FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22491

FusionGeneSummary for MRPL35_CTNNA2

check button Fusion gene summary
Fusion gene informationFusion gene name: MRPL35_CTNNA2
Fusion gene ID: 22491
HgeneTgene
Gene symbol

MRPL35

CTNNA2

Gene ID

51318

1496

Gene namemitochondrial ribosomal protein L35catenin alpha 2
SynonymsL35mt|MRP-L35CAP-R|CAPR|CT114|CTNR
Cytomap

2p11.2

2p12

Type of geneprotein-codingprotein-coding
Description39S ribosomal protein L35, mitochondrialmitochondrial large ribosomal subunit protein bL35mcatenin alpha-2alpha-N-cateninalpha-catenin-related proteincadherin-associated protein, relatedcancer/testis antigen 114catenin (cadherin-associated protein), alpha 2
Modification date2018052220180522
UniProtAcc

Q9NZE8

P26232

Ensembl transtripts involved in fusion geneENST00000254644, ENST00000605125, 
ENST00000337109, ENST00000409180, 
ENST00000466387, ENST00000496558, 
ENST00000361291, ENST00000402739, 
ENST00000540488, ENST00000541047, 
ENST00000343114, ENST00000496251, 
ENST00000409266, 
Fusion gene scores* DoF score3 X 3 X 2=1815 X 12 X 9=1620
# samples 315
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(15/1620*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MRPL35 [Title/Abstract] AND CTNNA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-18-3414-01AMRPL35chr2

86434450

+CTNNA2chr2

80772107

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254644ENST00000466387MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000496558MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000361291MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000402739MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000540488MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000541047MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000254644ENST00000343114MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000254644ENST00000496251MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000254644ENST00000409266MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000466387MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000496558MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000361291MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000402739MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000540488MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000541047MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-3CDSENST00000605125ENST00000343114MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-intronENST00000605125ENST00000496251MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
intron-intronENST00000605125ENST00000409266MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000466387MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000496558MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000361291MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000402739MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000540488MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000541047MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000337109ENST00000343114MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000337109ENST00000496251MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000337109ENST00000409266MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000466387MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000496558MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000361291MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000402739MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000540488MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000541047MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
In-frameENST00000409180ENST00000343114MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000409180ENST00000496251MRPL35chr2

86434450

+CTNNA2chr2

80772107

+
5CDS-intronENST00000409180ENST00000409266MRPL35chr2

86434450

+CTNNA2chr2

80772107

+

Top

FusionProtFeatures for MRPL35_CTNNA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MRPL35

Q9NZE8

CTNNA2

P26232


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MRPL35_CTNNA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_650aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCA
EGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQ

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_557aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKH

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_650aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCA
EGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQ

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_557aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKH

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_650aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDCDVIDGGRASQLSTHLPTCA
EGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQ

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_557aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKH

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_602aa
MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLP
VRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDV
FKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENTEAGVTTEKVLEAT
KLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVTDGVRDIRKAVLMIRTPEELEDDSDFEQEDTDVRSRTSVQTEDDQLIA
GQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSR
MDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_1950nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAG
AGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCT
GAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAAT
GCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTG
TCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAG

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1671nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTC
CTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAG
ATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACAC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_1950nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAG
AGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCT
GAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAAT
GCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTG
TCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAG

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1671nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTC
CTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAG
ATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACAC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_1950nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAG
AGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCT
GAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAAT
GCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTG
TCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAG

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1671nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTC
CTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAG
ATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACAC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_1806nt
ATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAAC
TGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTT
ACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCA
GTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGC
CTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAG
ATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTC
TTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAA
AATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGG
GGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACA
AAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTT
GAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAA
GAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCA
GGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAA
AGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAA
ATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGA
ATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTG
TATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCC
ACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAG
GTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCT
GAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_2849nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGT
CCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAA
GATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACA
CATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTT
CTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTC
TGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACA
GAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAA
CTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGT
AGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAA
CCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATT
CTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAA
AATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGA
AATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_2850nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGT
CCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAA
GATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACA
CATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTT
CTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTC
TGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACA
GAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAA
CTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGT
AGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAA
CCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATT
CTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAA
AATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGA
AATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1942nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGT
CCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAA
GATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACA

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_2903nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGA
TGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCT
GGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAA
ATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAG
AGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGC
AATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTAT
GCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACT
GATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCA
CAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAG
AATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCA
AAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTT
TAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATC
ATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGA
CCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGG

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1807nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGC
CACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAA
GGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCC
TGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_2849nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGT
CCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAA
GATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACA
CATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTT
CTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTC
TGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACA
GAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAA
CTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGT
AGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAA
CCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATT
CTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAA
AATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGA
AATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGC

>In-frame_MRPL35_ENST00000254644_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_2850nt
AGATGACATTGAATAAATGTTGAGTGGACAACTTTGTTCTTTTCCTCTTCCTTGACTCCGCCTCCTTGCTTTCCCTTCATTCTCTTTTGC
TCTTGTGCTTTTAAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGG
AATCCTACGGCCCCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACG
TTTTAGTCATATTCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGAT
CCTTAATAGAATGGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAA
GACCGTGAAAGCTGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTC
CAACAATGAAGAAGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACT
GGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGC
CGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCA
AGAGGGCGATGTGGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGA
GAACTATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGT
AGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGG
CGTTCGGGACATCAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGT
GCGTAGCAGGACAAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGA
GAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAA
TGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATC
TGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTC
AGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGT
GCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGT
CCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAA
GATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACA
CATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTT
CTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTC
TGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACA
GAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAA
CTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGT
AGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAA
CCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATT
CTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAA
AATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGA
AATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGC

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_2747nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAA
AGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCC
AGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGT
ACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTT
TTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTA
AGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTT
GCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACA
AAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAAC
TTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTA
TATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTT
CTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGG
GGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCC
AGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATA

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_2748nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAA
AGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCC
AGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGT
ACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTT
TTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTA
AGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTT
GCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACA
AAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAAC
TTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTA
TATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTT
CTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGG
GGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCC
AGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATA

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1840nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAA
AGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCC
AGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGT

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_2801nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGC
TAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCAC
ATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGT
CTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGA
AGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTT
CTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCA
GCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTA
GCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCAT
TGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTT
GGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAG
CCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGA
AATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCC
CCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTT
TCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACG

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1705nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTAT
CCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGAC
AGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCA

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_2747nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAA
AGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCC
AGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGT
ACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTT
TTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTA
AGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTT
GCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACA
AAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAAC
TTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTA
TATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTT
CTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGG
GGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCC
AGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATA

>In-frame_MRPL35_ENST00000337109_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_2748nt
AAACCCAAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCC
CCTGAATATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATAT
TCAGACACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAAT
GGCCCCCGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGC
TGTCATCGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGA
AGGGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCC
ACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACAT
CACCTCAGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGT
GGACACTCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGC
TGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCAT
TGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACAT
CAGAAAGGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGAC
AAGTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAAT
AGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGT
ACTGGCCAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAA
TGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCA
GGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGG
AGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAA
AGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCC
AGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGT
ACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTT
TTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTA
AGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTT
GCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACA
AAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAAC
TTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTA
TATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTT
CTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGG
GGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCC
AGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATA

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000466387_chr2_80772107_+_2741nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATC
CTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAA
GAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGC
TTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTT
TTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGA
GATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACA
TTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCA
AACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTAT
TGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCG
TGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTT
GTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACT
GGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGT
GGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCAT

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000496558_chr2_80772107_+_2742nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATC
CTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAA
GAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGC
TTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTT
TTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGA
GATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACA
TTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCA
AACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTAT
TGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCG
TGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTT
GTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACT
GGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGT
GGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCAT

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000361291_chr2_80772107_+_1834nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATC
CTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAA
GAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGC

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000402739_chr2_80772107_+_2795nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCA
ACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCT
TATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGG
GACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATT
CCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGA
CGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGT
ATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGG
GAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGC
AATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGG
TATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATA
CGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAA
CTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTT
TAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTT
TTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAA

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000540488_chr2_80772107_+_1699nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGC
AGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGC
TGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACG

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000541047_chr2_80772107_+_2741nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATC
CTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAA
GAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGC
TTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTT
TTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGA
GATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACA
TTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCA
AACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTAT
TGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCG
TGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTT
GTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACT
GGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGT
GGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCAT

>In-frame_MRPL35_ENST00000409180_chr2_86434450_+_CTNNA2_ENST00000343114_chr2_80772107_+_2742nt
AAAGCGGCCGCCGTAGGCGAAGGTGAAGATGGCTGCCTCTGCCTTTGCTGGTGCAGTGAGAGCAGCTTCAGGAATCCTACGGCCCCTGAA
TATTTTGGCATCTTCAACCTACCGCAACTGTGTCAAGAATGCCTCTCTTATTTCTGCATTGTCCACTGGACGTTTTAGTCATATTCAGAC
ACCAGTTGTTTCCTCCACTCCCAGACTTACCACATCTGAGAGAAACCTGACATGTGGGCATACCTCAGTGATCCTTAATAGAATGGCCCC
CGTGCTTCCAAGTGTCCTGAAGCTGCCAGTCAGATCTCTAACATACTTCAGTGCAAGAAAAGGCAAGAGAAAGACCGTGAAAGCTGTCAT
CGATAGGTTTCTTCGACTTCATTGTGGCCTTTGGGTGAGGAGAAAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAGGGGT
GAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCTGACACTGGCTGCCCGGCCACAGAG
CAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAGAAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTC
AGTGGATGACTTCCTCTCTGTCTCAGAAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACAC
TCTGGACCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAACTATGAAGCTGGGGT
TTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCACGCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGC
CCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAATGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAA
GGCTGTGCTGATGATCAGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAGGAAGATTATGATGTGCGTAGCAGGACAAGTGT
TCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCAGGAGGAGAAGGCAAAAATAGCTGA
GCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAAGTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGC
CAAGCAGATGTGTATGATCATGATGGAAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGC
CAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTT
ATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGA
GCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATC
CTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAA
GAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGC
TTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTT
TTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGA
GATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACA
TTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCA
AACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTAT
TGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCG
TGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTT
GTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACT
GGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGT
GGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCAT


Top

FusionGenePPI for MRPL35_CTNNA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MRPL35APP, MRPL4, MRPL39, MRPS30, MRPL47, RACGAP1, MRPL50, MRPL9, MRPL1, C6orf203, MRPL10, MRPL42, MRPL28, MRPL12, MRPL30, MRS2, VPRBP, MRPL13, UBE2O, MRPL38, MRPL41, MRPL45, MRPL40, MRPL27, MALSU1, METAP2, MRPL15, MRPL34, HNRNPA1, NAP1L1, IPO5, NAP1L4, MKI67, MRPS18A, RANBP6, MRPL48, MRPL20, MRPL55, MRPL49, LUC7L, MRPL2, MRPL3CTNNA2PAN2, PPP2R1A, FBXW11, CD27, UTP3, SAPCD1, CTNNB1, JUP, NTRK1, SDHAF2, GAN, MCM2, EGFR, CDH1, CDH8, CDH5, CTNNBIP1, DUSP22, FBXL5, CIR1, G3BP1, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MRPL35_CTNNA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MRPL35_CTNNA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCTNNA2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneCTNNA2C0036341Schizophrenia1PSYGENET
TgeneCTNNA2C0038356Stomach Neoplasms1CTD_human