAD2, SETD2, SETD3, SETD7, SETX, SF3B3, SF3B4, SFPQ, SFT2D2, SFXN5, SGK1, SGMS1, SGSM3, SGTA, SH2B2, SH3BP4, SH3BP5L, SH3PXD2A, SH3RF1, SH3RF3, SHANK2, SHB, SHKBP1, SHOC2, SHPK, SHROOM3, SIAE, SIK2, SIK3, SIN3A, SIPA1, SKI, SKP2, SLC12A4, SLC12A7, SLC16A1, SLC16A3, SLC20A1, SLC20A2, SLC25A3, SLC25A36, SLC25A43, SLC25A5, SLC25A5-AS1, SLC26A10, SLC27A4, SLC29A1, SLC2A1, SLC31A1, SLC35A4, SLC35C2, SLC35D1, SLC35D2, SLC35E1, SLC35F2, SLC38A1, SLC39A10, SLC39A3, SLC39A8, SLC3A2, SLC43A2, SLC43A3, SLC44A1, SLC4A7, SLC52A2, SLC5A3, SLC5A6, SLC7A5P2, SLC7A6, SLC7A6OS, SLC8B1, SLCO3A1, SLCO5A1, SMAD1-AS1, SMAD3, SMAD4, SMAGP, SMARCA4, SMARCC1, SMARCD2, SMC4, SMG1P2, SMG1P3, SMG1P5, SMG6, SMG7, SMIM13, SMOC1, SMOX, SMPD4, SMTN, SMUG1, SMYD4, SMYD5, SNAPC5, SND1, SNHG1, SNHG12, SNHG19, SNHG3, SNN, SNORA13, SNORA23, SNORA45B, SNORA52, SNORA53, SNORA73A, SNORA73B, SNORA76C, SNORA80E, SNORD10, SNORD101, SNORD104, SNORD118, SNORD12B, SNORD13, SNORD14C, SNORD14E, SNORD15A, SNORD15B, SNORD16, SNORD17, SNORD18B, SNORD18C, SNORD20, SNORD25, SNORD26, SNORD3A, SNORD3B-1, SNORD3B-2, SNORD3C, SNORD61, SNORD83A, SNORD83B, SNRPB, NHP2L1, SNX12, SNX13, SNX19, SNX27, SNX5, SOAT1, SOCS5, SOD2, SOGA1, SORCS2, SOX13, SPAG17, SPAG9, SPATA21, SPATA2L, SPATS2, SPCS3, SPDYA, SPIDR, SPIRE1, SPIRE2, SPRED1, SPSB3, SPTAN1, SPTBN1, SPTBN2, SPTLC2, SPTSSA, SRD5A1, SREBF1, SRFBP1, SRGAP1, SRP72, SRPK1, SRPK2, SRRM3, SRSF11, SRSF2, SRSF3, SSBP1, SSH1, SSH2, SSR3, SSU72, ST3GAL2, ST3GAL4, STARD3, STARD9, STAT3, STAT5B, STC2, STEAP1B, STIP1, STK10, STK11IP, STK17A, STK24, STK38L, STRN3, STRN4, STT3B, STUB1, STX16, STX16-NPEPL1, STX3, STX6, SUB1, SUN1, SUN2, SUPT16H, SUPT3H, SUPT5H, SUPT6H, SURF6, SUSD6, SUZ12P1, SYBU, SYNE2, SYNPO, SZRD1, TACC2, TAF15, TAF5L, TAF8, TALDO1, TAOK3, TARDBP, TAX1BP3, TBC1D16, TBC1D24, TBC1D2B, TBC1D30, TBCD, TBL1XR1, TBL2, TBRG4, TBX1, TCF12, TCF20, TCFL5, TCP11L1, TDG, TDRD9, TEAD1, TEAD3, TEX2, TFRC, TGFB1, TGFBR1, TGFBR2, TGFBRAP1, TGIF2, TGIF2-C20orf24, THAP3, THAP4, THOC3, THRAP3, THRIL, TIAL1, TICAM1, TIMM17A, TIMM50, TIMP2, TINCR, TJAP1, TLDC1, TLDC2, TLE1, TM4SF1, TM7SF3, TM9SF3, TM9SF4, TMC5, TMCO1, TMCO3, TMED7, TMED7-TICAM2, TMEM101, TMEM107, TMEM109, TMEM120B, TMEM141, TMEM14B, TMEM161A, TMEM165, TMEM184A, TMEM189, TMEM189-UBE2V1, TMEM199, TMEM214, TMEM241, TMEM242, TMEM245, TMEM38A, TMEM38B, TMEM50A, TMEM50B, TMEM53, TMEM9, TMEM91, TMOD3, TMTC3, TMX2, TMX2-CTNND1, TNFRSF10A, TNFRSF10B, TNFRSF1A, TNKS, TNKS2, TNPO1, TNRC18, TNS3, TOMM20, TOMM34, TOR1AIP2, TPCN2, TPM2, TRAF7, TRAPPC10, TRAPPC3, TRIM33, TRIM56, TRIM59, TRIO, TRMT61A, TRPC4AP, TRPM7, TSEN2, TSFM, TSNAX, TSNAX-DISC1, TSNAXIP1, TSPAN17, TSPAN5, TSR1, TSSC1, TTC19, TTC27, TTC4, TTC7A, TTI2, TUBAP2, TULP4, TXLNA, TXNDC11, TXNDC12, UBA2, UBAC1, UBAP1, UBAP2, UBAP2L, UBASH3B, UBE2G1, UBE2G2, UBE2L3, UBE2O, UBE2Q2P2, UBE3C, UBE3D, UBE4B, UBN2, UBQLN1, UBR5, UBXN2A, UCK2, UCP2, UGCG, UGDH, UIMC1, ULK1, UQCC1, UQCC2, URM1, USHBP1, USP11, USP14, USP19, USP22, USP24, USP32, USP34, USP36, USP53, USP54, USP7, USP9X, UTP18, UTP20, UTP6, VAMP3, VANGL1, VASP, VAV2, VCL, VGLL4, VIPR1, VKORC1L1, VPS4A, VPS53, VPS72, VRK1, VTRNA1-1, VTRNA2-1, WASF1, WASF2, WBSCR22, WDPCP, WDR1, WDR13, WDR3, WDR34, WDR37, WDR4, WDR43, WDR6, WDR91, WEE1, WHSC1, WIPF2, WLS, WNK1, WNK2, WNT7B, WSB1, WTAP, WWC1, WWOX, WWTR1, WWTR1-AS1, XPNPEP1, XPO1, XPO4, XPO6, XPR1, YBX3, YEATS2, YIF1B, YIPF4, YPEL2, YWHAB, YWHAE, YWHAQ, YY1, YY1AP1, ZBED9, ZBTB10, ZBTB43, ZBTB46, ZBTB7A, ZBTB7B, ZC3H7B, ZCCHC24, ZDHHC14, ZDHHC5, ZFAND3, ZFAS1, ZFP41, ZFR, ZFX, ZKSCAN5, ZMAT2, ZMIZ1, ZMIZ2, ZMYM2, ZNF124, ZNF131, ZNF148, ZNF264, ZNF277, ZNF326, ZNF354B, ZNF444, ZNF445, ZNF460, ZNF467, ZNF484, ZNF587B, ZNF598, ZNF609, ZNF668, ZNF713, ZNF787, ZNHIT3, ZP3, ZRANB3, ZSCAN25, ZYX, BRCA1, PCBP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneTRIM25chr17:55339553chr17:54985924ENST00000316881-09180_450199631influenza A virus NS1
TgeneTRIM25chr17:55339553chr17:54985924ENST00000537230-010180_450199684influenza A virus NS1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MSI2_TRIM25


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MSI2_TRIM25


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource