FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22356

FusionGeneSummary for MPHOSPH9_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: MPHOSPH9_PTPRR
Fusion gene ID: 22356
HgeneTgene
Gene symbol

MPHOSPH9

PTPRR

Gene ID

10198

5801

Gene nameM-phase phosphoprotein 9protein tyrosine phosphatase, receptor type R
SynonymsMPP-9|MPP9EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

12q24.31

12q15

Type of geneprotein-codingprotein-coding
DescriptionM-phase phosphoprotein 9receptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018051920180519
UniProtAcc

Q99550

Q15256

Ensembl transtripts involved in fusion geneENST00000302349, ENST00000541076, 
ENST00000606320, ENST00000392425, 
ENST00000539639, 
ENST00000283228, 
ENST00000440835, ENST00000537619, 
ENST00000378778, ENST00000342084, 
ENST00000549308, 
Fusion gene scores* DoF score7 X 6 X 7=29433 X 13 X 10=4290
# samples 731
** MAII scorelog2(7/294*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MPHOSPH9 [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-A922-01AMPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000302349ENST00000283228MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
Frame-shitENST00000302349ENST00000440835MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000302349ENST00000537619MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000302349ENST00000378778MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000302349ENST00000342084MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000302349ENST00000549308MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
In-frameENST00000541076ENST00000283228MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
In-frameENST00000541076ENST00000440835MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000541076ENST00000537619MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000541076ENST00000378778MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000541076ENST00000342084MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000541076ENST00000549308MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
Frame-shitENST00000606320ENST00000283228MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
Frame-shitENST00000606320ENST00000440835MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000606320ENST00000537619MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000606320ENST00000378778MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000606320ENST00000342084MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000606320ENST00000549308MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
Frame-shitENST00000392425ENST00000283228MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
Frame-shitENST00000392425ENST00000440835MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000392425ENST00000537619MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000392425ENST00000378778MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000392425ENST00000342084MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
5CDS-intronENST00000392425ENST00000549308MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-3CDSENST00000539639ENST00000283228MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-3CDSENST00000539639ENST00000440835MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-intronENST00000539639ENST00000537619MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-intronENST00000539639ENST00000378778MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-intronENST00000539639ENST00000342084MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-
intron-intronENST00000539639ENST00000549308MPHOSPH9chr12

123705919

-PTPRRchr12

71095103

-

Top

FusionProtFeatures for MPHOSPH9_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MPHOSPH9

Q99550

PTPRR

Q15256

Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MPHOSPH9_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000283228_chr12_71095103_-_583aa
MEEFDLVKTLHKTSSSVGSDENSLHSLGLNLNTDRSSPHLSTNGVSSFSGKTRPSVIQGTVEVLTSLMQELQNSGKTDSELWKNCEHIQE
EIKNLVKLQTSSASLASCEGNSSNKQVSSESQMGFFSLSSERNESVIHTPESTEPEIQQEMSTSQPDCNVDSCSVSSGTGTFCISELNLY
KSKDPKEFMEHIDVPKGQTVAPAVPAESLVDGVKNENFTIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNRRGSNVSLTL
DMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLR
PKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNEC
DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVD

>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000440835_chr12_71095103_-_583aa
MEEFDLVKTLHKTSSSVGSDENSLHSLGLNLNTDRSSPHLSTNGVSSFSGKTRPSVIQGTVEVLTSLMQELQNSGKTDSELWKNCEHIQE
EIKNLVKLQTSSASLASCEGNSSNKQVSSESQMGFFSLSSERNESVIHTPESTEPEIQQEMSTSQPDCNVDSCSVSSGTGTFCISELNLY
KSKDPKEFMEHIDVPKGQTVAPAVPAESLVDGVKNENFTIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNRRGSNVSLTL
DMSSLGNIEPFVSIPTPREKVAMETLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRTKTILPNPLSRVCLR
PKNVTDSLSTYINANTIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGITGKVEVLVISVNEC
DNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000283228_chr12_71095103_-_1749nt
ATGGAAGAGTTTGACTTGGTGAAAACCTTACACAAAACTTCATCTTCTGTAGGATCTGATGAAAATTCTCTTCATTCTCTTGGACTGAAC
TTAAATACTGATAGAAGTAGTCCCCACCTTAGTACAAATGGGGTATCCTCTTTCTCAGGGAAGACCAGACCATCTGTAATTCAAGGTACA
GTTGAAGTCCTAACTTCTTTAATGCAAGAGCTACAAAACAGTGGAAAGACTGATTCGGAACTTTGGAAAAACTGTGAGCATATACAGGAG
GAGATAAAAAATTTAGTCAAATTACAGACTAGTAGTGCTTCCTTAGCTTCCTGTGAAGGAAATTCTTCAAACAAACAAGTATCTTCGGAA
AGTCAAATGGGTTTTTTTTCTCTAAGCAGTGAGAGAAATGAATCTGTTATCCATTATCCTGAATCCACAGAACCTGAAATACAGCAAGAA
ATGTCCACGTCACAACCAGACTGCAATGTGGATAGTTGCTCAGTAAGCAGTGGATATGGCACCTTTTGTATCTCAGAATTAAATCTGTAC
AAATCTAAAGACCCTAAGGAGTTCATGGAGCACATAGATGTTCCCAAAGGACAGTATGTAGCACCTGCGGTGCCGGCTGAGTCACTTGTA
GATGGTGTGAAAAATGAGAATTTTTATATACAGACTCCTGAAGAGTGTCATGTGTCTTTAAAGGAAGATGTATCCATTTCTCCTGGTGAA
TTTGAACATAATTTTCTTGGTGAAAATAAGGTTTCTGAAGTATACAGTGGGAAAACAAATAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGA
CCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACG
CAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAA
GAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGT
GATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCAC
AAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTT
GTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGAT
GCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGC

>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000440835_chr12_71095103_-_1749nt
ATGGAAGAGTTTGACTTGGTGAAAACCTTACACAAAACTTCATCTTCTGTAGGATCTGATGAAAATTCTCTTCATTCTCTTGGACTGAAC
TTAAATACTGATAGAAGTAGTCCCCACCTTAGTACAAATGGGGTATCCTCTTTCTCAGGGAAGACCAGACCATCTGTAATTCAAGGTACA
GTTGAAGTCCTAACTTCTTTAATGCAAGAGCTACAAAACAGTGGAAAGACTGATTCGGAACTTTGGAAAAACTGTGAGCATATACAGGAG
GAGATAAAAAATTTAGTCAAATTACAGACTAGTAGTGCTTCCTTAGCTTCCTGTGAAGGAAATTCTTCAAACAAACAAGTATCTTCGGAA
AGTCAAATGGGTTTTTTTTCTCTAAGCAGTGAGAGAAATGAATCTGTTATCCATTATCCTGAATCCACAGAACCTGAAATACAGCAAGAA
ATGTCCACGTCACAACCAGACTGCAATGTGGATAGTTGCTCAGTAAGCAGTGGATATGGCACCTTTTGTATCTCAGAATTAAATCTGTAC
AAATCTAAAGACCCTAAGGAGTTCATGGAGCACATAGATGTTCCCAAAGGACAGTATGTAGCACCTGCGGTGCCGGCTGAGTCACTTGTA
GATGGTGTGAAAAATGAGAATTTTTATATACAGACTCCTGAAGAGTGTCATGTGTCTTTAAAGGAAGATGTATCCATTTCTCCTGGTGAA
TTTGAACATAATTTTCTTGGTGAAAATAAGGTTTCTGAAGTATACAGTGGGAAAACAAATAGAAGAGGGTCCAACGTATCTCTTACATTG
GACATGAGTAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGC
CGAATTCTCACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTG
GATCCCAAAGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGA
CCAAAAAATGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACG
CAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAA
GAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGT
GATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCAC
AAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTT
GTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGAT
GCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000283228_chr12_71095103_-_2933nt
GAAGATGACACGGATTCATTTTTCTCAAACAGCCCAAGAACCTTTATTTTCCAATAAGAGAATATAACAATTTCTGTACACTATGGAAGA
GTTTGACTTGGTGAAAACCTTACACAAAACTTCATCTTCTGTAGGATCTGATGAAAATTCTCTTCATTCTCTTGGACTGAACTTAAATAC
TGATAGAAGTAGTCCCCACCTTAGTACAAATGGGGTATCCTCTTTCTCAGGGAAGACCAGACCATCTGTAATTCAAGGTACAGTTGAAGT
CCTAACTTCTTTAATGCAAGAGCTACAAAACAGTGGAAAGACTGATTCGGAACTTTGGAAAAACTGTGAGCATATACAGGAGGAGATAAA
AAATTTAGTCAAATTACAGACTAGTAGTGCTTCCTTAGCTTCCTGTGAAGGAAATTCTTCAAACAAACAAGTATCTTCGGAAAGTCAAAT
GGGTTTTTTTTCTCTAAGCAGTGAGAGAAATGAATCTGTTATCCATTATCCTGAATCCACAGAACCTGAAATACAGCAAGAAATGTCCAC
GTCACAACCAGACTGCAATGTGGATAGTTGCTCAGTAAGCAGTGGATATGGCACCTTTTGTATCTCAGAATTAAATCTGTACAAATCTAA
AGACCCTAAGGAGTTCATGGAGCACATAGATGTTCCCAAAGGACAGTATGTAGCACCTGCGGTGCCGGCTGAGTCACTTGTAGATGGTGT
GAAAAATGAGAATTTTTATATACAGACTCCTGAAGAGTGTCATGTGTCTTTAAAGGAAGATGTATCCATTTCTCCTGGTGAATTTGAACA
TAATTTTCTTGGTGAAAATAAGGTTTCTGAAGTATACAGTGGGAAAACAAATAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAG
TAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCT
CACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAA
AGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAA
TGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCC
CATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAA
TGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTA
CACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCC
AGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTG
CAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAG
CATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGA
GAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCC
AAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATA
TTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATA
GGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAA
ATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATG
GACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGAT
AATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATT
ACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATT
ATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATT
TGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTC
TCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTA
CATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATT

>In-frame_MPHOSPH9_ENST00000541076_chr12_123705919_-_PTPRR_ENST00000440835_chr12_71095103_-_2942nt
GAAGATGACACGGATTCATTTTTCTCAAACAGCCCAAGAACCTTTATTTTCCAATAAGAGAATATAACAATTTCTGTACACTATGGAAGA
GTTTGACTTGGTGAAAACCTTACACAAAACTTCATCTTCTGTAGGATCTGATGAAAATTCTCTTCATTCTCTTGGACTGAACTTAAATAC
TGATAGAAGTAGTCCCCACCTTAGTACAAATGGGGTATCCTCTTTCTCAGGGAAGACCAGACCATCTGTAATTCAAGGTACAGTTGAAGT
CCTAACTTCTTTAATGCAAGAGCTACAAAACAGTGGAAAGACTGATTCGGAACTTTGGAAAAACTGTGAGCATATACAGGAGGAGATAAA
AAATTTAGTCAAATTACAGACTAGTAGTGCTTCCTTAGCTTCCTGTGAAGGAAATTCTTCAAACAAACAAGTATCTTCGGAAAGTCAAAT
GGGTTTTTTTTCTCTAAGCAGTGAGAGAAATGAATCTGTTATCCATTATCCTGAATCCACAGAACCTGAAATACAGCAAGAAATGTCCAC
GTCACAACCAGACTGCAATGTGGATAGTTGCTCAGTAAGCAGTGGATATGGCACCTTTTGTATCTCAGAATTAAATCTGTACAAATCTAA
AGACCCTAAGGAGTTCATGGAGCACATAGATGTTCCCAAAGGACAGTATGTAGCACCTGCGGTGCCGGCTGAGTCACTTGTAGATGGTGT
GAAAAATGAGAATTTTTATATACAGACTCCTGAAGAGTGTCATGTGTCTTTAAAGGAAGATGTATCCATTTCTCCTGGTGAATTTGAACA
TAATTTTCTTGGTGAAAATAAGGTTTCTGAAGTATACAGTGGGAAAACAAATAGAAGAGGGTCCAACGTATCTCTTACATTGGACATGAG
TAGCTTGGGGAACATTGAACCCTTTGTGTCTATACCAACACCACGGGAGAAGGTAGCAATGGAGTATCTGCAGTCAGCCAGCCGAATTCT
CACAAGGTCTCAGCTGAGGGACGTCGTGGCAAGTTCACATTTACTCCAAAGTGAATTCATGGAAATACCAATGAACTTTGTGGATCCCAA
AGAAATTGATATTCCGCGTCATGGAACTAAAAATCGCTATAAGACCATTTTACCAAATCCCCTCAGCAGAGTGTGTTTAAGACCAAAAAA
TGTAACCGATTCATTGAGCACCTACATTAATGCTAATTATATTAGGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCC
CATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAA
TGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTA
CACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCC
AGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTG
CAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAG
CATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGA
GAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCC
AAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATA
TTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATA
GGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAA
ATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATG
GACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGAT
AATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATT
ACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATT
ATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATT
TGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTC
TCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTA
CATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATT


Top

FusionGenePPI for MPHOSPH9_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MPHOSPH9USP11, YWHAZ, YWHAG, SVIL, LATS2, CCDC67, KIAA0753, CCDC14, MED4, OFD1, PCM1, CEP97, CEP104, CEP162, CEP290, CEP120, CNTROB, SPICE1, CEP128, CEP135, CEP63, CEP89, CNTRL, NINL, ODF2, RPGRIP1L, POC5, CENPJ, XPO1, CDC14APTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MPHOSPH9_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MPHOSPH9_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET