FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22471

FusionGeneSummary for MRPL21_LRP5

check button Fusion gene summary
Fusion gene informationFusion gene name: MRPL21_LRP5
Fusion gene ID: 22471
HgeneTgene
Gene symbol

MRPL21

LRP5

Gene ID

219927

4041

Gene namemitochondrial ribosomal protein L21LDL receptor related protein 5
SynonymsL21mt|MRP-L21BMND1|EVR1|EVR4|HBM|LR3|LRP-5|LRP7|OPPG|OPS|OPTA1|PCLD4|VBCH2
Cytomap

11q13.3

11q13.2

Type of geneprotein-codingprotein-coding
Description39S ribosomal protein L21, mitochondrialmitochondrial large ribosomal subunit protein bL21mlow-density lipoprotein receptor-related protein 5low density lipoprotein receptor-related protein 5low density lipoprotein receptor-related protein 7
Modification date2018052320180523
UniProtAcc

Q7Z2W9

O75197

Ensembl transtripts involved in fusion geneENST00000450904, ENST00000362034, 
ENST00000567045, 
ENST00000294304, 
ENST00000529481, 
Fusion gene scores* DoF score7 X 6 X 6=25210 X 9 X 7=630
# samples 812
** MAII scorelog2(8/252*10)=-1.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/630*10)=-2.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MRPL21 [Title/Abstract] AND LRP5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneLRP5

GO:0008284

positive regulation of cell proliferation

9790987

TgeneLRP5

GO:0016055

Wnt signaling pathway

17955262

TgeneLRP5

GO:0044332

Wnt signaling pathway involved in dorsal/ventral axis specification

11029007

TgeneLRP5

GO:0045840

positive regulation of mitotic nuclear division

9790987

TgeneLRP5

GO:0045893

positive regulation of transcription, DNA-templated

15035989|17955262

TgeneLRP5

GO:0045944

positive regulation of transcription by RNA polymerase II

12857724

TgeneLRP5

GO:0060070

canonical Wnt signaling pathway

12121999|12857724|15035989


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-91-6831-01AMRPL21chr11

68663983

-LRP5chr11

68115315

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000450904ENST00000294304MRPL21chr11

68663983

-LRP5chr11

68115315

+
5CDS-intronENST00000450904ENST00000529481MRPL21chr11

68663983

-LRP5chr11

68115315

+
Frame-shitENST00000362034ENST00000294304MRPL21chr11

68663983

-LRP5chr11

68115315

+
5CDS-intronENST00000362034ENST00000529481MRPL21chr11

68663983

-LRP5chr11

68115315

+
In-frameENST00000567045ENST00000294304MRPL21chr11

68663983

-LRP5chr11

68115315

+
5CDS-intronENST00000567045ENST00000529481MRPL21chr11

68663983

-LRP5chr11

68115315

+

Top

FusionProtFeatures for MRPL21_LRP5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MRPL21

Q7Z2W9

LRP5

O75197

Component of the Wnt-Fzd-LRP5-LRP6 complex that triggersbeta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surfacecoreceptor of Wnt/beta-catenin signaling, which plays a pivotalrole in bone formation. Plays a role in norrin (NDP) signaltransduction (PubMed:27228167). The Wnt-induced Fzd/LRP6coreceptor complex recruits DVL1 polymers to the plasma membranewhich, in turn, recruits the AXIN1/GSK3B-complex to the cellsurface promoting the formation of signalsomes and inhibitingAXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Appears be required for postnatal control of vascularregression in the eye (By similarity). Required for posteriorpatterning of the epiblast during gastrulation (By similarity).{ECO:0000250|UniProtKB:Q91VN0, ECO:0000269|PubMed:11336703,ECO:0000269|PubMed:11448771, ECO:0000269|PubMed:14727154,ECO:0000269|PubMed:14731402, ECO:0000269|PubMed:15778503,ECO:0000269|PubMed:27228167}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231495_1610301616Compositional biasNote=Pro-rich
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231213_1254301616DomainNote=EGF-like 4
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231258_1296301616DomainLDL-receptor class A 1
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231297_1333301616DomainLDL-receptor class A 2
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231335_1371301616DomainLDL-receptor class A 3
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023295_337301616DomainNote=EGF-like 1
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023601_641301616DomainNote=EGF-like 2
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023902_942301616DomainNote=EGF-like 3
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231500_1506301616MotifNote=PPPSP motif A
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231538_1545301616MotifNote=PPPSP motif B
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231574_1581301616MotifNote=PPPSP motif C
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231591_1596301616MotifNote=PPPSP motif D
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231605_1612301616MotifNote=PPPSP motif E
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+02332_288301616RegionNote=Beta-propeller 1
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023341_602301616RegionNote=Beta-propeller 2
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023644_903301616RegionNote=Beta-propeller 3
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023945_1212301616RegionNote=Beta-propeller 4
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231036_1078301616RepeatNote=LDL-receptor class B 17
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231079_1123301616RepeatNote=LDL-receptor class B 18
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231124_1164301616RepeatNote=LDL-receptor class B 19
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231165_1207301616RepeatNote=LDL-receptor class B 20
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023120_162301616RepeatNote=LDL-receptor class B 2
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023123_126301616RepeatNote=YWTD 2
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023163_206301616RepeatNote=LDL-receptor class B 3
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023166_169301616RepeatNote=YWTD 3
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023207_247301616RepeatNote=LDL-receptor class B 4
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023248_290301616RepeatNote=LDL-receptor class B 5
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023251_254301616RepeatNote=YWTD 4
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023385_427301616RepeatNote=LDL-receptor class B 6
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023388_391301616RepeatNote=YWTD 5
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023428_470301616RepeatNote=LDL-receptor class B 7
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023431_434301616RepeatNote=YWTD 6
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023471_514301616RepeatNote=LDL-receptor class B 8
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023474_477301616RepeatNote=YWTD 7
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023515_557301616RepeatNote=LDL-receptor class B 9
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023558_600301616RepeatNote=LDL-receptor class B 10
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023559_562301616RepeatNote=YWTD 8
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023687_729301616RepeatNote=LDL-receptor class B 11
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023690_693301616RepeatNote=YWTD 9
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023730_772301616RepeatNote=LDL-receptor class B 12
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+02375_119301616RepeatNote=LDL-receptor class B 1
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023773_815301616RepeatNote=LDL-receptor class B 13
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+02378_81301616RepeatNote=YWTD 1
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023816_855301616RepeatNote=LDL-receptor class B 14
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023819_822301616RepeatNote=YWTD 10
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023856_898301616RepeatNote=LDL-receptor class B 15
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023859_862301616RepeatNote=YWTD 11
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+023989_1035301616RepeatNote=LDL-receptor class B 16
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231408_1615301616Topological domainCytoplasmic
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+02332_1384301616Topological domainExtracellular
TgeneLRP5chr11:68663983chr11:68115315ENST00000294304+0231385_1407301616TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MRPL21_LRP5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MRPL21_ENST00000450904_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_1632aa
MIVTGQTGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKPRRSCTLPTAGTYGWWTPAESSWSPPSWSAAWRMRPQWTSSFP
REPCTGQT_ARRPSSRPT_TRRGPPCRTWSSPAWSLPTASPATGWARSCTGRTQRPTASRWPTSMAHPGRCSSGRTLTSRGPSPWTPLTG
TCTGQTGVRRPGLSGQGWMAAPGRSLWTRTFTGPMD_PSTWRSRSSTGLTPSSASSTVPTWTARSGRRWWRAA_RTPSP_RSPGTLCTGQ
TGRPAPSMPATSALGGRGRRS_VPSTHPWTSRC_ARSGSLSSTLAVRRTMAAAPTCACCPQASLSTHAPAPRVCSCRTTAGRVRQEPRRC
CCWPGGRTYGGSRWTRRTSPTSCCRWTTSGTPLPSTTTR_RAMSTGQMTRCGPSAGRTWTGLGRRRWSTPRSTTPMASRSTGWPETSTGP
TRARTASR_RASTAPPARSWCRRTWTSPEPSHCTP_WASCTGQTGERTLKSSVPTWMGRSGVCWSMPPSGGPTAWPWTCRRGSSTGETPR
QTRSR_SMLMGRRGGPSWRTSSRTFLGSRCWGTSSTGLTGSAAASSGCTRSRPAGTSSLTSCPT_WGSKL_MWPRSSEPTRVRTGTGGAA
TCASSHPTQPGVAAPSAWSC_VT_RPASCLRPSWSSPAEPPSTGSPSRPITTTWPSRSRASRRPQPWTLMCPTTTSTGQTSA_RPSAAPS
_TGARWSTWWSLALTTPRAWPLTGWARTSTGPTLGPTESKWRGWTGSSGKSSCGGTWTTRGRWPWIPPRATSTGPSGAASRGSCGPSWTG
PTA_RWWTRWAGPTTSPLTTLTSASTGPTWTPT_SSRPTCWVRSGS_LPTISRTRSV_RSTAIISTGQTGICTALSGPTRLAAGTAPSSR
ATWTS_WTSWCSTPPARMASMTVCTTTGSVGSCALPSPAATAAAAPHTTPWTPAAATAARPPPSCCSARNLPSVG_SRTTSTARISSCPC
MD_GTSKPSTMTHWTSSSTGWMGARTSSEPRTTGPSPLF_PL_AKAKTQTGSPTTSASTSTAGHCSGRARPPIPSTSTG_AGKPWGWCCV
GTATSPGPSSSTRSEGTCTSPTCRTGQPRSNAQPWTAPSARSSSPPASSALWPWWWTTHWASCSGWTRT_SALRAVTCQGPTA_PWRTPT
SCSLWA_PSLASISTGSTASSR_SSVWRRPPGTSGLASRAVSPTSLASMQWRKSAWRSSQPTHVPVTMVAAPTSVLPRVMGHHGAHAQST
SCSCRTC_PVESRPPAPRTSLHVPQGRSTVSPGPGAVTAFPSAMTRATRRAAPCAPPPSSPARGVSVWTCACAATARQTVRTAQTRRTVT
PSACPTSSGVRAASVSSSNSSATPSPTVSTAPTSSCVKSPSRPQTTARPTAVPSGPSLASSSLSSSWVVSILCASAWCASAMRGPTGPSR
TSMSAGPRTCPSIS_PRAVPSMAPSQASHAESP__AP_A_WGAGAGCPSTTGTTSQGPRPAARPARRPRCTRRS_TRRPPRPRTPPCTTW
TCSTLQTFRPLRDRTGPTSFEEWRPRRRPAAPTCVTATTAPAAGRPASTTWI_TRTQTPIHPHPRPTASTCRRRTAARPRPPPRGATSIS

>In-frame_MRPL21_ENST00000567045_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_1632aa
MIVTGQTGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKPRRSCTLPTAGTYGWWTPAESSWSPPSWSAAWRMRPQWTSSFP
REPCTGQT_ARRPSSRPT_TRRGPPCRTWSSPAWSLPTASPATGWARSCTGRTQRPTASRWPTSMAHPGRCSSGRTLTSRGPSPWTPLTG
TCTGQTGVRRPGLSGQGWMAAPGRSLWTRTFTGPMD_PSTWRSRSSTGLTPSSASSTVPTWTARSGRRWWRAA_RTPSP_RSPGTLCTGQ
TGRPAPSMPATSALGGRGRRS_VPSTHPWTSRC_ARSGSLSSTLAVRRTMAAAPTCACCPQASLSTHAPAPRVCSCRTTAGRVRQEPRRC
CCWPGGRTYGGSRWTRRTSPTSCCRWTTSGTPLPSTTTR_RAMSTGQMTRCGPSAGRTWTGLGRRRWSTPRSTTPMASRSTGWPETSTGP
TRARTASR_RASTAPPARSWCRRTWTSPEPSHCTP_WASCTGQTGERTLKSSVPTWMGRSGVCWSMPPSGGPTAWPWTCRRGSSTGETPR
QTRSR_SMLMGRRGGPSWRTSSRTFLGSRCWGTSSTGLTGSAAASSGCTRSRPAGTSSLTSCPT_WGSKL_MWPRSSEPTRVRTGTGGAA
TCASSHPTQPGVAAPSAWSC_VT_RPASCLRPSWSSPAEPPSTGSPSRPITTTWPSRSRASRRPQPWTLMCPTTTSTGQTSA_RPSAAPS
_TGARWSTWWSLALTTPRAWPLTGWARTSTGPTLGPTESKWRGWTGSSGKSSCGGTWTTRGRWPWIPPRATSTGPSGAASRGSCGPSWTG
PTA_RWWTRWAGPTTSPLTTLTSASTGPTWTPT_SSRPTCWVRSGS_LPTISRTRSV_RSTAIISTGQTGICTALSGPTRLAAGTAPSSR
ATWTS_WTSWCSTPPARMASMTVCTTTGSVGSCALPSPAATAAAAPHTTPWTPAAATAARPPPSCCSARNLPSVG_SRTTSTARISSCPC
MD_GTSKPSTMTHWTSSSTGWMGARTSSEPRTTGPSPLF_PL_AKAKTQTGSPTTSASTSTAGHCSGRARPPIPSTSTG_AGKPWGWCCV
GTATSPGPSSSTRSEGTCTSPTCRTGQPRSNAQPWTAPSARSSSPPASSALWPWWWTTHWASCSGWTRT_SALRAVTCQGPTA_PWRTPT
SCSLWA_PSLASISTGSTASSR_SSVWRRPPGTSGLASRAVSPTSLASMQWRKSAWRSSQPTHVPVTMVAAPTSVLPRVMGHHGAHAQST
SCSCRTC_PVESRPPAPRTSLHVPQGRSTVSPGPGAVTAFPSAMTRATRRAAPCAPPPSSPARGVSVWTCACAATARQTVRTAQTRRTVT
PSACPTSSGVRAASVSSSNSSATPSPTVSTAPTSSCVKSPSRPQTTARPTAVPSGPSLASSSLSSSWVVSILCASAWCASAMRGPTGPSR
TSMSAGPRTCPSIS_PRAVPSMAPSQASHAESP__AP_A_WGAGAGCPSTTGTTSQGPRPAARPARRPRCTRRS_TRRPPRPRTPPCTTW
TCSTLQTFRPLRDRTGPTSFEEWRPRRRPAAPTCVTATTAPAAGRPASTTWI_TRTQTPIHPHPRPTASTCRRRTAARPRPPPRGATSIS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MRPL21_ENST00000450904_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_4898nt
ATGATCGTCACGGGGCAGTATGGCAGGCTCTTTGCCGTGGTGCACTTTGCCAGCCGCCAGTGGAAGGTGACCTCTGAAGACCTGATCTTA
ATTGGAAATGAACTAGACCTTGCGTGTGGAGAGAGAATTCGACTGGAGAAGCCTCGCCGCTCCTGCTATTTGCCAACCGCCGGGACGTAC
GGCTGGTGGACGCCGGCGGAGTCAAGCTGGAGTCCACCATCGTGGTCAGCGGCCTGGAGGATGCGGCCGCAGTGGACTTCCAGTTTTCCA
AGGGAGCCGTGTACTGGACAGACGTGAGCGAGGAGGCCATCAAGCAGACCTACCTGAACCAGACGGGGGCCGCCGTGCAGAACGTGGTCA
TCTCCGGCCTGGTCTCTCCCGACGGCCTCGCCTGCGACTGGGTGGGCAAGAAGCTGTACTGGACGGACTCAGAGACCAACCGCATCGAGG
TGGCCAACCTCAATGGCACATCCCGGAAGGTGCTCTTCTGGCAGGACCTTGACCAGCCGAGGGCCATCGCCTTGGACCCCGCTCACGGGT
ACATGTACTGGACAGACTGGGGTGAGACGCCCCGGATTGAGCGGGCAGGGATGGATGGCAGCACCCGGAAGATCATTGTGGACTCGGACA
TTTACTGGCCCAATGGACTGACCATCGACCTGGAGGAGCAGAAGCTCTACTGGGCTGACGCCAAGCTCAGCTTCATCCACCGTGCCAACC
TGGACGGCTCGTTCCGGCAGAAGGTGGTGGAGGGCAGCCTGACGCACCCCTTCGCCCTGACGCTCTCCGGGGACACTCTGTACTGGACAG
ACTGGCAGACCCGCTCCATCCATGCCTGCAACAAGCGCACTGGGGGGAAGAGGAAGGAGATCCTGAGTGCCCTCTACTCACCCATGGACA
TCCAGGTGCTGAGCCAGGAGCGGCAGCCTTTCTTCCACACTCGCTGTGAGGAGGACAATGGCGGCTGCTCCCACCTGTGCCTGCTGTCCC
CAAGCGAGCCTTTCTACACATGCGCCTGCCCCACGGGTGTGCAGCTGCAGGACAACGGCAGGACGTGTAAGGCAGGAGCCGAGGAGGTGC
TGCTGCTGGCCCGGCGGACGGACCTACGGAGGATCTCGCTGGACACGCCGGACTTCACCGACATCGTGCTGCAGGTGGACGACATCCGGC
ACGCCATTGCCATCGACTACGACCCGCTAGAGGGCTATGTCTACTGGACAGATGACGAGGTGCGGGCCATCCGCAGGGCGTACCTGGACG
GGTCTGGGGCGCAGACGCTGGTCAACACCGAGATCAACGACCCCGATGGCATCGCGGTCGACTGGGTGGCCCGAAACCTCTACTGGACCG
ACACGGGCACGGACCGCATCGAGGTGACGCGCCTCAACGGCACCTCCCGCAAGATCCTGGTGTCGGAGGACCTGGACGAGCCCCGAGCCA
TCGCACTGCACCCCGTGATGGGCCTCATGTACTGGACAGACTGGGGAGAGAACCCTAAAATCGAGTGTGCCAACTTGGATGGGCAGGAGC
GGCGTGTGCTGGTCAATGCCTCCCTCGGGTGGCCCAACGGCCTGGCCCTGGACCTGCAGGAGGGGAAGCTCTACTGGGGAGACGCCAAGA
CAGACAAGATCGAGGTGATCAATGTTGATGGGACGAAGAGGCGGACCCTCCTGGAGGACAAGCTCCCGCACATTTTTGGGTTCACGCTGC
TGGGGGACTTCATCTACTGGACTGACTGGCAGCGCCGCAGCATCGAGCGGGTGCACAAGGTCAAGGCCAGCCGGGACGTCATCATTGACC
AGCTGCCCGACCTGATGGGGCTCAAAGCTGTGAATGTGGCCAAGGTCGTCGGAACCAACCCGTGTGCGGACAGGAACGGGGGGTGCAGCC
ACCTGTGCTTCTTCACACCCCACGCAACCCGGTGTGGCTGCCCCATCGGCCTGGAGCTGCTGAGTGACATGAAGACCTGCATCGTGCCTG
AGGCCTTCTTGGTCTTCACCAGCAGAGCCGCCATCCACAGGATCTCCCTCGAGACCAATAACAACGACGTGGCCATCCCGCTCACGGGCG
TCAAGGAGGCCTCAGCCCTGGACTTTGATGTGTCCAACAACCACATCTACTGGACAGACGTCAGCCTGAAGACCATCAGCCGCGCCTTCA
TGAACGGGAGCTCGGTGGAGCACGTGGTGGAGTTTGGCCTTGACTACCCCGAGGGCATGGCCGTTGACTGGATGGGCAAGAACCTCTACT
GGGCCGACACTGGGACCAACAGAATCGAAGTGGCGCGGCTGGACGGGCAGTTCCGGCAAGTCCTCGTGTGGAGGGACTTGGACAACCCGA
GGTCGCTGGCCCTGGATCCCACCAAGGGCTACATCTACTGGACCGAGTGGGGCGGCAAGCCGAGGATCGTGCGGGCCTTCATGGACGGGA
CCAACTGCATGACGCTGGTGGACAAGGTGGGCCGGGCCAACGACCTCACCATTGACTACGCTGACCAGCGCCTCTACTGGACCGACCTGG
ACACCAACATGATCGAGTCGTCCAACATGCTGGGTCAGGAGCGGGTCGTGATTGCCGACGATCTCCCGCACCCGTTCGGTCTGACGCAGT
ACAGCGATTATATCTACTGGACAGACTGGAATCTGCACAGCATTGAGCGGGCCGACAAGACTAGCGGCCGGAACCGCACCCTCATCCAGG
GCCACCTGGACTTCGTGATGGACATCCTGGTGTTCCACTCCTCCCGCCAGGATGGCCTCAATGACTGTATGCACAACAACGGGCAGTGTG
GGCAGCTGTGCCTTGCCATCCCCGGCGGCCACCGCTGCGGCTGCGCCTCACACTACACCCTGGACCCCAGCAGCCGCAACTGCAGCCCGC
CCACCACCTTCTTGCTGTTCAGCCAGAAATCTGCCATCAGTCGGATGATCCCGGACGACCAGCACAGCCCGGATCTCATCCTGCCCCTGC
ATGGACTGAGGAACGTCAAAGCCATCGACTATGACCCACTGGACAAGTTCATCTACTGGGTGGATGGGCGCCAGAACATCAAGCGAGCCA
AGGACGACGGGACCCAGCCCTTTGTTTTGACCTCTCTGAGCCAAGGCCAAAACCCAGACAGGCAGCCCCACGACCTCAGCATCGACATCT
ACAGCCGGACACTGTTCTGGACGTGCGAGGCCACCAATACCATCAACGTCCACAGGCTGAGCGGGGAAGCCATGGGGGTGGTGCTGCGTG
GGGACCGCGACAAGCCCAGGGCCATCGTCGTCAACGCGGAGCGAGGGTACCTGTACTTCACCAACATGCAGGACCGGGCAGCCAAGATCG
AACGCGCAGCCCTGGACGGCACCGAGCGCGAGGTCCTCTTCACCACCGGCCTCATCCGCCCTGTGGCCCTGGTGGTGGACAACACACTGG
GCAAGCTGTTCTGGGTGGACGCGGACCTGAAGCGCATTGAGAGCTGTGACCTGTCAGGGGCCAACCGCCTGACCCTGGAGGACGCCAACA
TCGTGCAGCCTCTGGGCCTGACCATCCTTGGCAAGCATCTCTACTGGATCGACCGCCAGCAGCAGATGATCGAGCGTGTGGAGAAGACCA
CCGGGGACAAGCGGACTCGCATCCAGGGCCGTGTCGCCCACCTCACTGGCATCCATGCAGTGGAGGAAGTCAGCCTGGAGGAGTTCTCAG
CCCACCCATGTGCCCGTGACAATGGTGGCTGCTCCCACATCTGTATTGCCAAGGGTGATGGGACACCACGGTGCTCATGCCCAGTCCACC
TCGTGCTCCTGCAGAACCTGCTGACCTGTGGAGAGCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGTA
TCCCCGGGGCCTGGCGCTGTGACGGCTTTCCCGAGTGCGATGACCAGAGCGACGAGGAGGGCTGCCCCGTGTGCTCCGCCGCCCAGTTCC
CCTGCGCGCGGGGTCAGTGTGTGGACCTGCGCCTGCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGACG
CCATCTGCCTGCCCAACCAGTTCCGGTGTGCGAGCGGCCAGTGTGTCCTCATCAAACAGCAGTGCGACTCCTTCCCCGACTGTATCGACG
GCTCCGACGAGCTCATGTGTGAAATCACCAAGCCGCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATCA
TCCTCTCTCTCTTCGTCATGGGTGGTGTCTATTTTGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGC
ACGAGTATGTCAGCGGGACCCCGCACGTGCCCCTCAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGCG
GAAAGTCCATGATGAGCTCCGTGAGCCTGATGGGGGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCA
GCAGCTCGTCCAGCACGAAGGCCACGCTGTACCCGCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATGG
ACATGTTCTACTCTTCAAACATTCCGGCCACTGCGAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCA
GCACCGACGTGTGTGACAGCGACTACAGCGCCAGCCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTATC
CACCCCCACCCACGCCCCACAGCCAGTACCTGTCGGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCT

>In-frame_MRPL21_ENST00000567045_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_4898nt
ATGATCGTCACGGGGCAGTATGGCAGGCTCTTTGCCGTGGTGCACTTTGCCAGCCGCCAGTGGAAGGTGACCTCTGAAGACCTGATCTTA
ATTGGAAATGAACTAGACCTTGCGTGTGGAGAGAGAATTCGACTGGAGAAGCCTCGCCGCTCCTGCTATTTGCCAACCGCCGGGACGTAC
GGCTGGTGGACGCCGGCGGAGTCAAGCTGGAGTCCACCATCGTGGTCAGCGGCCTGGAGGATGCGGCCGCAGTGGACTTCCAGTTTTCCA
AGGGAGCCGTGTACTGGACAGACGTGAGCGAGGAGGCCATCAAGCAGACCTACCTGAACCAGACGGGGGCCGCCGTGCAGAACGTGGTCA
TCTCCGGCCTGGTCTCTCCCGACGGCCTCGCCTGCGACTGGGTGGGCAAGAAGCTGTACTGGACGGACTCAGAGACCAACCGCATCGAGG
TGGCCAACCTCAATGGCACATCCCGGAAGGTGCTCTTCTGGCAGGACCTTGACCAGCCGAGGGCCATCGCCTTGGACCCCGCTCACGGGT
ACATGTACTGGACAGACTGGGGTGAGACGCCCCGGATTGAGCGGGCAGGGATGGATGGCAGCACCCGGAAGATCATTGTGGACTCGGACA
TTTACTGGCCCAATGGACTGACCATCGACCTGGAGGAGCAGAAGCTCTACTGGGCTGACGCCAAGCTCAGCTTCATCCACCGTGCCAACC
TGGACGGCTCGTTCCGGCAGAAGGTGGTGGAGGGCAGCCTGACGCACCCCTTCGCCCTGACGCTCTCCGGGGACACTCTGTACTGGACAG
ACTGGCAGACCCGCTCCATCCATGCCTGCAACAAGCGCACTGGGGGGAAGAGGAAGGAGATCCTGAGTGCCCTCTACTCACCCATGGACA
TCCAGGTGCTGAGCCAGGAGCGGCAGCCTTTCTTCCACACTCGCTGTGAGGAGGACAATGGCGGCTGCTCCCACCTGTGCCTGCTGTCCC
CAAGCGAGCCTTTCTACACATGCGCCTGCCCCACGGGTGTGCAGCTGCAGGACAACGGCAGGACGTGTAAGGCAGGAGCCGAGGAGGTGC
TGCTGCTGGCCCGGCGGACGGACCTACGGAGGATCTCGCTGGACACGCCGGACTTCACCGACATCGTGCTGCAGGTGGACGACATCCGGC
ACGCCATTGCCATCGACTACGACCCGCTAGAGGGCTATGTCTACTGGACAGATGACGAGGTGCGGGCCATCCGCAGGGCGTACCTGGACG
GGTCTGGGGCGCAGACGCTGGTCAACACCGAGATCAACGACCCCGATGGCATCGCGGTCGACTGGGTGGCCCGAAACCTCTACTGGACCG
ACACGGGCACGGACCGCATCGAGGTGACGCGCCTCAACGGCACCTCCCGCAAGATCCTGGTGTCGGAGGACCTGGACGAGCCCCGAGCCA
TCGCACTGCACCCCGTGATGGGCCTCATGTACTGGACAGACTGGGGAGAGAACCCTAAAATCGAGTGTGCCAACTTGGATGGGCAGGAGC
GGCGTGTGCTGGTCAATGCCTCCCTCGGGTGGCCCAACGGCCTGGCCCTGGACCTGCAGGAGGGGAAGCTCTACTGGGGAGACGCCAAGA
CAGACAAGATCGAGGTGATCAATGTTGATGGGACGAAGAGGCGGACCCTCCTGGAGGACAAGCTCCCGCACATTTTTGGGTTCACGCTGC
TGGGGGACTTCATCTACTGGACTGACTGGCAGCGCCGCAGCATCGAGCGGGTGCACAAGGTCAAGGCCAGCCGGGACGTCATCATTGACC
AGCTGCCCGACCTGATGGGGCTCAAAGCTGTGAATGTGGCCAAGGTCGTCGGAACCAACCCGTGTGCGGACAGGAACGGGGGGTGCAGCC
ACCTGTGCTTCTTCACACCCCACGCAACCCGGTGTGGCTGCCCCATCGGCCTGGAGCTGCTGAGTGACATGAAGACCTGCATCGTGCCTG
AGGCCTTCTTGGTCTTCACCAGCAGAGCCGCCATCCACAGGATCTCCCTCGAGACCAATAACAACGACGTGGCCATCCCGCTCACGGGCG
TCAAGGAGGCCTCAGCCCTGGACTTTGATGTGTCCAACAACCACATCTACTGGACAGACGTCAGCCTGAAGACCATCAGCCGCGCCTTCA
TGAACGGGAGCTCGGTGGAGCACGTGGTGGAGTTTGGCCTTGACTACCCCGAGGGCATGGCCGTTGACTGGATGGGCAAGAACCTCTACT
GGGCCGACACTGGGACCAACAGAATCGAAGTGGCGCGGCTGGACGGGCAGTTCCGGCAAGTCCTCGTGTGGAGGGACTTGGACAACCCGA
GGTCGCTGGCCCTGGATCCCACCAAGGGCTACATCTACTGGACCGAGTGGGGCGGCAAGCCGAGGATCGTGCGGGCCTTCATGGACGGGA
CCAACTGCATGACGCTGGTGGACAAGGTGGGCCGGGCCAACGACCTCACCATTGACTACGCTGACCAGCGCCTCTACTGGACCGACCTGG
ACACCAACATGATCGAGTCGTCCAACATGCTGGGTCAGGAGCGGGTCGTGATTGCCGACGATCTCCCGCACCCGTTCGGTCTGACGCAGT
ACAGCGATTATATCTACTGGACAGACTGGAATCTGCACAGCATTGAGCGGGCCGACAAGACTAGCGGCCGGAACCGCACCCTCATCCAGG
GCCACCTGGACTTCGTGATGGACATCCTGGTGTTCCACTCCTCCCGCCAGGATGGCCTCAATGACTGTATGCACAACAACGGGCAGTGTG
GGCAGCTGTGCCTTGCCATCCCCGGCGGCCACCGCTGCGGCTGCGCCTCACACTACACCCTGGACCCCAGCAGCCGCAACTGCAGCCCGC
CCACCACCTTCTTGCTGTTCAGCCAGAAATCTGCCATCAGTCGGATGATCCCGGACGACCAGCACAGCCCGGATCTCATCCTGCCCCTGC
ATGGACTGAGGAACGTCAAAGCCATCGACTATGACCCACTGGACAAGTTCATCTACTGGGTGGATGGGCGCCAGAACATCAAGCGAGCCA
AGGACGACGGGACCCAGCCCTTTGTTTTGACCTCTCTGAGCCAAGGCCAAAACCCAGACAGGCAGCCCCACGACCTCAGCATCGACATCT
ACAGCCGGACACTGTTCTGGACGTGCGAGGCCACCAATACCATCAACGTCCACAGGCTGAGCGGGGAAGCCATGGGGGTGGTGCTGCGTG
GGGACCGCGACAAGCCCAGGGCCATCGTCGTCAACGCGGAGCGAGGGTACCTGTACTTCACCAACATGCAGGACCGGGCAGCCAAGATCG
AACGCGCAGCCCTGGACGGCACCGAGCGCGAGGTCCTCTTCACCACCGGCCTCATCCGCCCTGTGGCCCTGGTGGTGGACAACACACTGG
GCAAGCTGTTCTGGGTGGACGCGGACCTGAAGCGCATTGAGAGCTGTGACCTGTCAGGGGCCAACCGCCTGACCCTGGAGGACGCCAACA
TCGTGCAGCCTCTGGGCCTGACCATCCTTGGCAAGCATCTCTACTGGATCGACCGCCAGCAGCAGATGATCGAGCGTGTGGAGAAGACCA
CCGGGGACAAGCGGACTCGCATCCAGGGCCGTGTCGCCCACCTCACTGGCATCCATGCAGTGGAGGAAGTCAGCCTGGAGGAGTTCTCAG
CCCACCCATGTGCCCGTGACAATGGTGGCTGCTCCCACATCTGTATTGCCAAGGGTGATGGGACACCACGGTGCTCATGCCCAGTCCACC
TCGTGCTCCTGCAGAACCTGCTGACCTGTGGAGAGCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGTA
TCCCCGGGGCCTGGCGCTGTGACGGCTTTCCCGAGTGCGATGACCAGAGCGACGAGGAGGGCTGCCCCGTGTGCTCCGCCGCCCAGTTCC
CCTGCGCGCGGGGTCAGTGTGTGGACCTGCGCCTGCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGACG
CCATCTGCCTGCCCAACCAGTTCCGGTGTGCGAGCGGCCAGTGTGTCCTCATCAAACAGCAGTGCGACTCCTTCCCCGACTGTATCGACG
GCTCCGACGAGCTCATGTGTGAAATCACCAAGCCGCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATCA
TCCTCTCTCTCTTCGTCATGGGTGGTGTCTATTTTGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGC
ACGAGTATGTCAGCGGGACCCCGCACGTGCCCCTCAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGCG
GAAAGTCCATGATGAGCTCCGTGAGCCTGATGGGGGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCA
GCAGCTCGTCCAGCACGAAGGCCACGCTGTACCCGCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATGG
ACATGTTCTACTCTTCAAACATTCCGGCCACTGCGAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCA
GCACCGACGTGTGTGACAGCGACTACAGCGCCAGCCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTATC
CACCCCCACCCACGCCCCACAGCCAGTACCTGTCGGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MRPL21_ENST00000450904_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_5347nt
ACCTTAGGGCGGCTGGCGTCCGCGTGCAGCCACAGCATCCTGAGACCTTCGGGGCCCGGAGCAGCCTCCCTTTGGTCTGCTTCTCGAAGG
TTCAATTCACAGAGCACTTCATATCTACCAGGGTAATATCAAAATATATGTTCCTAAAACATCCCTGAGTTCACCACCTTGGCCAGAAGT
TGTTCTGCCAGACCCAGTTGAGGAGACCAGACACCATGCAGAGGTCGTGAAGAAGGTGAATGAGATGATCGTCACGGGGCAGTATGGCAG
GCTCTTTGCCGTGGTGCACTTTGCCAGCCGCCAGTGGAAGGTGACCTCTGAAGACCTGATCTTAATTGGAAATGAACTAGACCTTGCGTG
TGGAGAGAGAATTCGACTGGAGAAGCCTCGCCGCTCCTGCTATTTGCCAACCGCCGGGACGTACGGCTGGTGGACGCCGGCGGAGTCAAG
CTGGAGTCCACCATCGTGGTCAGCGGCCTGGAGGATGCGGCCGCAGTGGACTTCCAGTTTTCCAAGGGAGCCGTGTACTGGACAGACGTG
AGCGAGGAGGCCATCAAGCAGACCTACCTGAACCAGACGGGGGCCGCCGTGCAGAACGTGGTCATCTCCGGCCTGGTCTCTCCCGACGGC
CTCGCCTGCGACTGGGTGGGCAAGAAGCTGTACTGGACGGACTCAGAGACCAACCGCATCGAGGTGGCCAACCTCAATGGCACATCCCGG
AAGGTGCTCTTCTGGCAGGACCTTGACCAGCCGAGGGCCATCGCCTTGGACCCCGCTCACGGGTACATGTACTGGACAGACTGGGGTGAG
ACGCCCCGGATTGAGCGGGCAGGGATGGATGGCAGCACCCGGAAGATCATTGTGGACTCGGACATTTACTGGCCCAATGGACTGACCATC
GACCTGGAGGAGCAGAAGCTCTACTGGGCTGACGCCAAGCTCAGCTTCATCCACCGTGCCAACCTGGACGGCTCGTTCCGGCAGAAGGTG
GTGGAGGGCAGCCTGACGCACCCCTTCGCCCTGACGCTCTCCGGGGACACTCTGTACTGGACAGACTGGCAGACCCGCTCCATCCATGCC
TGCAACAAGCGCACTGGGGGGAAGAGGAAGGAGATCCTGAGTGCCCTCTACTCACCCATGGACATCCAGGTGCTGAGCCAGGAGCGGCAG
CCTTTCTTCCACACTCGCTGTGAGGAGGACAATGGCGGCTGCTCCCACCTGTGCCTGCTGTCCCCAAGCGAGCCTTTCTACACATGCGCC
TGCCCCACGGGTGTGCAGCTGCAGGACAACGGCAGGACGTGTAAGGCAGGAGCCGAGGAGGTGCTGCTGCTGGCCCGGCGGACGGACCTA
CGGAGGATCTCGCTGGACACGCCGGACTTCACCGACATCGTGCTGCAGGTGGACGACATCCGGCACGCCATTGCCATCGACTACGACCCG
CTAGAGGGCTATGTCTACTGGACAGATGACGAGGTGCGGGCCATCCGCAGGGCGTACCTGGACGGGTCTGGGGCGCAGACGCTGGTCAAC
ACCGAGATCAACGACCCCGATGGCATCGCGGTCGACTGGGTGGCCCGAAACCTCTACTGGACCGACACGGGCACGGACCGCATCGAGGTG
ACGCGCCTCAACGGCACCTCCCGCAAGATCCTGGTGTCGGAGGACCTGGACGAGCCCCGAGCCATCGCACTGCACCCCGTGATGGGCCTC
ATGTACTGGACAGACTGGGGAGAGAACCCTAAAATCGAGTGTGCCAACTTGGATGGGCAGGAGCGGCGTGTGCTGGTCAATGCCTCCCTC
GGGTGGCCCAACGGCCTGGCCCTGGACCTGCAGGAGGGGAAGCTCTACTGGGGAGACGCCAAGACAGACAAGATCGAGGTGATCAATGTT
GATGGGACGAAGAGGCGGACCCTCCTGGAGGACAAGCTCCCGCACATTTTTGGGTTCACGCTGCTGGGGGACTTCATCTACTGGACTGAC
TGGCAGCGCCGCAGCATCGAGCGGGTGCACAAGGTCAAGGCCAGCCGGGACGTCATCATTGACCAGCTGCCCGACCTGATGGGGCTCAAA
GCTGTGAATGTGGCCAAGGTCGTCGGAACCAACCCGTGTGCGGACAGGAACGGGGGGTGCAGCCACCTGTGCTTCTTCACACCCCACGCA
ACCCGGTGTGGCTGCCCCATCGGCCTGGAGCTGCTGAGTGACATGAAGACCTGCATCGTGCCTGAGGCCTTCTTGGTCTTCACCAGCAGA
GCCGCCATCCACAGGATCTCCCTCGAGACCAATAACAACGACGTGGCCATCCCGCTCACGGGCGTCAAGGAGGCCTCAGCCCTGGACTTT
GATGTGTCCAACAACCACATCTACTGGACAGACGTCAGCCTGAAGACCATCAGCCGCGCCTTCATGAACGGGAGCTCGGTGGAGCACGTG
GTGGAGTTTGGCCTTGACTACCCCGAGGGCATGGCCGTTGACTGGATGGGCAAGAACCTCTACTGGGCCGACACTGGGACCAACAGAATC
GAAGTGGCGCGGCTGGACGGGCAGTTCCGGCAAGTCCTCGTGTGGAGGGACTTGGACAACCCGAGGTCGCTGGCCCTGGATCCCACCAAG
GGCTACATCTACTGGACCGAGTGGGGCGGCAAGCCGAGGATCGTGCGGGCCTTCATGGACGGGACCAACTGCATGACGCTGGTGGACAAG
GTGGGCCGGGCCAACGACCTCACCATTGACTACGCTGACCAGCGCCTCTACTGGACCGACCTGGACACCAACATGATCGAGTCGTCCAAC
ATGCTGGGTCAGGAGCGGGTCGTGATTGCCGACGATCTCCCGCACCCGTTCGGTCTGACGCAGTACAGCGATTATATCTACTGGACAGAC
TGGAATCTGCACAGCATTGAGCGGGCCGACAAGACTAGCGGCCGGAACCGCACCCTCATCCAGGGCCACCTGGACTTCGTGATGGACATC
CTGGTGTTCCACTCCTCCCGCCAGGATGGCCTCAATGACTGTATGCACAACAACGGGCAGTGTGGGCAGCTGTGCCTTGCCATCCCCGGC
GGCCACCGCTGCGGCTGCGCCTCACACTACACCCTGGACCCCAGCAGCCGCAACTGCAGCCCGCCCACCACCTTCTTGCTGTTCAGCCAG
AAATCTGCCATCAGTCGGATGATCCCGGACGACCAGCACAGCCCGGATCTCATCCTGCCCCTGCATGGACTGAGGAACGTCAAAGCCATC
GACTATGACCCACTGGACAAGTTCATCTACTGGGTGGATGGGCGCCAGAACATCAAGCGAGCCAAGGACGACGGGACCCAGCCCTTTGTT
TTGACCTCTCTGAGCCAAGGCCAAAACCCAGACAGGCAGCCCCACGACCTCAGCATCGACATCTACAGCCGGACACTGTTCTGGACGTGC
GAGGCCACCAATACCATCAACGTCCACAGGCTGAGCGGGGAAGCCATGGGGGTGGTGCTGCGTGGGGACCGCGACAAGCCCAGGGCCATC
GTCGTCAACGCGGAGCGAGGGTACCTGTACTTCACCAACATGCAGGACCGGGCAGCCAAGATCGAACGCGCAGCCCTGGACGGCACCGAG
CGCGAGGTCCTCTTCACCACCGGCCTCATCCGCCCTGTGGCCCTGGTGGTGGACAACACACTGGGCAAGCTGTTCTGGGTGGACGCGGAC
CTGAAGCGCATTGAGAGCTGTGACCTGTCAGGGGCCAACCGCCTGACCCTGGAGGACGCCAACATCGTGCAGCCTCTGGGCCTGACCATC
CTTGGCAAGCATCTCTACTGGATCGACCGCCAGCAGCAGATGATCGAGCGTGTGGAGAAGACCACCGGGGACAAGCGGACTCGCATCCAG
GGCCGTGTCGCCCACCTCACTGGCATCCATGCAGTGGAGGAAGTCAGCCTGGAGGAGTTCTCAGCCCACCCATGTGCCCGTGACAATGGT
GGCTGCTCCCACATCTGTATTGCCAAGGGTGATGGGACACCACGGTGCTCATGCCCAGTCCACCTCGTGCTCCTGCAGAACCTGCTGACC
TGTGGAGAGCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGTATCCCCGGGGCCTGGCGCTGTGACGGC
TTTCCCGAGTGCGATGACCAGAGCGACGAGGAGGGCTGCCCCGTGTGCTCCGCCGCCCAGTTCCCCTGCGCGCGGGGTCAGTGTGTGGAC
CTGCGCCTGCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGACGCCATCTGCCTGCCCAACCAGTTCCGG
TGTGCGAGCGGCCAGTGTGTCCTCATCAAACAGCAGTGCGACTCCTTCCCCGACTGTATCGACGGCTCCGACGAGCTCATGTGTGAAATC
ACCAAGCCGCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATCATCCTCTCTCTCTTCGTCATGGGTGGT
GTCTATTTTGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGCACGAGTATGTCAGCGGGACCCCGCAC
GTGCCCCTCAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGCGGAAAGTCCATGATGAGCTCCGTGAGC
CTGATGGGGGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCAGCAGCTCGTCCAGCACGAAGGCCACG
CTGTACCCGCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATGGACATGTTCTACTCTTCAAACATTCCG
GCCACTGCGAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCAGCACCGACGTGTGTGACAGCGACTAC
AGCGCCAGCCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTATCCACCCCCACCCACGCCCCACAGCCAG
TACCTGTCGGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCTTCCCGCCCCCTCCGTCCCCCTGCACG
GACTCATCCTGACCTCGGCCGGGCCACTCTGGCTTCTCTGTGCCCCTGTAAATAGTTTTAAATATGAACAAAGAAAAAAATATATTTTAT
GATTTAAAAAATAAATATAATTGGGATTTTAAAAACATGAGAAATGTGAACTGTGATGGGGTGGGCAGGGCTGGGAGAACTTTGTACAGT

>In-frame_MRPL21_ENST00000567045_chr11_68663983_-_LRP5_ENST00000294304_chr11_68115315_+_5339nt
GCGGCTGGCGTCCGCGTGCAGCCACAGCATCCTGAGACCTTCGGGGCCCGGAGCAGCCTCCCTTTGGTCTGCTTCTCGAAGGTTCAATTC
ACAGAGCACTTCATATCTACCAGGGTAATATCAAAATATATGTTCCTAAAACATCCCTGAGTTCACCACCTTGGCCAGAAGTTGTTCTGC
CAGACCCAGTTGAGGAGACCAGACACCATGCAGAGGTCGTGAAGAAGGTGAATGAGATGATCGTCACGGGGCAGTATGGCAGGCTCTTTG
CCGTGGTGCACTTTGCCAGCCGCCAGTGGAAGGTGACCTCTGAAGACCTGATCTTAATTGGAAATGAACTAGACCTTGCGTGTGGAGAGA
GAATTCGACTGGAGAAGCCTCGCCGCTCCTGCTATTTGCCAACCGCCGGGACGTACGGCTGGTGGACGCCGGCGGAGTCAAGCTGGAGTC
CACCATCGTGGTCAGCGGCCTGGAGGATGCGGCCGCAGTGGACTTCCAGTTTTCCAAGGGAGCCGTGTACTGGACAGACGTGAGCGAGGA
GGCCATCAAGCAGACCTACCTGAACCAGACGGGGGCCGCCGTGCAGAACGTGGTCATCTCCGGCCTGGTCTCTCCCGACGGCCTCGCCTG
CGACTGGGTGGGCAAGAAGCTGTACTGGACGGACTCAGAGACCAACCGCATCGAGGTGGCCAACCTCAATGGCACATCCCGGAAGGTGCT
CTTCTGGCAGGACCTTGACCAGCCGAGGGCCATCGCCTTGGACCCCGCTCACGGGTACATGTACTGGACAGACTGGGGTGAGACGCCCCG
GATTGAGCGGGCAGGGATGGATGGCAGCACCCGGAAGATCATTGTGGACTCGGACATTTACTGGCCCAATGGACTGACCATCGACCTGGA
GGAGCAGAAGCTCTACTGGGCTGACGCCAAGCTCAGCTTCATCCACCGTGCCAACCTGGACGGCTCGTTCCGGCAGAAGGTGGTGGAGGG
CAGCCTGACGCACCCCTTCGCCCTGACGCTCTCCGGGGACACTCTGTACTGGACAGACTGGCAGACCCGCTCCATCCATGCCTGCAACAA
GCGCACTGGGGGGAAGAGGAAGGAGATCCTGAGTGCCCTCTACTCACCCATGGACATCCAGGTGCTGAGCCAGGAGCGGCAGCCTTTCTT
CCACACTCGCTGTGAGGAGGACAATGGCGGCTGCTCCCACCTGTGCCTGCTGTCCCCAAGCGAGCCTTTCTACACATGCGCCTGCCCCAC
GGGTGTGCAGCTGCAGGACAACGGCAGGACGTGTAAGGCAGGAGCCGAGGAGGTGCTGCTGCTGGCCCGGCGGACGGACCTACGGAGGAT
CTCGCTGGACACGCCGGACTTCACCGACATCGTGCTGCAGGTGGACGACATCCGGCACGCCATTGCCATCGACTACGACCCGCTAGAGGG
CTATGTCTACTGGACAGATGACGAGGTGCGGGCCATCCGCAGGGCGTACCTGGACGGGTCTGGGGCGCAGACGCTGGTCAACACCGAGAT
CAACGACCCCGATGGCATCGCGGTCGACTGGGTGGCCCGAAACCTCTACTGGACCGACACGGGCACGGACCGCATCGAGGTGACGCGCCT
CAACGGCACCTCCCGCAAGATCCTGGTGTCGGAGGACCTGGACGAGCCCCGAGCCATCGCACTGCACCCCGTGATGGGCCTCATGTACTG
GACAGACTGGGGAGAGAACCCTAAAATCGAGTGTGCCAACTTGGATGGGCAGGAGCGGCGTGTGCTGGTCAATGCCTCCCTCGGGTGGCC
CAACGGCCTGGCCCTGGACCTGCAGGAGGGGAAGCTCTACTGGGGAGACGCCAAGACAGACAAGATCGAGGTGATCAATGTTGATGGGAC
GAAGAGGCGGACCCTCCTGGAGGACAAGCTCCCGCACATTTTTGGGTTCACGCTGCTGGGGGACTTCATCTACTGGACTGACTGGCAGCG
CCGCAGCATCGAGCGGGTGCACAAGGTCAAGGCCAGCCGGGACGTCATCATTGACCAGCTGCCCGACCTGATGGGGCTCAAAGCTGTGAA
TGTGGCCAAGGTCGTCGGAACCAACCCGTGTGCGGACAGGAACGGGGGGTGCAGCCACCTGTGCTTCTTCACACCCCACGCAACCCGGTG
TGGCTGCCCCATCGGCCTGGAGCTGCTGAGTGACATGAAGACCTGCATCGTGCCTGAGGCCTTCTTGGTCTTCACCAGCAGAGCCGCCAT
CCACAGGATCTCCCTCGAGACCAATAACAACGACGTGGCCATCCCGCTCACGGGCGTCAAGGAGGCCTCAGCCCTGGACTTTGATGTGTC
CAACAACCACATCTACTGGACAGACGTCAGCCTGAAGACCATCAGCCGCGCCTTCATGAACGGGAGCTCGGTGGAGCACGTGGTGGAGTT
TGGCCTTGACTACCCCGAGGGCATGGCCGTTGACTGGATGGGCAAGAACCTCTACTGGGCCGACACTGGGACCAACAGAATCGAAGTGGC
GCGGCTGGACGGGCAGTTCCGGCAAGTCCTCGTGTGGAGGGACTTGGACAACCCGAGGTCGCTGGCCCTGGATCCCACCAAGGGCTACAT
CTACTGGACCGAGTGGGGCGGCAAGCCGAGGATCGTGCGGGCCTTCATGGACGGGACCAACTGCATGACGCTGGTGGACAAGGTGGGCCG
GGCCAACGACCTCACCATTGACTACGCTGACCAGCGCCTCTACTGGACCGACCTGGACACCAACATGATCGAGTCGTCCAACATGCTGGG
TCAGGAGCGGGTCGTGATTGCCGACGATCTCCCGCACCCGTTCGGTCTGACGCAGTACAGCGATTATATCTACTGGACAGACTGGAATCT
GCACAGCATTGAGCGGGCCGACAAGACTAGCGGCCGGAACCGCACCCTCATCCAGGGCCACCTGGACTTCGTGATGGACATCCTGGTGTT
CCACTCCTCCCGCCAGGATGGCCTCAATGACTGTATGCACAACAACGGGCAGTGTGGGCAGCTGTGCCTTGCCATCCCCGGCGGCCACCG
CTGCGGCTGCGCCTCACACTACACCCTGGACCCCAGCAGCCGCAACTGCAGCCCGCCCACCACCTTCTTGCTGTTCAGCCAGAAATCTGC
CATCAGTCGGATGATCCCGGACGACCAGCACAGCCCGGATCTCATCCTGCCCCTGCATGGACTGAGGAACGTCAAAGCCATCGACTATGA
CCCACTGGACAAGTTCATCTACTGGGTGGATGGGCGCCAGAACATCAAGCGAGCCAAGGACGACGGGACCCAGCCCTTTGTTTTGACCTC
TCTGAGCCAAGGCCAAAACCCAGACAGGCAGCCCCACGACCTCAGCATCGACATCTACAGCCGGACACTGTTCTGGACGTGCGAGGCCAC
CAATACCATCAACGTCCACAGGCTGAGCGGGGAAGCCATGGGGGTGGTGCTGCGTGGGGACCGCGACAAGCCCAGGGCCATCGTCGTCAA
CGCGGAGCGAGGGTACCTGTACTTCACCAACATGCAGGACCGGGCAGCCAAGATCGAACGCGCAGCCCTGGACGGCACCGAGCGCGAGGT
CCTCTTCACCACCGGCCTCATCCGCCCTGTGGCCCTGGTGGTGGACAACACACTGGGCAAGCTGTTCTGGGTGGACGCGGACCTGAAGCG
CATTGAGAGCTGTGACCTGTCAGGGGCCAACCGCCTGACCCTGGAGGACGCCAACATCGTGCAGCCTCTGGGCCTGACCATCCTTGGCAA
GCATCTCTACTGGATCGACCGCCAGCAGCAGATGATCGAGCGTGTGGAGAAGACCACCGGGGACAAGCGGACTCGCATCCAGGGCCGTGT
CGCCCACCTCACTGGCATCCATGCAGTGGAGGAAGTCAGCCTGGAGGAGTTCTCAGCCCACCCATGTGCCCGTGACAATGGTGGCTGCTC
CCACATCTGTATTGCCAAGGGTGATGGGACACCACGGTGCTCATGCCCAGTCCACCTCGTGCTCCTGCAGAACCTGCTGACCTGTGGAGA
GCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGTATCCCCGGGGCCTGGCGCTGTGACGGCTTTCCCGA
GTGCGATGACCAGAGCGACGAGGAGGGCTGCCCCGTGTGCTCCGCCGCCCAGTTCCCCTGCGCGCGGGGTCAGTGTGTGGACCTGCGCCT
GCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGACGCCATCTGCCTGCCCAACCAGTTCCGGTGTGCGAG
CGGCCAGTGTGTCCTCATCAAACAGCAGTGCGACTCCTTCCCCGACTGTATCGACGGCTCCGACGAGCTCATGTGTGAAATCACCAAGCC
GCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATCATCCTCTCTCTCTTCGTCATGGGTGGTGTCTATTT
TGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGCACGAGTATGTCAGCGGGACCCCGCACGTGCCCCT
CAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGCGGAAAGTCCATGATGAGCTCCGTGAGCCTGATGGG
GGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCAGCAGCTCGTCCAGCACGAAGGCCACGCTGTACCC
GCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATGGACATGTTCTACTCTTCAAACATTCCGGCCACTGC
GAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCAGCACCGACGTGTGTGACAGCGACTACAGCGCCAG
CCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTATCCACCCCCACCCACGCCCCACAGCCAGTACCTGTC
GGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCTTCCCGCCCCCTCCGTCCCCCTGCACGGACTCATC
CTGACCTCGGCCGGGCCACTCTGGCTTCTCTGTGCCCCTGTAAATAGTTTTAAATATGAACAAAGAAAAAAATATATTTTATGATTTAAA
AAATAAATATAATTGGGATTTTAAAAACATGAGAAATGTGAACTGTGATGGGGTGGGCAGGGCTGGGAGAACTTTGTACAGTGGAGAAAT


