FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22391

FusionGeneSummary for MPPED2_AMOTL1

check button Fusion gene summary
Fusion gene informationFusion gene name: MPPED2_AMOTL1
Fusion gene ID: 22391
HgeneTgene
Gene symbol

MPPED2

AMOTL1

Gene ID

744

154810

Gene namemetallophosphoesterase domain containing 2angiomotin like 1
Synonyms239FB|C11orf8JEAP
Cytomap

11p14.1

11q21

Type of geneprotein-codingprotein-coding
Descriptionmetallophosphoesterase MPPED2fetal brain protein 239metallophosphoesterase domain-containing protein 2angiomotin-like protein 1junction-enriched and associated protein
Modification date2018051920180523
UniProtAcc

Q15777

Q8IY63

Ensembl transtripts involved in fusion geneENST00000448418, ENST00000358117, 
ENST00000524667, 
ENST00000317829, 
ENST00000317837, ENST00000433060, 
ENST00000539727, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 2 X 2=8
# samples 43
** MAII scorelog2(4/8*10)=2.32192809488736log2(3/8*10)=1.90689059560852
Context

PubMed: MPPED2 [Title/Abstract] AND AMOTL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-FG-5963-01AMPPED2chr11

30601793

-AMOTL1chr11

94554696

+
TCGARVLGGTCGA-FG-5963-02AMPPED2chr11

30601793

-AMOTL1chr11

94554696

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000448418ENST00000317829MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
In-frameENST00000448418ENST00000317837MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
In-frameENST00000448418ENST00000433060MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
5CDS-3UTRENST00000448418ENST00000539727MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
Frame-shitENST00000358117ENST00000317829MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
Frame-shitENST00000358117ENST00000317837MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
Frame-shitENST00000358117ENST00000433060MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
5CDS-3UTRENST00000358117ENST00000539727MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
intron-3CDSENST00000524667ENST00000317829MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
intron-3CDSENST00000524667ENST00000317837MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
intron-3CDSENST00000524667ENST00000433060MPPED2chr11

30601793

-AMOTL1chr11

94554696

+
intron-3UTRENST00000524667ENST00000539727MPPED2chr11

30601793

-AMOTL1chr11

94554696

+

Top

FusionProtFeatures for MPPED2_AMOTL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MPPED2

Q15777

AMOTL1

Q8IY63

Displays low metallophosphoesterase activity (in vitro).May play a role in the development of the nervous system (Bysimilarity). {ECO:0000250}. Inhibits the Wnt/beta-catenin signaling pathway,probably by recruiting CTNNB1 to recycling endosomes and hencepreventing its translocation to the nucleus.{ECO:0000269|PubMed:22362771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000317829+112438_639323907Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000317829+112665_694323907Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000317829+112729_762323907Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000433060+213438_639373957Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000433060+213665_694373957Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000433060+213729_762373957Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000317829+112953_956323907MotifNote=PDZ-binding
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000433060+213953_956373957MotifNote=PDZ-binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000317829+112259_279323907Coiled coilOntology_term=ECO:0000255
TgeneAMOTL1chr11:30601793chr11:94554696ENST00000433060+213259_279373957Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for MPPED2_AMOTL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317829_chr11_94554696_+_626aa
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHIRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQPP
PAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKSTTKRESLDKAMRNKLEGEIRRL
HDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELRE
KQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKY
LEESTIRHFAMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDAG
KTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTG

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317837_chr11_94554696_+_213aa
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHIRPCQLPFPSTMQQHSPMNFRTSLTSSQLAEEKKEEKTWKGSIGLLLG
KEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLKHPAAKGTAEKLENS

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000433060_chr11_94554696_+_626aa
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHIRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQPP
PAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKSTTKRESLDKAMRNKLEGEIRRL
HDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELRE
KQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKY
LEESTIRHFAMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDAG
KTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317829_chr11_94554696_+_1878nt
ATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAAC
ATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCATG
TCCTCCCAGACCTCTTCCGCCAGCGGGCCACTGCACTCTGTCTCCCTGCCGCTTCCACTCCCGATGGCCCTGGGTGCTCCACAGCCCCCG
CCTGCCGCCTCCCCCAGCCAGCAGCTTGGTCCAGATGCCTTTGCGATTGTGGAGCGAGCCCAGCAAATGGTGGAGATATTAACAGAGGAG
AACCGGGTGCTTCACCAGGAACTTCAGGGTTACTACGACAATGCCGACAAGCTCCACAAGTTTGAAAAAGAACTTCAGAGAATTTCGGAA
GCCTATGAAAGTCTGGTCAAGTCTACCACCAAGCGAGAATCGCTGGACAAGGCCATGAGAAACAAATTGGAAGGCGAGATTAGAAGACTT
CATGATTTCAACAGAGACCTCCGAGATCGACTAGAGACTGCTAACAGGCAACTATCCAGCAGGGAATACGAAGGGCATGAAGACAAAGCT
GCAGAGGGGCATTATGCTTCCCAGAACAAAGAATTCTTGAAGGAAAAGGAGAAATTAGAAATGGAGTTAGCAGCAGTGCGGACTGCAAGT
GAGGACCATCGGAGACACATCGAGATCCTGGACCAGGCTTTGAGCAACGCCCAGGCCAGGGTCATCAAGCTGGAAGAGGAGTTACGAGAG
AAGCAAGCATATGTTGAGAAAGTTGAGAAGCTGCAGCAGGCCCTGACCCAGCTGCAGTCTGCATGTGAGAAGCGAGAACAGATGGAGCGG
AGACTGCGGACTTGGCTGGAGAGAGAGCTGGATGCACTGAGAACCCAGCAGAAACATGGAAATGGCCAGCCAGCCAACATGCCGGAATAC
AATGCCCCAGCCCTCCTGGAACTTGTGCGGGAGAAGGAGGAGCGGATCCTGGCCCTGGAGGCCGACATGACAAAGTGGGAGCAGAAGTAC
CTGGAGGAGAGCACCATCCGACACTTTGCCATGAATGCCGCAGCCACTGCAGCAGCTGAGAGGGACACCACGATCATCAACCACTCACGG
AATGGCAGCTACGGAGAGAGCTCGCTGGAGGCCCACATCTGGCAAGAGGAGGAGGAGGTGGTGCAGGCCAACAGAAGGTGTCAGGACATG
GAATACACTATTAAAAATCTCCATGCCAAAATCATAGAGAAAGATGCTATGATTAAGGTCCTGCAGCAGCGATCTCGTAAAGATGCCGGG
AAGACAGACTCCTCCAGCCTACGTCCTGCCCGCTCCGTTCCATCCATAGCAGCAGCTACTGGGACACACTCTCGCCAGACCTCTCTTACC
AGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGGGAAGGAGCACCATGAGCATGCC
TCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAGCAGTGCCCACGCCAAGACAGGC
AGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCCCAGCCGCGGCCGGCTGAGCACG
ACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTCTCCTGGCCATGGGAAGTCGCCT

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317837_chr11_94554696_+_639nt
ATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAAC
ATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCATG
AACTTCAGGACCTCTCTTACCAGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGGG
AAGGAGCACCATGAGCATGCCTCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAGC
AGTGCCCACGCCAAGACAGGCAGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCCC
AGCCGCGGCCGGCTGAGCACGACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTCT
CCTGGCCATGGGAAGTCGCCTGACCACAGAGGCCGGGTCAGCAGCTTGCTGCACAAGCCCGAGTTCCCTGATGGAGAGATGATGGAAGTC

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000433060_chr11_94554696_+_1878nt
ATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAAC
ATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCATG
TCCTCCCAGACCTCTTCCGCCAGCGGGCCACTGCACTCTGTCTCCCTGCCGCTTCCACTCCCGATGGCCCTGGGTGCTCCACAGCCCCCG
CCTGCCGCCTCCCCCAGCCAGCAGCTTGGTCCAGATGCCTTTGCGATTGTGGAGCGAGCCCAGCAAATGGTGGAGATATTAACAGAGGAG
AACCGGGTGCTTCACCAGGAACTTCAGGGTTACTACGACAATGCCGACAAGCTCCACAAGTTTGAAAAAGAACTTCAGAGAATTTCGGAA
GCCTATGAAAGTCTGGTCAAGTCTACCACCAAGCGAGAATCGCTGGACAAGGCCATGAGAAACAAATTGGAAGGCGAGATTAGAAGACTT
CATGATTTCAACAGAGACCTCCGAGATCGACTAGAGACTGCTAACAGGCAACTATCCAGCAGGGAATACGAAGGGCATGAAGACAAAGCT
GCAGAGGGGCATTATGCTTCCCAGAACAAAGAATTCTTGAAGGAAAAGGAGAAATTAGAAATGGAGTTAGCAGCAGTGCGGACTGCAAGT
GAGGACCATCGGAGACACATCGAGATCCTGGACCAGGCTTTGAGCAACGCCCAGGCCAGGGTCATCAAGCTGGAAGAGGAGTTACGAGAG
AAGCAAGCATATGTTGAGAAAGTTGAGAAGCTGCAGCAGGCCCTGACCCAGCTGCAGTCTGCATGTGAGAAGCGAGAACAGATGGAGCGG
AGACTGCGGACTTGGCTGGAGAGAGAGCTGGATGCACTGAGAACCCAGCAGAAACATGGAAATGGCCAGCCAGCCAACATGCCGGAATAC
AATGCCCCAGCCCTCCTGGAACTTGTGCGGGAGAAGGAGGAGCGGATCCTGGCCCTGGAGGCCGACATGACAAAGTGGGAGCAGAAGTAC
CTGGAGGAGAGCACCATCCGACACTTTGCCATGAATGCCGCAGCCACTGCAGCAGCTGAGAGGGACACCACGATCATCAACCACTCACGG
AATGGCAGCTACGGAGAGAGCTCGCTGGAGGCCCACATCTGGCAAGAGGAGGAGGAGGTGGTGCAGGCCAACAGAAGGTGTCAGGACATG
GAATACACTATTAAAAATCTCCATGCCAAAATCATAGAGAAAGATGCTATGATTAAGGTCCTGCAGCAGCGATCTCGTAAAGATGCCGGG
AAGACAGACTCCTCCAGCCTACGTCCTGCCCGCTCCGTTCCATCCATAGCAGCAGCTACTGGGACACACTCTCGCCAGACCTCTCTTACC
AGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGGGAAGGAGCACCATGAGCATGCC
TCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAGCAGTGCCCACGCCAAGACAGGC
AGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCCCAGCCGCGGCCGGCTGAGCACG
ACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTCTCCTGGCCATGGGAAGTCGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317829_chr11_94554696_+_8192nt
CCCAGATCGAGGCTGCTCGGGTCCTTTCTCCCCCCGCCTCCCTCTAGCGCCGCGCCCCCTGGCCCCCAGCCCCAGCCTGCGGCGGGACCT
CCGGGGTCGAAGGTTCTGGCCCGCTCGCGCCCCTCGCCGCCCCCGCGCGCCCCCAGCGCTCCTCCAGCCGGCTCGGGCCGCTCGGCTATG
GATCGCCTGCTCGCCGGGCGCTGAAGGCATCCCCGGGATCCGGAGCGCAGCCCGGGAAAGAAATGCACAGCGGTATTGATGAGTAGATCC
TTGGATTCAGAGGTTGGCTGAAACGCACCATGCCTGCTTCCATCTTTTGCTCTGTAAAGTTGTGAATTGCTCATGCCTATAGGGAGGAAG
GATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAA
CATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCAT
GTCCTCCCAGACCTCTTCCGCCAGCGGGCCACTGCACTCTGTCTCCCTGCCGCTTCCACTCCCGATGGCCCTGGGTGCTCCACAGCCCCC
GCCTGCCGCCTCCCCCAGCCAGCAGCTTGGTCCAGATGCCTTTGCGATTGTGGAGCGAGCCCAGCAAATGGTGGAGATATTAACAGAGGA
GAACCGGGTGCTTCACCAGGAACTTCAGGGTTACTACGACAATGCCGACAAGCTCCACAAGTTTGAAAAAGAACTTCAGAGAATTTCGGA
AGCCTATGAAAGTCTGGTCAAGTCTACCACCAAGCGAGAATCGCTGGACAAGGCCATGAGAAACAAATTGGAAGGCGAGATTAGAAGACT
TCATGATTTCAACAGAGACCTCCGAGATCGACTAGAGACTGCTAACAGGCAACTATCCAGCAGGGAATACGAAGGGCATGAAGACAAAGC
TGCAGAGGGGCATTATGCTTCCCAGAACAAAGAATTCTTGAAGGAAAAGGAGAAATTAGAAATGGAGTTAGCAGCAGTGCGGACTGCAAG
TGAGGACCATCGGAGACACATCGAGATCCTGGACCAGGCTTTGAGCAACGCCCAGGCCAGGGTCATCAAGCTGGAAGAGGAGTTACGAGA
GAAGCAAGCATATGTTGAGAAAGTTGAGAAGCTGCAGCAGGCCCTGACCCAGCTGCAGTCTGCATGTGAGAAGCGAGAACAGATGGAGCG
GAGACTGCGGACTTGGCTGGAGAGAGAGCTGGATGCACTGAGAACCCAGCAGAAACATGGAAATGGCCAGCCAGCCAACATGCCGGAATA
CAATGCCCCAGCCCTCCTGGAACTTGTGCGGGAGAAGGAGGAGCGGATCCTGGCCCTGGAGGCCGACATGACAAAGTGGGAGCAGAAGTA
CCTGGAGGAGAGCACCATCCGACACTTTGCCATGAATGCCGCAGCCACTGCAGCAGCTGAGAGGGACACCACGATCATCAACCACTCACG
GAATGGCAGCTACGGAGAGAGCTCGCTGGAGGCCCACATCTGGCAAGAGGAGGAGGAGGTGGTGCAGGCCAACAGAAGGTGTCAGGACAT
GGAATACACTATTAAAAATCTCCATGCCAAAATCATAGAGAAAGATGCTATGATTAAGGTCCTGCAGCAGCGATCTCGTAAAGATGCCGG
GAAGACAGACTCCTCCAGCCTACGTCCTGCCCGCTCCGTTCCATCCATAGCAGCAGCTACTGGGACACACTCTCGCCAGACCTCTCTTAC
CAGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGGGAAGGAGCACCATGAGCATGC
CTCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAGCAGTGCCCACGCCAAGACAGG
CAGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCCCAGCCGCGGCCGGCTGAGCAC
GACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTCTCCTGGCCATGGGAAGTCGCC
TGACCACAGAGGCCGGGTCAGCAGCTTGCTGCACAAGCCCGAGTTCCCTGATGGAGAGATGATGGAAGTCCTCATCTAACTGCCATCCCT
GTGGAATTTCAGTACAGAACACTGACAAACAAGGAAAGCGGCAGAGAAAGAAGAAAGACCTAGAAGGTTGTAGATGGGAAATCAGGAATG
ATTTGAACTGATAAAGATTTCAGACTCATAAGAACACATTTTATAAATGTTAAACACAAAAACTACATGACTGAAGATAGAAGAGAATGC
GATGGATTTTATTACACATGGTGGAAGAGAGAAGAGGCGTGTAGGTTTGCAAACAAAGTTAAGAAATAGGAAACTGAATTTTTCATTGTA
CAGAAAATGTATCTCTTGGGGAGGGCCTGTGTACCCCCATTCTCTGATTATAAACAGATAAACCCAAATGTGGATCATCCTTGGAATACC
CCCATTCTCCTTGCCTCTTAGCATGTTTGATTTAAGAAAAGCCTCCAGGAAATCTTGAGAGCCTGTCTTGGCATAATGCAGTGTCACCTG
TGCCAACCATGGGGTGTCCCGTGAGTGTGAGTGTGGCAGTGAGAAGAAGCATCGAGGGCGAGGGGAATATGAAAGTTGGTCTTCACCTAA
TTACCTGTTTGGTTTGGATTTTCAAGAGATGATTGGGCTTCTTAGCTTTTCTGAATTCTGCAGTATTTTCTAAACAGGATAGATTATGAT
CTCGGTCCCCATCCATCCTAACTTCTGAGTTCATCTCTGTCTCTGCTTTACAGTCTTTAATTTTTTGTTGTTCCTTCATTTTTTTCTTTT
TAATAAGACATAGCAGAATTCCTTAGGTATGGGATTTATGAGACCAGTACCTGAACTGTCATCATTCCTACTGTGTTTGATAGTGACCAG
TAGGACAAAGCCACGTGCCGACTTCCTGGCTGCTTCACCTTTGCATAGCTGGGTTGCAGCTGCGAACCTCATTCTGACTGTGAACTAAGC
AAGCTTTGAGGAGGCAGGAGATTCCGTGGGTCCCTGTGACATATTGCATTAAGATCGTGGCACTTGCTTTTTTGTCTTTCACATCGGCTG
TCTTGCAAGGAGCTTGACATTTCCAAATTCCATTGCTCTGTTTGGGGAAGACTTAGGACAGCACTCCAGGAAACAGATGACAATTTACAG
ACAGTTGTCTCAGTGGTTTCCAGAATCTCACCAGCCTCCCGTATAGCTTCTTGTATTGAGGCTCATGAGCGTATTCACACTCTTTCCTCC
CCCGCGCACGCCTCTGCTTGCTCTCGATCAGCATCCAGACCTCCGTGGCACCAGGTTGCCTCTGTTGTGAACTTCTTTTGTAACCTACCA
GGCCAGTTGTATATACAGTGTTGTCAGGTTTTTCCGGGTTTCAGTTTTGAGGCAGTTTATTCAAAGTGAGACAGAAGTGCCACGGAAAAG
AGGCAGGAGTGTGTTAGGTGGTGGGTCCATTAGACCTCTGCTGTGACATTGCATATTCAGCTCTGCAGACACTGGCTTCCTTTACAAATC
TAAGAGATGCTGGATTAGAAAAGAGGAGAAGCTCATCGGGCCATCAGAGAGATGCTCCTACAGGGTCCTGATGTTTTTGTACCTCCAGGT
CAGCTGGATCGCTGTTTTCCCAGTTCCCTTTGCTCATGCTTACTTAGAGGAAGAAAGAAAGGGGGGTACCTCTTCCAAGTACCTTCTAAA
TGAAACACTCAAGAGAGTGCTACTCAGGAAACTTTGCTTGGATCCTAAAATGGACTGGTCTTGGGTGTGTAACCCCGGTGAAGTTATAGC
CTCCCCAAATTGAGGTGACAGAAGGAAGACAAGAGGTGTAAGCTGGAGAGGGAAGGGAAGAAATCAGTGGCTTTGGCCAGCCTCTGTGCC
ACCCAGTACGACAGAGGAGTGGGAACTGGCCCTCTGGGGCTCTGCTTGGCCATAGGCACTGCACATTGTGCCACCTGCTCATCACCTCCT
CTAGTCTCACACTGAGCATCGGAGTACCTGTTGTGCAGACAGGAAAACTGAGGAGCTCTGAGAGGCTGAGCATGGAGCTCACCCCATGCC
ATAGGGTGTGGGAAGAGGGCACAGGAGGCCTCATCCATGGGGGAAAGGGTTGAGGATGGACATGGGTGGGGAGAGGGCATAGACATCCCT
TCCTAATCTCTGTTCCCACCACATTTCATAGGAGATGAGTTAGGAGATGACAGCTAACTCTCTTAAGGACATTTTGACCCCAGTTTATGT
TGGGGATGGACCAGAAAGGAAAATGTCTAGAGATAGGAAGGTAAATCAACTCTGCCAGCCCCTACCATCAGGTCTGGGCCACCCCAAACT
TGGGCTGCCTCCCTTAGACATAGGTTAGAGTGAGAGACCCAGCTGTTTCTCCCGAAGCCTCGTCTTCATGCCCCAGACACCTGATTGCCC
CAATCAGGTGTCAGACTTGCTTGCTCTTCGAGGTCCCCCTGAGCTGCCAAGTGTTTTCATTGTAAACAGACACATCGCCATGTTTCAGGG
CTTCAACGGCATTGTATTTTGGACTTTGACCGTATTTTTTTTCTCTTAACCTACTGAGACTCTTCCTTAAGAACAGGATCTATAGCTTTA
AAATGTCTTCTTCTATGGGAAATTTCCTGCCAAGCCAGGGCACTAAATTCTTTCATCATTAGAGCTTTCCTGAAGTCCGGCCATATACTG
AGTACCTGCTCTGAGTTCTGGGCAGCTTACAATATCTTAAACAGATTTTCAGAAAAATAATGCAACTATATTTTCTAGTGTCAACTGTAT
GCAAACAGTGTGGTAAATACCTTTTAATTAGTCCTCCACCCACCTGGAGTACAGGGGGTGCGTTTATTATTCTGATTTCACTGATGAGGA
AATGGGCTCAGAAAGGTTAAGTCCCTTCCTGAAATCTCACAGCCAGGAGAAGCTAGGATGATTTAAAACAAAGTTTGGAGAGGCACTGGG
CATAGACCCTGGCTGTACAGCCTCTAACATGCGGCACTGCATCTTGGCAGTCTCTATGCCTGTCTGTGATGTGTGTGTGCACGTGTAACT
ACACACACACACACACACACACACACACACACACACAGCTATCACACATCTCAGAGCCTAAGAAATAGGACTAAGCCCAGAACTCCTAGA
ATCACCTATAAATGCTAGGCATAGATGGAAATTATTGTGTTCCACCAGAAGCACAGCTCCAAACTATACCTAAAAAATATTTCTGCACTT
CCCAGAGACCTGGACTTCAAACTTTCCCAGTGGAGCCTGATTATAGAACTTGAGGGTCCTATCTCAGGATGAAGGGGAGAGGCCCTGGCT
TCACGGGAAGGTATTCCAGCATTGTTCTGCTTCACCCTTGACTGCGTTGTCTGGCAGTTTCTGTGTGCTGCCAGGATATTATATGGAACT
GGAGAAGTTGGAGTCAGGTCTCTGAAGCTAGAGTTTCACTAATTAGATGCCTCTGTACATGAGAACTATTACTGTCTGCAGGTCCATATA
GCTAAGCTGCCAGGAAAAACACATTATCTTCCAAAACTTTCAGAGCATGTGCAGAACCCTTTCTTAGCGTTTTCTTCTCAGCATTTTCTC
TGCCTCCCAGAGGCTGGCAGCCAGTGACACTGCAGAGTTCAGCATGTTCTAACCATGCACGCAGGGCAGGGGCTGCCTTGGCCCTCCTCA
GGCTTTCGTTGGGAGAGCAGGCAGTGGTGGAGCCCTTCTGGGTGCAGTCCTCTGGGGTTGCTCTTTGGAACTCATGTATGAGTTTGACTC
CACAAGGCTTGGCATGGATACCAAAACAGTTGCAACAAATTAGTTCTGAACCTGGAACAGAGAATTCAGTGCTTCTGTTACTCAGGAAGG
AGGTGTTCAGAATGCCCCGTGCAGAGCAGCCAGTCATTACTCTTGTTTGTTCTCACCTGGGTGCGCACCCTCATGATGCAGTGGCTGTAG
CACCTTCATGCCAGGTGCTGAGAGAATGGGAAATTCTTCCTCCCCATTGACCTGAGTCCCAGAGACTTAGGGACACAGACTTCAGGTGAG
GCTGCGGACCTCAGAAGCAGTGGATAATAGATTGGGGCATTAAAAGCTTTTGAGGCAGGGGGCTCATGTTTTGACTGCAGGGAGTTATGC
TGAGCAAAGAGATGTGTTTTTCAAAACCAGGGTTCAAAACCAGTGTCCACGCTGGAGTAAGTGGAGCATGCTTCTCTGTGTTCTCTGAAT
GATCTTGCACTCCTCTTAAGCAAAGGAGTACCATGACCATAGTCAGTGGGATCCCACAAATGTTCTTAAATGGGTAAGGCTTTAAGTAGC
CAGAGAGTATCCAGCCTACCATTGGCTTCTCCACATCCTAAAACCTGAGACAGCCTTGGTATATGCTTTATAAATGTTTCTTTTCTTGTT
GTTTAAGTAATTAAAGTGTTTAAAATGTCTTCATTAGATGTGACGATTGTTTAATGAGTTTGCCTCTGACGTGTGGCTCCATGGGAGATA
GGCAAAGTAATTAAGAAGTTACCAGAAATTGGTCGGCTGGGGAAATGCAAAAGTTAGCATTTCAGTAGTGAATTTCTCCTGGAACAAATG
AGCAATTTTTCCTCTTTCTCTTAAGTAGTATACCCTTTTCTCACTTAGTAATTTAATGGTATATAAAGACATGTGTATAAGTGAGTGCAT
ACATATGAGGTATGACTATAGGGTTGTTTGTGGGAATTTCTTTTCCTAACATACAGAAGATCAAAGTGTTCATCTCACCCCGCCCTCCTT
AAAAGGTGTCTTTTGGGAGACTATGTGCTCATTGACTATAGTGCTGCCAAGTAAAAATATCTTGGGAACTCTTCTACTAGAATGGCCTTC
AGGGCTTGGCATGTTCCTTTGGTTTACCCTTAGAGATGAGAAATCCTCCTCCTTTGAGGATGGATTTAAGTTCTGGAAATAATCTCAAGT
GCTTGATAGCACAGTTGGATGAAAAAAGATGGCAATTAAGGTAAGTTACACCATTTTTGTTTCTAAAAAAATCCCTAAGAAATTTCTTGG
AATGAGTCTTTGGCCTCAGAGCCTCTCAAAGTGTCCACTTCAAGGGGGGATCATCCTCATTAGCACACAGATTTTTAAAAATCAATTCTC
TTGCCATGCCTCCTATGTGTTCACATCTCTGCATACACTACAGATATAAGTGCATAATCATTCATATAAACATCTGGTAGGTATTCTGTA
AAACTGTGTTTACTTTAGTGCATGTTATTGTCATGTTATGATGTGACTGGGGTGTTTCTTTGTCATGAAACTTTGCTTCTTCACAGAATT
AGAATACTGCTCTCTCTATATTGAACTACATATACAGCGTTTTCTTGTATCAGCCCCCAAAGTCTGGATGCCCGGTGTTGTGTTTACATG
TGATTGTGCCTAGGAGTCTGTTCACATAGAGACACCTGTAAGTATTTATTACAAAACGGAATGTAAGCAAATATATCCACATTGGTTTTA
TTTGAATCAAGGTGTTTTTTTGTTTTTTGTTTTTTTTCCTTTTGAGGAGGAACAGGGAGCCTCCTCCTCCATGAGCACTTACAGAATTGT
GTAAAATTCTGTGAAACAGTGGTAAGCATGGGCACCCGATTTCAGCTGTCCTGCTGCCGCTGCCCTCCAACCTGCTCTGTGTGTGTGTGT
CGCTGTGCTTGGTGGCAGTGTGCCGTGCTCGTGCCGGCTCTTCCCAGCAGACTGGTATCTGGCTGTAACGTTTGACGTCTTCATATTGCC
AGTCTGTATTGAGGGGTGATGTACATGGCCATACAGCCAAATGGGTCTGTGTACCAGTGTGGGGATTCCAAGAACACTGCCTGTCCCCCA
CAGCAAATATTGATGCTGTTGGTCAGCCAAAGATTTTCCTCTCCTTTGCTGCTTAAACTTGTGCCTTAATATTGTACATAATAAATGGAT
AAAATGGCAAAATGACTCTTTTCTCTCGCTTGCTCCTTTCTTCCTTAAAGAACTTATAAACTGATGCTCAATAAATGTTTCATTTCATTG

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000317837_chr11_94554696_+_6958nt
CCCAGATCGAGGCTGCTCGGGTCCTTTCTCCCCCCGCCTCCCTCTAGCGCCGCGCCCCCTGGCCCCCAGCCCCAGCCTGCGGCGGGACCT
CCGGGGTCGAAGGTTCTGGCCCGCTCGCGCCCCTCGCCGCCCCCGCGCGCCCCCAGCGCTCCTCCAGCCGGCTCGGGCCGCTCGGCTATG
GATCGCCTGCTCGCCGGGCGCTGAAGGCATCCCCGGGATCCGGAGCGCAGCCCGGGAAAGAAATGCACAGCGGTATTGATGAGTAGATCC
TTGGATTCAGAGGTTGGCTGAAACGCACCATGCCTGCTTCCATCTTTTGCTCTGTAAAGTTGTGAATTGCTCATGCCTATAGGGAGGAAG
GATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAA
CATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCAT
GAACTTCAGGACCTCTCTTACCAGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGG
GAAGGAGCACCATGAGCATGCCTCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAG
CAGTGCCCACGCCAAGACAGGCAGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCC
CAGCCGCGGCCGGCTGAGCACGACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTC
TCCTGGCCATGGGAAGTCGCCTGACCACAGAGGCCGGGTCAGCAGCTTGCTGCACAAGCCCGAGTTCCCTGATGGAGAGATGATGGAAGT
CCTCATCTAACTGCCATCCCTGTGGAATTTCAGTACAGAACACTGACAAACAAGGAAAGCGGCAGAGAAAGAAGAAAGACCTAGAAGGTT
GTAGATGGGAAATCAGGAATGATTTGAACTGATAAAGATTTCAGACTCATAAGAACACATTTTATAAATGTTAAACACAAAAACTACATG
ACTGAAGATAGAAGAGAATGCGATGGATTTTATTACACATGGTGGAAGAGAGAAGAGGCGTGTAGGTTTGCAAACAAAGTTAAGAAATAG
GAAACTGAATTTTTCATTGTACAGAAAATGTATCTCTTGGGGAGGGCCTGTGTACCCCCATTCTCTGATTATAAACAGATAAACCCAAAT
GTGGATCATCCTTGGAATACCCCCATTCTCCTTGCCTCTTAGCATGTTTGATTTAAGAAAAGCCTCCAGGAAATCTTGAGAGCCTGTCTT
GGCATAATGCAGTGTCACCTGTGCCAACCATGGGGTGTCCCGTGAGTGTGAGTGTGGCAGTGAGAAGAAGCATCGAGGGCGAGGGGAATA
TGAAAGTTGGTCTTCACCTAATTACCTGTTTGGTTTGGATTTTCAAGAGATGATTGGGCTTCTTAGCTTTTCTGAATTCTGCAGTATTTT
CTAAACAGGATAGATTATGATCTCGGTCCCCATCCATCCTAACTTCTGAGTTCATCTCTGTCTCTGCTTTACAGTCTTTAATTTTTTGTT
GTTCCTTCATTTTTTTCTTTTTAATAAGACATAGCAGAATTCCTTAGGTATGGGATTTATGAGACCAGTACCTGAACTGTCATCATTCCT
ACTGTGTTTGATAGTGACCAGTAGGACAAAGCCACGTGCCGACTTCCTGGCTGCTTCACCTTTGCATAGCTGGGTTGCAGCTGCGAACCT
CATTCTGACTGTGAACTAAGCAAGCTTTGAGGAGGCAGGAGATTCCGTGGGTCCCTGTGACATATTGCATTAAGATCGTGGCACTTGCTT
TTTTGTCTTTCACATCGGCTGTCTTGCAAGGAGCTTGACATTTCCAAATTCCATTGCTCTGTTTGGGGAAGACTTAGGACAGCACTCCAG
GAAACAGATGACAATTTACAGACAGTTGTCTCAGTGGTTTCCAGAATCTCACCAGCCTCCCGTATAGCTTCTTGTATTGAGGCTCATGAG
CGTATTCACACTCTTTCCTCCCCCGCGCACGCCTCTGCTTGCTCTCGATCAGCATCCAGACCTCCGTGGCACCAGGTTGCCTCTGTTGTG
AACTTCTTTTGTAACCTACCAGGCCAGTTGTATATACAGTGTTGTCAGGTTTTTCCGGGTTTCAGTTTTGAGGCAGTTTATTCAAAGTGA
GACAGAAGTGCCACGGAAAAGAGGCAGGAGTGTGTTAGGTGGTGGGTCCATTAGACCTCTGCTGTGACATTGCATATTCAGCTCTGCAGA
CACTGGCTTCCTTTACAAATCTAAGAGATGCTGGATTAGAAAAGAGGAGAAGCTCATCGGGCCATCAGAGAGATGCTCCTACAGGGTCCT
GATGTTTTTGTACCTCCAGGTCAGCTGGATCGCTGTTTTCCCAGTTCCCTTTGCTCATGCTTACTTAGAGGAAGAAAGAAAGGGGGGTAC
CTCTTCCAAGTACCTTCTAAATGAAACACTCAAGAGAGTGCTACTCAGGAAACTTTGCTTGGATCCTAAAATGGACTGGTCTTGGGTGTG
TAACCCCGGTGAAGTTATAGCCTCCCCAAATTGAGGTGACAGAAGGAAGACAAGAGGTGTAAGCTGGAGAGGGAAGGGAAGAAATCAGTG
GCTTTGGCCAGCCTCTGTGCCACCCAGTACGACAGAGGAGTGGGAACTGGCCCTCTGGGGCTCTGCTTGGCCATAGGCACTGCACATTGT
GCCACCTGCTCATCACCTCCTCTAGTCTCACACTGAGCATCGGAGTACCTGTTGTGCAGACAGGAAAACTGAGGAGCTCTGAGAGGCTGA
GCATGGAGCTCACCCCATGCCATAGGGTGTGGGAAGAGGGCACAGGAGGCCTCATCCATGGGGGAAAGGGTTGAGGATGGACATGGGTGG
GGAGAGGGCATAGACATCCCTTCCTAATCTCTGTTCCCACCACATTTCATAGGAGATGAGTTAGGAGATGACAGCTAACTCTCTTAAGGA
CATTTTGACCCCAGTTTATGTTGGGGATGGACCAGAAAGGAAAATGTCTAGAGATAGGAAGGTAAATCAACTCTGCCAGCCCCTACCATC
AGGTCTGGGCCACCCCAAACTTGGGCTGCCTCCCTTAGACATAGGTTAGAGTGAGAGACCCAGCTGTTTCTCCCGAAGCCTCGTCTTCAT
GCCCCAGACACCTGATTGCCCCAATCAGGTGTCAGACTTGCTTGCTCTTCGAGGTCCCCCTGAGCTGCCAAGTGTTTTCATTGTAAACAG
ACACATCGCCATGTTTCAGGGCTTCAACGGCATTGTATTTTGGACTTTGACCGTATTTTTTTTCTCTTAACCTACTGAGACTCTTCCTTA
AGAACAGGATCTATAGCTTTAAAATGTCTTCTTCTATGGGAAATTTCCTGCCAAGCCAGGGCACTAAATTCTTTCATCATTAGAGCTTTC
CTGAAGTCCGGCCATATACTGAGTACCTGCTCTGAGTTCTGGGCAGCTTACAATATCTTAAACAGATTTTCAGAAAAATAATGCAACTAT
ATTTTCTAGTGTCAACTGTATGCAAACAGTGTGGTAAATACCTTTTAATTAGTCCTCCACCCACCTGGAGTACAGGGGGTGCGTTTATTA
TTCTGATTTCACTGATGAGGAAATGGGCTCAGAAAGGTTAAGTCCCTTCCTGAAATCTCACAGCCAGGAGAAGCTAGGATGATTTAAAAC
AAAGTTTGGAGAGGCACTGGGCATAGACCCTGGCTGTACAGCCTCTAACATGCGGCACTGCATCTTGGCAGTCTCTATGCCTGTCTGTGA
TGTGTGTGTGCACGTGTAACTACACACACACACACACACACACACACACACACACACAGCTATCACACATCTCAGAGCCTAAGAAATAGG
ACTAAGCCCAGAACTCCTAGAATCACCTATAAATGCTAGGCATAGATGGAAATTATTGTGTTCCACCAGAAGCACAGCTCCAAACTATAC
CTAAAAAATATTTCTGCACTTCCCAGAGACCTGGACTTCAAACTTTCCCAGTGGAGCCTGATTATAGAACTTGAGGGTCCTATCTCAGGA
TGAAGGGGAGAGGCCCTGGCTTCACGGGAAGGTATTCCAGCATTGTTCTGCTTCACCCTTGACTGCGTTGTCTGGCAGTTTCTGTGTGCT
GCCAGGATATTATATGGAACTGGAGAAGTTGGAGTCAGGTCTCTGAAGCTAGAGTTTCACTAATTAGATGCCTCTGTACATGAGAACTAT
TACTGTCTGCAGGTCCATATAGCTAAGCTGCCAGGAAAAACACATTATCTTCCAAAACTTTCAGAGCATGTGCAGAACCCTTTCTTAGCG
TTTTCTTCTCAGCATTTTCTCTGCCTCCCAGAGGCTGGCAGCCAGTGACACTGCAGAGTTCAGCATGTTCTAACCATGCACGCAGGGCAG
GGGCTGCCTTGGCCCTCCTCAGGCTTTCGTTGGGAGAGCAGGCAGTGGTGGAGCCCTTCTGGGTGCAGTCCTCTGGGGTTGCTCTTTGGA
ACTCATGTATGAGTTTGACTCCACAAGGCTTGGCATGGATACCAAAACAGTTGCAACAAATTAGTTCTGAACCTGGAACAGAGAATTCAG
TGCTTCTGTTACTCAGGAAGGAGGTGTTCAGAATGCCCCGTGCAGAGCAGCCAGTCATTACTCTTGTTTGTTCTCACCTGGGTGCGCACC
CTCATGATGCAGTGGCTGTAGCACCTTCATGCCAGGTGCTGAGAGAATGGGAAATTCTTCCTCCCCATTGACCTGAGTCCCAGAGACTTA
GGGACACAGACTTCAGGTGAGGCTGCGGACCTCAGAAGCAGTGGATAATAGATTGGGGCATTAAAAGCTTTTGAGGCAGGGGGCTCATGT
TTTGACTGCAGGGAGTTATGCTGAGCAAAGAGATGTGTTTTTCAAAACCAGGGTTCAAAACCAGTGTCCACGCTGGAGTAAGTGGAGCAT
GCTTCTCTGTGTTCTCTGAATGATCTTGCACTCCTCTTAAGCAAAGGAGTACCATGACCATAGTCAGTGGGATCCCACAAATGTTCTTAA
ATGGGTAAGGCTTTAAGTAGCCAGAGAGTATCCAGCCTACCATTGGCTTCTCCACATCCTAAAACCTGAGACAGCCTTGGTATATGCTTT
ATAAATGTTTCTTTTCTTGTTGTTTAAGTAATTAAAGTGTTTAAAATGTCTTCATTAGATGTGACGATTGTTTAATGAGTTTGCCTCTGA
CGTGTGGCTCCATGGGAGATAGGCAAAGTAATTAAGAAGTTACCAGAAATTGGTCGGCTGGGGAAATGCAAAAGTTAGCATTTCAGTAGT
GAATTTCTCCTGGAACAAATGAGCAATTTTTCCTCTTTCTCTTAAGTAGTATACCCTTTTCTCACTTAGTAATTTAATGGTATATAAAGA
CATGTGTATAAGTGAGTGCATACATATGAGGTATGACTATAGGGTTGTTTGTGGGAATTTCTTTTCCTAACATACAGAAGATCAAAGTGT
TCATCTCACCCCGCCCTCCTTAAAAGGTGTCTTTTGGGAGACTATGTGCTCATTGACTATAGTGCTGCCAAGTAAAAATATCTTGGGAAC
TCTTCTACTAGAATGGCCTTCAGGGCTTGGCATGTTCCTTTGGTTTACCCTTAGAGATGAGAAATCCTCCTCCTTTGAGGATGGATTTAA
GTTCTGGAAATAATCTCAAGTGCTTGATAGCACAGTTGGATGAAAAAAGATGGCAATTAAGGTAAGTTACACCATTTTTGTTTCTAAAAA
AATCCCTAAGAAATTTCTTGGAATGAGTCTTTGGCCTCAGAGCCTCTCAAAGTGTCCACTTCAAGGGGGGATCATCCTCATTAGCACACA
GATTTTTAAAAATCAATTCTCTTGCCATGCCTCCTATGTGTTCACATCTCTGCATACACTACAGATATAAGTGCATAATCATTCATATAA
ACATCTGGTAGGTATTCTGTAAAACTGTGTTTACTTTAGTGCATGTTATTGTCATGTTATGATGTGACTGGGGTGTTTCTTTGTCATGAA
ACTTTGCTTCTTCACAGAATTAGAATACTGCTCTCTCTATATTGAACTACATATACAGCGTTTTCTTGTATCAGCCCCCAAAGTCTGGAT
GCCCGGTGTTGTGTTTACATGTGATTGTGCCTAGGAGTCTGTTCACATAGAGACACCTGTAAGTATTTATTACAAAACGGAATGTAAGCA
AATATATCCACATTGGTTTTATTTGAATCAAGGTGTTTTTTTGTTTTTTGTTTTTTTTCCTTTTGAGGAGGAACAGGGAGCCTCCTCCTC
CATGAGCACTTACAGAATTGTGTAAAATTCTGTGAAACAGTGGTAAGCATGGGCACCCGATTTCAGCTGTCCTGCTGCCGCTGCCCTCCA
ACCTGCTCTGTGTGTGTGTGTCGCTGTGCTTGGTGGCAGTGTGCCGTGCTCGTGCCGGCTCTTCCCAGCAGACTGGTATCTGGCTGTAAC
GTTTGACGTCTTCATATTGCCAGTCTGTATTGAGGGGTGATGTACATGGCCATACAGCCAAATGGGTCTGTGTACCAGTGTGGGGATTCC
AAGAACACTGCCTGTCCCCCACAGCAAATATTGATGCTGTTGGTCAGCCAAAGATTTTCCTCTCCTTTGCTGCTTAAACTTGTGCCTTAA
TATTGTACATAATAAATGGATAAAATGGCAAAATGACTCTTTTCTCTCGCTTGCTCCTTTCTTCCTTAAAGAACTTATAAACTGATGCTC

>In-frame_MPPED2_ENST00000448418_chr11_30601793_-_AMOTL1_ENST00000433060_chr11_94554696_+_8197nt
CCCAGATCGAGGCTGCTCGGGTCCTTTCTCCCCCCGCCTCCCTCTAGCGCCGCGCCCCCTGGCCCCCAGCCCCAGCCTGCGGCGGGACCT
CCGGGGTCGAAGGTTCTGGCCCGCTCGCGCCCCTCGCCGCCCCCGCGCGCCCCCAGCGCTCCTCCAGCCGGCTCGGGCCGCTCGGCTATG
GATCGCCTGCTCGCCGGGCGCTGAAGGCATCCCCGGGATCCGGAGCGCAGCCCGGGAAAGAAATGCACAGCGGTATTGATGAGTAGATCC
TTGGATTCAGAGGTTGGCTGAAACGCACCATGCCTGCTTCCATCTTTTGCTCTGTAAAGTTGTGAATTGCTCATGCCTATAGGGAGGAAG
GATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTACAGCTCAAACCCCACCCAGGCATTCACGCACTACAA
CATCAACCAGAGCAGATTCCAGCCTCCACATGTACATATCCGCCCATGCCAACTTCCGTTCCCATCAACCATGCAGCAGCACAGCCCCAT
GTCCTCCCAGACCTCTTCCGCCAGCGGGCCACTGCACTCTGTCTCCCTGCCGCTTCCACTCCCGATGGCCCTGGGTGCTCCACAGCCCCC
GCCTGCCGCCTCCCCCAGCCAGCAGCTTGGTCCAGATGCCTTTGCGATTGTGGAGCGAGCCCAGCAAATGGTGGAGATATTAACAGAGGA
GAACCGGGTGCTTCACCAGGAACTTCAGGGTTACTACGACAATGCCGACAAGCTCCACAAGTTTGAAAAAGAACTTCAGAGAATTTCGGA
AGCCTATGAAAGTCTGGTCAAGTCTACCACCAAGCGAGAATCGCTGGACAAGGCCATGAGAAACAAATTGGAAGGCGAGATTAGAAGACT
TCATGATTTCAACAGAGACCTCCGAGATCGACTAGAGACTGCTAACAGGCAACTATCCAGCAGGGAATACGAAGGGCATGAAGACAAAGC
TGCAGAGGGGCATTATGCTTCCCAGAACAAAGAATTCTTGAAGGAAAAGGAGAAATTAGAAATGGAGTTAGCAGCAGTGCGGACTGCAAG
TGAGGACCATCGGAGACACATCGAGATCCTGGACCAGGCTTTGAGCAACGCCCAGGCCAGGGTCATCAAGCTGGAAGAGGAGTTACGAGA
GAAGCAAGCATATGTTGAGAAAGTTGAGAAGCTGCAGCAGGCCCTGACCCAGCTGCAGTCTGCATGTGAGAAGCGAGAACAGATGGAGCG
GAGACTGCGGACTTGGCTGGAGAGAGAGCTGGATGCACTGAGAACCCAGCAGAAACATGGAAATGGCCAGCCAGCCAACATGCCGGAATA
CAATGCCCCAGCCCTCCTGGAACTTGTGCGGGAGAAGGAGGAGCGGATCCTGGCCCTGGAGGCCGACATGACAAAGTGGGAGCAGAAGTA
CCTGGAGGAGAGCACCATCCGACACTTTGCCATGAATGCCGCAGCCACTGCAGCAGCTGAGAGGGACACCACGATCATCAACCACTCACG
GAATGGCAGCTACGGAGAGAGCTCGCTGGAGGCCCACATCTGGCAAGAGGAGGAGGAGGTGGTGCAGGCCAACAGAAGGTGTCAGGACAT
GGAATACACTATTAAAAATCTCCATGCCAAAATCATAGAGAAAGATGCTATGATTAAGGTCCTGCAGCAGCGATCTCGTAAAGATGCCGG
GAAGACAGACTCCTCCAGCCTACGTCCTGCCCGCTCCGTTCCATCCATAGCAGCAGCTACTGGGACACACTCTCGCCAGACCTCTCTTAC
CAGCAGCCAGCTGGCTGAGGAAAAGAAGGAAGAGAAGACCTGGAAGGGGAGCATAGGATTGCTGCTGGGGAAGGAGCACCATGAGCATGC
CTCTGCCCCACTGCTGCCACCCCCACCCACCTCAGCACTGTCCTCCATAGCCTCCACTACGGCAGCCAGCAGTGCCCACGCCAAGACAGG
CAGCAAGGACAGCAGCACACAGACTGACAAGAGTGCCGAGCTCTTCTGGCCCAGCATGGCCTCCCTTCCCAGCCGCGGCCGGCTGAGCAC
GACCCCTGCTCACAGCCCCGTCCTGAAACACCCAGCGGCCAAAGGGACCGCAGAGAAACTGGAGAACTCTCCTGGCCATGGGAAGTCGCC
TGACCACAGAGGCCGGGTCAGCAGCTTGCTGCACAAGCCCGAGTTCCCTGATGGAGAGATGATGGAAGTCCTCATCTAACTGCCATCCCT
GTGGAATTTCAGTACAGAACACTGACAAACAAGGAAAGCGGCAGAGAAAGAAGAAAGACCTAGAAGGTTGTAGATGGGAAATCAGGAATG
ATTTGAACTGATAAAGATTTCAGACTCATAAGAACACATTTTATAAATGTTAAACACAAAAACTACATGACTGAAGATAGAAGAGAATGC
GATGGATTTTATTACACATGGTGGAAGAGAGAAGAGGCGTGTAGGTTTGCAAACAAAGTTAAGAAATAGGAAACTGAATTTTTCATTGTA
CAGAAAATGTATCTCTTGGGGAGGGCCTGTGTACCCCCATTCTCTGATTATAAACAGATAAACCCAAATGTGGATCATCCTTGGAATACC
CCCATTCTCCTTGCCTCTTAGCATGTTTGATTTAAGAAAAGCCTCCAGGAAATCTTGAGAGCCTGTCTTGGCATAATGCAGTGTCACCTG
TGCCAACCATGGGGTGTCCCGTGAGTGTGAGTGTGGCAGTGAGAAGAAGCATCGAGGGCGAGGGGAATATGAAAGTTGGTCTTCACCTAA
TTACCTGTTTGGTTTGGATTTTCAAGAGATGATTGGGCTTCTTAGCTTTTCTGAATTCTGCAGTATTTTCTAAACAGGATAGATTATGAT
CTCGGTCCCCATCCATCCTAACTTCTGAGTTCATCTCTGTCTCTGCTTTACAGTCTTTAATTTTTTGTTGTTCCTTCATTTTTTTCTTTT
TAATAAGACATAGCAGAATTCCTTAGGTATGGGATTTATGAGACCAGTACCTGAACTGTCATCATTCCTACTGTGTTTGATAGTGACCAG
TAGGACAAAGCCACGTGCCGACTTCCTGGCTGCTTCACCTTTGCATAGCTGGGTTGCAGCTGCGAACCTCATTCTGACTGTGAACTAAGC
AAGCTTTGAGGAGGCAGGAGATTCCGTGGGTCCCTGTGACATATTGCATTAAGATCGTGGCACTTGCTTTTTTGTCTTTCACATCGGCTG
TCTTGCAAGGAGCTTGACATTTCCAAATTCCATTGCTCTGTTTGGGGAAGACTTAGGACAGCACTCCAGGAAACAGATGACAATTTACAG
ACAGTTGTCTCAGTGGTTTCCAGAATCTCACCAGCCTCCCGTATAGCTTCTTGTATTGAGGCTCATGAGCGTATTCACACTCTTTCCTCC
CCCGCGCACGCCTCTGCTTGCTCTCGATCAGCATCCAGACCTCCGTGGCACCAGGTTGCCTCTGTTGTGAACTTCTTTTGTAACCTACCA
GGCCAGTTGTATATACAGTGTTGTCAGGTTTTTCCGGGTTTCAGTTTTGAGGCAGTTTATTCAAAGTGAGACAGAAGTGCCACGGAAAAG
AGGCAGGAGTGTGTTAGGTGGTGGGTCCATTAGACCTCTGCTGTGACATTGCATATTCAGCTCTGCAGACACTGGCTTCCTTTACAAATC
TAAGAGATGCTGGATTAGAAAAGAGGAGAAGCTCATCGGGCCATCAGAGAGATGCTCCTACAGGGTCCTGATGTTTTTGTACCTCCAGGT
CAGCTGGATCGCTGTTTTCCCAGTTCCCTTTGCTCATGCTTACTTAGAGGAAGAAAGAAAGGGGGGTACCTCTTCCAAGTACCTTCTAAA
TGAAACACTCAAGAGAGTGCTACTCAGGAAACTTTGCTTGGATCCTAAAATGGACTGGTCTTGGGTGTGTAACCCCGGTGAAGTTATAGC
CTCCCCAAATTGAGGTGACAGAAGGAAGACAAGAGGTGTAAGCTGGAGAGGGAAGGGAAGAAATCAGTGGCTTTGGCCAGCCTCTGTGCC
ACCCAGTACGACAGAGGAGTGGGAACTGGCCCTCTGGGGCTCTGCTTGGCCATAGGCACTGCACATTGTGCCACCTGCTCATCACCTCCT
CTAGTCTCACACTGAGCATCGGAGTACCTGTTGTGCAGACAGGAAAACTGAGGAGCTCTGAGAGGCTGAGCATGGAGCTCACCCCATGCC
ATAGGGTGTGGGAAGAGGGCACAGGAGGCCTCATCCATGGGGGAAAGGGTTGAGGATGGACATGGGTGGGGAGAGGGCATAGACATCCCT
TCCTAATCTCTGTTCCCACCACATTTCATAGGAGATGAGTTAGGAGATGACAGCTAACTCTCTTAAGGACATTTTGACCCCAGTTTATGT
TGGGGATGGACCAGAAAGGAAAATGTCTAGAGATAGGAAGGTAAATCAACTCTGCCAGCCCCTACCATCAGGTCTGGGCCACCCCAAACT
TGGGCTGCCTCCCTTAGACATAGGTTAGAGTGAGAGACCCAGCTGTTTCTCCCGAAGCCTCGTCTTCATGCCCCAGACACCTGATTGCCC
CAATCAGGTGTCAGACTTGCTTGCTCTTCGAGGTCCCCCTGAGCTGCCAAGTGTTTTCATTGTAAACAGACACATCGCCATGTTTCAGGG
CTTCAACGGCATTGTATTTTGGACTTTGACCGTATTTTTTTTCTCTTAACCTACTGAGACTCTTCCTTAAGAACAGGATCTATAGCTTTA
AAATGTCTTCTTCTATGGGAAATTTCCTGCCAAGCCAGGGCACTAAATTCTTTCATCATTAGAGCTTTCCTGAAGTCCGGCCATATACTG
AGTACCTGCTCTGAGTTCTGGGCAGCTTACAATATCTTAAACAGATTTTCAGAAAAATAATGCAACTATATTTTCTAGTGTCAACTGTAT
GCAAACAGTGTGGTAAATACCTTTTAATTAGTCCTCCACCCACCTGGAGTACAGGGGGTGCGTTTATTATTCTGATTTCACTGATGAGGA
AATGGGCTCAGAAAGGTTAAGTCCCTTCCTGAAATCTCACAGCCAGGAGAAGCTAGGATGATTTAAAACAAAGTTTGGAGAGGCACTGGG
CATAGACCCTGGCTGTACAGCCTCTAACATGCGGCACTGCATCTTGGCAGTCTCTATGCCTGTCTGTGATGTGTGTGTGCACGTGTAACT
ACACACACACACACACACACACACACACACACACACAGCTATCACACATCTCAGAGCCTAAGAAATAGGACTAAGCCCAGAACTCCTAGA
ATCACCTATAAATGCTAGGCATAGATGGAAATTATTGTGTTCCACCAGAAGCACAGCTCCAAACTATACCTAAAAAATATTTCTGCACTT
CCCAGAGACCTGGACTTCAAACTTTCCCAGTGGAGCCTGATTATAGAACTTGAGGGTCCTATCTCAGGATGAAGGGGAGAGGCCCTGGCT
TCACGGGAAGGTATTCCAGCATTGTTCTGCTTCACCCTTGACTGCGTTGTCTGGCAGTTTCTGTGTGCTGCCAGGATATTATATGGAACT
GGAGAAGTTGGAGTCAGGTCTCTGAAGCTAGAGTTTCACTAATTAGATGCCTCTGTACATGAGAACTATTACTGTCTGCAGGTCCATATA
GCTAAGCTGCCAGGAAAAACACATTATCTTCCAAAACTTTCAGAGCATGTGCAGAACCCTTTCTTAGCGTTTTCTTCTCAGCATTTTCTC
TGCCTCCCAGAGGCTGGCAGCCAGTGACACTGCAGAGTTCAGCATGTTCTAACCATGCACGCAGGGCAGGGGCTGCCTTGGCCCTCCTCA
GGCTTTCGTTGGGAGAGCAGGCAGTGGTGGAGCCCTTCTGGGTGCAGTCCTCTGGGGTTGCTCTTTGGAACTCATGTATGAGTTTGACTC
CACAAGGCTTGGCATGGATACCAAAACAGTTGCAACAAATTAGTTCTGAACCTGGAACAGAGAATTCAGTGCTTCTGTTACTCAGGAAGG
AGGTGTTCAGAATGCCCCGTGCAGAGCAGCCAGTCATTACTCTTGTTTGTTCTCACCTGGGTGCGCACCCTCATGATGCAGTGGCTGTAG
CACCTTCATGCCAGGTGCTGAGAGAATGGGAAATTCTTCCTCCCCATTGACCTGAGTCCCAGAGACTTAGGGACACAGACTTCAGGTGAG
GCTGCGGACCTCAGAAGCAGTGGATAATAGATTGGGGCATTAAAAGCTTTTGAGGCAGGGGGCTCATGTTTTGACTGCAGGGAGTTATGC
TGAGCAAAGAGATGTGTTTTTCAAAACCAGGGTTCAAAACCAGTGTCCACGCTGGAGTAAGTGGAGCATGCTTCTCTGTGTTCTCTGAAT
GATCTTGCACTCCTCTTAAGCAAAGGAGTACCATGACCATAGTCAGTGGGATCCCACAAATGTTCTTAAATGGGTAAGGCTTTAAGTAGC
CAGAGAGTATCCAGCCTACCATTGGCTTCTCCACATCCTAAAACCTGAGACAGCCTTGGTATATGCTTTATAAATGTTTCTTTTCTTGTT
GTTTAAGTAATTAAAGTGTTTAAAATGTCTTCATTAGATGTGACGATTGTTTAATGAGTTTGCCTCTGACGTGTGGCTCCATGGGAGATA
GGCAAAGTAATTAAGAAGTTACCAGAAATTGGTCGGCTGGGGAAATGCAAAAGTTAGCATTTCAGTAGTGAATTTCTCCTGGAACAAATG
AGCAATTTTTCCTCTTTCTCTTAAGTAGTATACCCTTTTCTCACTTAGTAATTTAATGGTATATAAAGACATGTGTATAAGTGAGTGCAT
ACATATGAGGTATGACTATAGGGTTGTTTGTGGGAATTTCTTTTCCTAACATACAGAAGATCAAAGTGTTCATCTCACCCCGCCCTCCTT
AAAAGGTGTCTTTTGGGAGACTATGTGCTCATTGACTATAGTGCTGCCAAGTAAAAATATCTTGGGAACTCTTCTACTAGAATGGCCTTC
AGGGCTTGGCATGTTCCTTTGGTTTACCCTTAGAGATGAGAAATCCTCCTCCTTTGAGGATGGATTTAAGTTCTGGAAATAATCTCAAGT
GCTTGATAGCACAGTTGGATGAAAAAAGATGGCAATTAAGGTAAGTTACACCATTTTTGTTTCTAAAAAAATCCCTAAGAAATTTCTTGG
AATGAGTCTTTGGCCTCAGAGCCTCTCAAAGTGTCCACTTCAAGGGGGGATCATCCTCATTAGCACACAGATTTTTAAAAATCAATTCTC
TTGCCATGCCTCCTATGTGTTCACATCTCTGCATACACTACAGATATAAGTGCATAATCATTCATATAAACATCTGGTAGGTATTCTGTA
AAACTGTGTTTACTTTAGTGCATGTTATTGTCATGTTATGATGTGACTGGGGTGTTTCTTTGTCATGAAACTTTGCTTCTTCACAGAATT
AGAATACTGCTCTCTCTATATTGAACTACATATACAGCGTTTTCTTGTATCAGCCCCCAAAGTCTGGATGCCCGGTGTTGTGTTTACATG
TGATTGTGCCTAGGAGTCTGTTCACATAGAGACACCTGTAAGTATTTATTACAAAACGGAATGTAAGCAAATATATCCACATTGGTTTTA
TTTGAATCAAGGTGTTTTTTTGTTTTTTGTTTTTTTTCCTTTTGAGGAGGAACAGGGAGCCTCCTCCTCCATGAGCACTTACAGAATTGT
GTAAAATTCTGTGAAACAGTGGTAAGCATGGGCACCCGATTTCAGCTGTCCTGCTGCCGCTGCCCTCCAACCTGCTCTGTGTGTGTGTGT
CGCTGTGCTTGGTGGCAGTGTGCCGTGCTCGTGCCGGCTCTTCCCAGCAGACTGGTATCTGGCTGTAACGTTTGACGTCTTCATATTGCC
AGTCTGTATTGAGGGGTGATGTACATGGCCATACAGCCAAATGGGTCTGTGTACCAGTGTGGGGATTCCAAGAACACTGCCTGTCCCCCA
CAGCAAATATTGATGCTGTTGGTCAGCCAAAGATTTTCCTCTCCTTTGCTGCTTAAACTTGTGCCTTAATATTGTACATAATAAATGGAT
AAAATGGCAAAATGACTCTTTTCTCTCGCTTGCTCCTTTCTTCCTTAAAGAACTTATAAACTGATGCTCAATAAATGTTTCATTTCATTG


Top

FusionGenePPI for MPPED2_AMOTL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MPPED2TRIP13, RXRG, VAC14, CAGE1, FAM72A, NOTCH3, NR2F6, MPPED1, IKZF1, SULT1A3AMOTL1AMOT, NEDD4L, LATS1, LATS2, YAP1, HECW2, NEDD4, WWOX, SHMT2, MOV10, NXF1, SUZ12, FHL3, MAGEA4, WWP2, TEAD4, RAB3IL1, WWTR1, RNF166, NF2, MPP5, CAPZA2, COG6, ALOX5, IFFO1, COBLL1, CDADC1, SCML1, HMBOX1, DDHD1, TLK2, UHRF1BP1L, WWC1, USP9X


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MPPED2_AMOTL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MPPED2_AMOTL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource