FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22398

FusionGeneSummary for MPRIP_OAZ2

check button Fusion gene summary
Fusion gene informationFusion gene name: MPRIP_OAZ2
Fusion gene ID: 22398
HgeneTgene
Gene symbol

MPRIP

OAZ2

Gene ID

23164

4947

Gene namemyosin phosphatase Rho interacting proteinornithine decarboxylase antizyme 2
SynonymsM-RIP|MRIP|RHOIP3|RIP3|p116RipAZ2
Cytomap

17p11.2

15q22.31

Type of geneprotein-codingprotein-coding
Descriptionmyosin phosphatase Rho-interacting proteinRho interacting protein 3ornithine decarboxylase antizyme 2ODC-Az 2
Modification date2018052220180523
UniProtAcc

Q6WCQ1

O95190

Ensembl transtripts involved in fusion geneENST00000395811, ENST00000444976, 
ENST00000395804, ENST00000341712, 
ENST00000395806, ENST00000395807, 
ENST00000326005, ENST00000560258, 
ENST00000559753, ENST00000560837, 
Fusion gene scores* DoF score12 X 5 X 7=4203 X 4 X 2=24
# samples 123
** MAII scorelog2(12/420*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/24*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MPRIP [Title/Abstract] AND OAZ2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-FX-A3TO-01AMPRIPchr17

16946285

+OAZ2chr15

64982748

-
TCGALDSARCTCGA-FX-A3TO-01AMPRIPchr17

16946285

+OAZ2chr15

64983790

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000395811ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000395811ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395811ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395811ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000444976ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000444976ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000444976ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000444976ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000395804ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000395804ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395804ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395804ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000341712ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000341712ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000341712ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000341712ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000395806ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
In-frameENST00000395806ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395806ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
5CDS-5UTRENST00000395806ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
3UTR-3CDSENST00000395807ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64982748

-
3UTR-3CDSENST00000395807ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64982748

-
3UTR-5UTRENST00000395807ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64982748

-
3UTR-5UTRENST00000395807ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64982748

-
Frame-shiftENST00000395811ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000395811ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-intronENST00000395811ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-5UTRENST00000395811ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000444976ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000444976ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-intronENST00000444976ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-5UTRENST00000444976ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000395804ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000395804ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-intronENST00000395804ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-5UTRENST00000395804ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000341712ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000341712ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-intronENST00000341712ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-5UTRENST00000341712ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000395806ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
Frame-shiftENST00000395806ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-intronENST00000395806ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
5CDS-5UTRENST00000395806ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-
3UTR-3CDSENST00000395807ENST00000326005MPRIPchr17

16946285

+OAZ2chr15

64983790

-
3UTR-3CDSENST00000395807ENST00000560258MPRIPchr17

16946285

+OAZ2chr15

64983790

-
3UTR-intronENST00000395807ENST00000559753MPRIPchr17

16946285

+OAZ2chr15

64983790

-
3UTR-5UTRENST00000395807ENST00000560837MPRIPchr17

16946285

+OAZ2chr15

64983790

-

Top

FusionProtFeatures for MPRIP_OAZ2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MPRIP

Q6WCQ1

OAZ2

O95190

Targets myosin phosphatase to the actin cytoskeleton.Required for the regulation of the actin cytoskeleton by RhoA andROCK1. Depletion leads to an increased number of stress fibers insmooth muscle cells through stabilization of actin fibers byphosphorylated myosin. Overexpression of MRIP as well as its F-actin-binding region leads to disassembly of stress fibers inneuronal cells. {ECO:0000250|UniProtKB:P97434,ECO:0000269|PubMed:15545284, ECO:0000269|PubMed:16257966}. Ornithine decarboxylase (ODC) antizyme protein thatnegatively regulates ODC activity and intracellular polyaminebiosynthesis and uptake in response to increased intracellularpolyamine levels. Binds to ODC monomers, inhibiting the assemblyof the functional ODC homodimers. Does not target the ODC monomersfor degradation, which allows a protein synthesis-independentrestoration of ODC activity (PubMed:17900240). Involved in thetranslocation of AZIN2 from ER-Golgi intermediate compartment(ERGIC) to the cytosol (By similarity).{ECO:0000250|UniProtKB:O08608, ECO:0000269|PubMed:17900240}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+124673_977411231Coiled coilOntology_term=ECO:0000255
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+123673_977411026Coiled coilOntology_term=ECO:0000255
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+123673_977411039Coiled coilOntology_term=ECO:0000255
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+122673_977411001Coiled coilOntology_term=ECO:0000255
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+124179_252411231Compositional biasNote=Ser-rich
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+123179_252411026Compositional biasNote=Ser-rich
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+123179_252411039Compositional biasNote=Ser-rich
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+122179_252411001Compositional biasNote=Ser-rich
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+124387_483411231DomainPH 2
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+12443_150411231DomainPH 1
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+123387_483411026DomainPH 2
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+12343_150411026DomainPH 1
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+123387_483411039DomainPH 2
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+12343_150411039DomainPH 1
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+122387_483411001DomainPH 2
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+12243_150411001DomainPH 1


Top

FusionGeneSequence for MPRIP_OAZ2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_172aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_112aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_172aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_112aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_172aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_112aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_172aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_112aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_172aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_112aa
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_516nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC

>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_336nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_516nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_336nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_516nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_336nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_516nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_336nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_516nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_336nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_1736nt
GCGGCCGCGCTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCA
TGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGT
CGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCG
TCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATG
GATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGCT
TCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCC
CCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAA
GAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCA
GGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATC
ACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGAC
ATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGT
TGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCC
CTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACC
CCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCAT
TGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGC
CAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAA
CTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGG
TTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAAC
AGCTTTTTCTAAGGGGAGAGCAAGGGGGAGAGATCTAGATTGGGTGAGGGGGACGGGGATGTCAGGGAGGCAAGTGTGTTGTGTTACTGT

>In-frame_MPRIP_ENST00000395811_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_1619nt
GCGGCCGCGCTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCA
TGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGT
CGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCG
TCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATG
GATTATTAGCTGATGGGAGCAAAGAAGGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGT
GTCCCCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTAC
CCAAGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGG
CTCAGGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGT
AATCACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGA
GGACATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTG
CTGTTGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCA
GTCCCTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCC
GACCCCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGG
GCATTGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCA
CTGCCAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATA
GCAACTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCAC
CAGGTTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACT

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_1727nt
CTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCATGTCGGCAG
CCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGTCGCATCTGC
TCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCGTCCACTTCC
AGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATGGATTATTAG
CTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGCTTCAGGAAGG
GCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCCCCTCTCGGC
CAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAAGAGCCACAG
TGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCAGGGTGAGGG
TTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATCACCAATAGT
AAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGACATTGCCTAG
AGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGTTGGCTTTCT
GTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCCCTGGGCAGT
GTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACCCCTCCTTCT
TTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCATTGAAATTTA
CTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGCCAGGAGTTC
TTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAACTCAGGGCC
TGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGGTTCCGAGTA
GTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAACAGCTTTTTC
TAAGGGGAGAGCAAGGGGGAGAGATCTAGATTGGGTGAGGGGGACGGGGATGTCAGGGAGGCAAGTGTGTTGTGTTACTGTGTCAATAAA

>In-frame_MPRIP_ENST00000444976_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_1610nt
CTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCATGTCGGCAG
CCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGTCGCATCTGC
TCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCGTCCACTTCC
AGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATGGATTATTAG
CTGATGGGAGCAAAGAAGGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCCCCTCT
CGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAAGAGCC
ACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCAGGGTG
AGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATCACCAA
TAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGACATTGC
CTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGTTGGCT
TTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCCCTGGG
CAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACCCCTCC
TTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCATTGAAA
TTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGCCAGGA
GTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAACTCAG
GGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGGTTCCG
AGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAACAGCTT

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_1703nt
GCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAAT
TCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGTCGCATCTGCTCAACGACGAGGACCTGACGCAGG
ACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCGTCCACTTCCAGTATGAGGTCACCGAGGTGAAGG
TCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATGGATTATTAGCTGATGGGAGCAAAGAAGGATTGT
TAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGCTTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCC
TGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCCCCTCTCGGCCAGATGTGATGTTCATGGTTTATC
CCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAAGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCA
GCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCAGGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTG
ACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATCACCAATAGTAAATGAAGATGTTTATGAACTGGC
ATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGACATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCA
GGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGTTGGCTTTCTGTTTTGGTTATTAAGACTTGTGTA
TTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCCCTGGGCAGTGTCCTTGAGTTGTTTTTTGACACT
CTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACCCCTCCTTCTTTACAGCTTAGTGTTATTCTGGCA
TTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCATTGAAATTTACTCCCACCACCAGGGCTTTTTTGG
GGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGCCAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGC
CCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAACTCAGGGCCTGGGAATTGTGGGGCAATCCGTTC
TTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGGTTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGG
GCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAACAGCTTTTTCTAAGGGGAGAGCAAGGGGGAGAGA

>In-frame_MPRIP_ENST00000395804_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_1586nt
GCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAAT
TCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGTCGCATCTGCTCAACGACGAGGACCTGACGCAGG
ACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCGTCCACTTCCAGTATGAGGTCACCGAGGTGAAGG
TCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATGGATTATTAGCTGATGGGAGCAAAGAAGGCTCCA
CTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCCCCTCTCGGCCAGATGTGATGTTCATGGTT
TATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAAGAGCCACAGTGGGGGAAGAGGGGAAGTTA
GGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCAGGGTGAGGGTTGCCTATTGTGTTCTCGGA
GTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATCACCAATAGTAAATGAAGATGTTTATGAAC
TGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGACATTGCCTAGAGGGGGAGGGACTGTCTGGG
TTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGTTGGCTTTCTGTTTTGGTTATTAAGACTTG
TGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCCCTGGGCAGTGTCCTTGAGTTGTTTTTTGA
CACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACCCCTCCTTCTTTACAGCTTAGTGTTATTCT
GGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCATTGAAATTTACTCCCACCACCAGGGCTTTT
TTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGCCAGGAGTTCTTGCTCCTGGCTGCAGGCCC
AGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAACTCAGGGCCTGGGAATTGTGGGGCAATCC
GTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGGTTCCGAGTAGTGTCTGAGACTCTGCTCTG
CAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAACAGCTTTTTCTAAGGGGAGAGCAAGGGGGA

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_1647nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGC
TTCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTC
CCCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCA
AGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTC
AGGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAAT
CACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGA
CATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTG
TTGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTC
CCTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGAC
CCCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCA
TTGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTG
CCAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCA
ACTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAG
GTTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAA
CAGCTTTTTCTAAGGGGAGAGCAAGGGGGAGAGATCTAGATTGGGTGAGGGGGACGGGGATGTCAGGGAGGCAAGTGTGTTGTGTTACTG

>In-frame_MPRIP_ENST00000341712_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_1530nt
ATGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAG
TCGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATC
GTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGAT
GGATTATTAGCTGATGGGAGCAAAGAAGGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTG
TGTCCCCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTA
CCCAAGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGG
GCTCAGGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATG
TAATCACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGG
AGGACATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCT
GCTGTTGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTC
AGTCCCTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTC
CGACCCCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGG
GGCATTGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATC
ACTGCCAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATAT
AGCAACTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCA
CCAGGTTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCAC
TAAACAGCTTTTTCTAAGGGGAGAGCAAGGGGGAGAGATCTAGATTGGGTGAGGGGGACGGGGATGTCAGGGAGGCAAGTGTGTTGTGTT

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000326005_chr15_64982748_-_1736nt
GCGGCCGCGCTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCA
TGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGT
CGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCG
TCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATG
GATTATTAGCTGATGGGAGCAAAGAAGGATTGTTAGCACTGCTAGAGTTTGCTGAAGAGAAGATGAAAGTGAACTATGTCTTCATCTGCT
TCAGGAAGGGCCGAGAAGACAGAGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGTGTCC
CCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTACCCAA
GAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGGCTCA
GGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGTAATC
ACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGAGGAC
ATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTGCTGT
TGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCAGTCC
CTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCCGACC
CCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGGGCAT
TGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCACTGC
CAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATAGCAA
CTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCACCAGG
TTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACTAAAC
AGCTTTTTCTAAGGGGAGAGCAAGGGGGAGAGATCTAGATTGGGTGAGGGGGACGGGGATGTCAGGGAGGCAAGTGTGTTGTGTTACTGT

>In-frame_MPRIP_ENST00000395806_chr17_16946285_+_OAZ2_ENST00000560258_chr15_64982748_-_1619nt
GCGGCCGCGCTGAGCCCCTAGCCCGCCGGGAGCGCCAGGCCGGCCAGGCCTGCGCCGCCGCCGCCGCCGCCGTCGCCGCCGCGCCGACCA
TGTCGGCAGCCAAGGAGAACCCGTGCAGGAAATTCCAGGCCAACATCTTCAACAAGAGCAAGTGTCAGAACTGCTTCAAGCCCCGCGAGT
CGCATCTGCTCAACGACGAGGACCTGACGCAGGACGAGAAGCTCACTGTGACCCAGGACCTCCCTGTGAATGATGGAAAACCTCACATCG
TCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCTTGGGATGCAGTCCTGTCCAGCCAGAGCCTGTTTGTAGAAATCCCAGATG
GATTATTAGCTGATGGGAGCAAAGAAGGCTCCACTCCTGAAGACCTTCAGCTTCTTGGGCTTTGAGATTGTACGTCCAGGCCATCCCTGT
GTCCCCTCTCGGCCAGATGTGATGTTCATGGTTTATCCCCTGGACCAGAACTTGTCCGATGAGGACTAATAGTCATAGAGGATGCTTTAC
CCAAGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCCTGGGACAGACGAGAGGGCTCCTCGCTGTCTAGGGAAGGACACTGAGGGG
CTCAGGGTGAGGGTTGCCTATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAACATATTATTCACATGT
AATCACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTCTAAACTGCGCTGTGTGATGTGTTCTATCTAGCCTAGGGGA
GGACATTGCCTAGAGGGGGAGGGACTGTCTGGGTTCAGGGGCATGGCCTGGAGGGCTGGTGGGCAGCACTGTCAGGCTCAGGTTTCCCTG
CTGTTGGCTTTCTGTTTTGGTTATTAAGACTTGTGTATTTTCTTTCTTTGCTTCCTGTCACCCCAGGGGCTCCTGAGTATAGGCTTTTCA
GTCCCTGGGCAGTGTCCTTGAGTTGTTTTTTGACACTCTTACCTGGGCTTCTCTGTGTGCATTTGCGTCTGGCCTGGAGTAAGCAGGTCC
GACCCCTCCTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTAATCTGTTTAATGTTATCAGTACATTTTAAATAGGG
GCATTGAAATTTACTCCCACCACCAGGGCTTTTTTGGGGGATGCCTGGGCCTTTAAAACACTAGCCAAACTCTAATTAATTCTCAAATCA
CTGCCAGGAGTTCTTGCTCCTGGCTGCAGGCCCAGGCCCCAAGGTCTCCTTCTTGGGGTCACAAACAGCAGTAAGGAAGAGGAATATATA
GCAACTCAGGGCCTGGGAATTGTGGGGCAATCCGTTCTTAGGGACTGGATACTTCTGGCTGGCTGAGTATAGTACTAGCTGCCTCCCCAC
CAGGTTCCGAGTAGTGTCTGAGACTCTGCTCTGCAGGGCCTAGGGTAGCGCTGGGAGTGTAGAAGTGGCCTGCCCTTAACTGTTTTCACT


Top

FusionGenePPI for MPRIP_OAZ2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MPRIPPPP1R12C, YWHAB, YWHAG, YWHAQ, SFN, RHOA, ATXN7, ARRB1, FBXO25, LRRK2, NOS3, AGAP2, PAN2, IKBKG, RACGAP1, PIAS4, LSM8, YTHDC1, RPA3, RPA2, RPA1, CCDC101, WDR83, PSAT1, TCP10L2, PSMC3, FNDC4, PACSIN2, ZFP41, PTEN, PCM1, RPGRIP1L, CAPZA2, CDK2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, LIMA1, ANLN, MYO19, MYO18A, ESR1, ARMC7, CDH1, VAPB, BTRC, JPH4, VAPA, PACSIN1, PLK1, VTN, NECAB1, CTAGE5, TRIM25OAZ2AZIN1, ELAVL1, MOV10, NXF1, ODC1, AZIN2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+1242_383411231F-actin
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+1232_383411026F-actin
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+1232_383411039F-actin
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+1222_383411001F-actin
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+124824_879411231PPP1R12A
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+123824_879411026PPP1R12A
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+123824_879411039PPP1R12A
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+122824_879411001PPP1R12A
HgeneMPRIPchr17:16946285chr15:64982748ENST00000341712+124546_824411231RHOA
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395804+123546_824411026RHOA
HgeneMPRIPchr17:16946285chr15:64982748ENST00000395811+123546_824411039RHOA
HgeneMPRIPchr17:16946285chr15:64982748ENST00000444976+122546_824411001RHOA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MPRIP_OAZ2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MPRIP_OAZ2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMPRIPC0043094Weight Gain1CTD_human