Top

FusionGenePPI for MRPL21_LRP5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MRPL21CUL3, MRPL40, MRPL51, MRPL32, MRPS9, MRPL19, MRPL24, MRPL38, ILF2, FAF2, C1QBP, GRSF1, BTRC, ZC3H3, RPS8, MRPL4, HNRNPA1, MRPL39, CASQ2, MRPS30, MRPL47, MRPL50, MRPL9, MRPL1, FOXL2, C6orf203, DUSP11, NBEA, MRPL42, MTIF2, GTPBP8, AUH, MRPL20, HARS2, NDUFAF7, MRPL10, FDXR, LARS2, ELAC2, TOP3A, NDUFAF5, IARS2, CYLDLRP5AXIN1, SMAD9, CAPRIN2, SOST, DKK1, FZD8, TAZ, RASD2, SUSD4, PARP16, POMK, B3GALT2, ETV6, CHST9, LIPH, PRSS37, CSNK1A1, TGIF2LY, DKKL1, SERPINA12, ST8SIA4, SCGB1D1, DKK4, MGAT4C, F9, FAM3B, C4orf26, FCGRT, PODN, ADAM33, BRINP3, LRRC4C, CLPSL1, NXPH2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MRPL21_LRP5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MRPL21_LRP5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLRP5C0432252Osteoporosis with pseudoglioma8CTD_human;ORPHANET;UNIPROT
TgeneLRP5C1866176EXUDATIVE VITREORETINOPATHY 4 (disorder)8CTD_human;UNIPROT
TgeneLRP5C1866079BONE MINERAL DENSITY QUANTITATIVE TRAIT LOCUS 15UNIPROT
TgeneLRP5C0242852Proliferative vitreoretinopathy1CTD_human
TgeneLRP5C0432273Worth disease1CTD_human;ORPHANET;UNIPROT
TgeneLRP5C1843330OSTEOPETROSIS, AUTOSOMAL DOMINANT 11CTD_human;ORPHANET;UNIPROT
TgeneLRP5C1851402Exudative vitreoretinopathy 11ORPHANET;UNIPROT