FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22309

FusionGeneSummary for MORN1_CMPK1

check button Fusion gene summary
Fusion gene informationFusion gene name: MORN1_CMPK1
Fusion gene ID: 22309
HgeneTgene
Gene symbol

MORN1

CMPK1

Gene ID

79906

51727

Gene nameMORN repeat containing 1cytidine/uridine monophosphate kinase 1
Synonyms-CK|CMK|CMPK|UMK|UMP-CMPK|UMPK
Cytomap

1p36.32

1p33

Type of geneprotein-codingprotein-coding
DescriptionMORN repeat-containing protein 1UMP-CMP kinaseUMP/CMP kinasecytidine monophosphate (UMP-CMP) kinase 1, cytosoliccytidylate kinasedCMP kinasedeoxycytidylate kinasenucleoside-diphosphate kinaseuridine monophosphate kinaseuridine monophosphate/cytidine monophosphate kinase
Modification date2018033120180519
UniProtAcc

Q5T089

P30085

Ensembl transtripts involved in fusion geneENST00000378531, ENST00000606372, 
ENST00000378529, 
ENST00000371873, 
ENST00000450808, ENST00000471289, 
Fusion gene scores* DoF score2 X 2 X 2=85 X 3 X 3=45
# samples 25
** MAII scorelog2(2/8*10)=1.32192809488736log2(5/45*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MORN1 [Title/Abstract] AND CMPK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCMPK1

GO:0006165

nucleoside diphosphate phosphorylation

23416111

TgeneCMPK1

GO:0009142

nucleoside triphosphate biosynthetic process

23416111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A1N9-01AMORN1chr1

2316417

-CMPK1chr1

47834141

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378531ENST00000371873MORN1chr1

2316417

-CMPK1chr1

47834141

+
5CDS-intronENST00000378531ENST00000450808MORN1chr1

2316417

-CMPK1chr1

47834141

+
5CDS-intronENST00000378531ENST00000471289MORN1chr1

2316417

-CMPK1chr1

47834141

+
5UTR-3CDSENST00000606372ENST00000371873MORN1chr1

2316417

-CMPK1chr1

47834141

+
5UTR-intronENST00000606372ENST00000450808MORN1chr1

2316417

-CMPK1chr1

47834141

+
5UTR-intronENST00000606372ENST00000471289MORN1chr1

2316417

-CMPK1chr1

47834141

+
In-frameENST00000378529ENST00000371873MORN1chr1

2316417

-CMPK1chr1

47834141

+
5CDS-intronENST00000378529ENST00000450808MORN1chr1

2316417

-CMPK1chr1

47834141

+
5CDS-intronENST00000378529ENST00000471289MORN1chr1

2316417

-CMPK1chr1

47834141

+

Top

FusionProtFeatures for MORN1_CMPK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MORN1

Q5T089

CMPK1

P30085

Catalyzes the phosphorylation of pyrimidine nucleosidemonophosphates at the expense of ATP. Plays an important role inde novo pyrimidine nucleotide biosynthesis. Has preference for UMPand CMP as phosphate acceptors. Also displays broad nucleosidediphosphate kinase activity. {ECO:0000255|HAMAP-Rule:MF_03172,ECO:0000269|PubMed:10462544, ECO:0000269|PubMed:11912132,ECO:0000269|PubMed:23416111}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-611109_131179351RepeatNote=MORN 4
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-611132_154179351RepeatNote=MORN 5
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-611155_177179351RepeatNote=MORN 6
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-61139_61179351RepeatNote=MORN 1
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-61162_84179351RepeatNote=MORN 2
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-61186_108179351RepeatNote=MORN 3
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-614109_131179498RepeatNote=MORN 4
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-614132_154179498RepeatNote=MORN 5
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-614155_177179498RepeatNote=MORN 6
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-61439_61179498RepeatNote=MORN 1
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-61462_84179498RepeatNote=MORN 2
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-61486_108179498RepeatNote=MORN 3
TgeneCMPK1chr1:2316417chr1:47834141ENST00000371873+0661_6357229Nucleotide bindingNMP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000371873+0693_9657229Nucleotide bindingNMP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000450808+0513_18-11180Nucleotide bindingATP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000450808+0561_63-11180Nucleotide bindingNMP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000450808+0593_96-11180Nucleotide bindingNMP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000371873+06133_14357229RegionLID
TgeneCMPK1chr1:2316417chr1:47834141ENST00000450808+05133_143-11180RegionLID
TgeneCMPK1chr1:2316417chr1:47834141ENST00000450808+0533_63-11180RegionNMPbind

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMORN1chr1:2316417chr1:47834141ENST00000378529-611178_200179351RepeatNote=MORN 7
HgeneMORN1chr1:2316417chr1:47834141ENST00000378531-614178_200179498RepeatNote=MORN 7
TgeneCMPK1chr1:2316417chr1:47834141ENST00000371873+0613_1857229Nucleotide bindingATP
TgeneCMPK1chr1:2316417chr1:47834141ENST00000371873+0633_6357229RegionNMPbind


Top

FusionGeneSequence for MORN1_CMPK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MORN1_ENST00000378531_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_351aa
MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQF
VLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKK
YGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSF

>In-frame_MORN1_ENST00000378529_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_351aa
MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQF
VLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKK
YGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MORN1_ENST00000378531_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_1053nt
ATGGCAGCGGCGGGCGAGGGCACCCCGAGCTCCCGCGGGCCGCGTCGGGACCCGCCTAGGCGGCCGCCCCGGAACGGTTATGGTGTCTAC
GTATACCCAAATTCCTTCTTTCGATATGAAGGAGAATGGAAAGCAGGGAGGAAGCACGGTCACGGGAAGTTGTTATTTAAAGATGGCAGT
TATTACGAAGGGGCGTTTGTGGACGGAGAGATCACGGGAGAAGGCCGCCGGCACTGGGCCTGGTCAGGAGACACCTTCTCTGGACAGTTT
GTTCTGGGAGAGCCTCAAGGCTACGGCGTCATGGAGTACAAAGCCGGCGGATGTTATGAAGGGGAGGTCTCCCACGGCATGCGGGAAGGA
CACGGGTTTCTGGTGGACCGGGATGGACAAGTGTACCAGGGCTCCTTCCATGACAACAAGAGGCACGGCCCTGGGCAGATGCTCTTTCAG
AACGGTGACAAGTACGACGGCGACTGGGTCCGGGACCGGCGTCAGGGACACGGGGTGCTGCGCTGCGCCGACGGCTCCACCTACAAGAAA
TATGGCTACACACACCTTTCTGCAGGAGAGCTGCTTCGTGATGAAAGGAAGAACCCAGATTCACAGTATGGTGAACTTATTGAAAAGTAC
ATTAAAGAAGGAAAGATTGTACCAGTTGAGATAACCATCAGTTTATTAAAGAGGGAAATGGATCAGACAATGGCTGCCAATGCTCAGAAG
AATAAATTCTTGATTGATGGGTTTCCAAGAAATCAAGACAACCTTCAAGGATGGAACAAGACCATGGATGGGAAGGCAGATGTATCTTTC
GTTCTCTTTTTTGACTGTAATAATGAGATTTGTATTGAACGATGTCTTGAGAGGGGAAAGAGTAGTGGTAGGAGTGATGACAACAGAGAG
AGCTTGGAAAAGAGAATTCAGACCTACCTTCAGTCAACAAAGCCAATTATTGACTTATATGAAGAAATGGGGAAAGTCAAGAAAATAGAT

>In-frame_MORN1_ENST00000378529_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_1053nt
ATGGCAGCGGCGGGCGAGGGCACCCCGAGCTCCCGCGGGCCGCGTCGGGACCCGCCTAGGCGGCCGCCCCGGAACGGTTATGGTGTCTAC
GTATACCCAAATTCCTTCTTTCGATATGAAGGAGAATGGAAAGCAGGGAGGAAGCACGGTCACGGGAAGTTGTTATTTAAAGATGGCAGT
TATTACGAAGGGGCGTTTGTGGACGGAGAGATCACGGGAGAAGGCCGCCGGCACTGGGCCTGGTCAGGAGACACCTTCTCTGGACAGTTT
GTTCTGGGAGAGCCTCAAGGCTACGGCGTCATGGAGTACAAAGCCGGCGGATGTTATGAAGGGGAGGTCTCCCACGGCATGCGGGAAGGA
CACGGGTTTCTGGTGGACCGGGATGGACAAGTGTACCAGGGCTCCTTCCATGACAACAAGAGGCACGGCCCTGGGCAGATGCTCTTTCAG
AACGGTGACAAGTACGACGGCGACTGGGTCCGGGACCGGCGTCAGGGACACGGGGTGCTGCGCTGCGCCGACGGCTCCACCTACAAGAAA
TATGGCTACACACACCTTTCTGCAGGAGAGCTGCTTCGTGATGAAAGGAAGAACCCAGATTCACAGTATGGTGAACTTATTGAAAAGTAC
ATTAAAGAAGGAAAGATTGTACCAGTTGAGATAACCATCAGTTTATTAAAGAGGGAAATGGATCAGACAATGGCTGCCAATGCTCAGAAG
AATAAATTCTTGATTGATGGGTTTCCAAGAAATCAAGACAACCTTCAAGGATGGAACAAGACCATGGATGGGAAGGCAGATGTATCTTTC
GTTCTCTTTTTTGACTGTAATAATGAGATTTGTATTGAACGATGTCTTGAGAGGGGAAAGAGTAGTGGTAGGAGTGATGACAACAGAGAG
AGCTTGGAAAAGAGAATTCAGACCTACCTTCAGTCAACAAAGCCAATTATTGACTTATATGAAGAAATGGGGAAAGTCAAGAAAATAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MORN1_ENST00000378531_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_3321nt
GACAGCGGCGGAAACGCGCACAGGCGCAGCTGCGTCCTCTGGCTCCGGGCCCGGCTAGCTTCGCTCCAGAGATTGCGCGGGCTCAGGGAC
TAGGCCCGTGGCCACACCCCCCCTTGCGACAAAGACCAATGGAAGCGGGCGTTGCTGGTCGCTAAGAGAACCCTCGGCGGCAAGATGGCA
GCGGCGGGCGAGGGCACCCCGAGCTCCCGCGGGCCGCGTCGGGACCCGCCTAGGCGGCCGCCCCGGAACGGTTATGGTGTCTACGTATAC
CCAAATTCCTTCTTTCGATATGAAGGAGAATGGAAAGCAGGGAGGAAGCACGGTCACGGGAAGTTGTTATTTAAAGATGGCAGTTATTAC
GAAGGGGCGTTTGTGGACGGAGAGATCACGGGAGAAGGCCGCCGGCACTGGGCCTGGTCAGGAGACACCTTCTCTGGACAGTTTGTTCTG
GGAGAGCCTCAAGGCTACGGCGTCATGGAGTACAAAGCCGGCGGATGTTATGAAGGGGAGGTCTCCCACGGCATGCGGGAAGGACACGGG
TTTCTGGTGGACCGGGATGGACAAGTGTACCAGGGCTCCTTCCATGACAACAAGAGGCACGGCCCTGGGCAGATGCTCTTTCAGAACGGT
GACAAGTACGACGGCGACTGGGTCCGGGACCGGCGTCAGGGACACGGGGTGCTGCGCTGCGCCGACGGCTCCACCTACAAGAAATATGGC
TACACACACCTTTCTGCAGGAGAGCTGCTTCGTGATGAAAGGAAGAACCCAGATTCACAGTATGGTGAACTTATTGAAAAGTACATTAAA
GAAGGAAAGATTGTACCAGTTGAGATAACCATCAGTTTATTAAAGAGGGAAATGGATCAGACAATGGCTGCCAATGCTCAGAAGAATAAA
TTCTTGATTGATGGGTTTCCAAGAAATCAAGACAACCTTCAAGGATGGAACAAGACCATGGATGGGAAGGCAGATGTATCTTTCGTTCTC
TTTTTTGACTGTAATAATGAGATTTGTATTGAACGATGTCTTGAGAGGGGAAAGAGTAGTGGTAGGAGTGATGACAACAGAGAGAGCTTG
GAAAAGAGAATTCAGACCTACCTTCAGTCAACAAAGCCAATTATTGACTTATATGAAGAAATGGGGAAAGTCAAGAAAATAGATGCTTCT
AAATCTGTTGATGAAGTTTTTGATGAAGTTGTGCAGATTTTTGACAAGGAAGGCTAATTCTAAACCTGAAGGCATCCTTGAAATCATGCT
TGAATATTGCTTTGATAGCTGCTATCATGACCCCTTTTTAAGGCAATTCTAATCTTTCATAACTACATCTCAATTAGTGGCTGGAAAGTA
CATGGTAAAACAAAGTAAATTTTTTTATGTTCTTTTTTTTGGTCACAGGAGTAGACAGTGAATTCAGGTTTAACTTCACCTTAGTTATGG
TGCTCACCAAACGAAGGGTATCAGCTATTTTTTTTAAAATTCAAAAAGAATATCCCTTTTATAGTTTGTGCCTTCTGTGAGCAAAACTTT
TTAGTACGCGTATATATCCCTCTAGTAATCACAACATTTTAGGATTTAGGGATACCCGCTTCCTCTTTTTCTTGCAAGTTTTAAATTTCC
AACCTTAAGTGAATTTGTGGACCAAATTTCAAAGGAACTTTTTGTGTAGTCAGTTCTTGCACAATGTGTTTGGTAAACAAACTCAAAATG
GATTCTTAGGAGCATTTTAGTGTTTATTAAATAACTGACCATTTGCTGTAGAAAGATGAGAAAACTTAAGCTTTGTTTTACTACAACTTG
TACAAAGTTGTATGACAGGGCATATTCTTTGCTTCCAAGATTTGGGTTGGGGGCACTAGGGGTTCAGAGCCTGGCAGAATTGTCAGCTTT
AGTCTGACATAATCTAAGGGTATGGGGCAAGGATCACATCTAATGCTTGTGTTCCTTATACTCTATTATATAGTGTTATTCATGATTCAG
CTGATCTTAACAAAATTCGTAGCAGTGGAACCTTGAAATGCATGTGGCTAGATTTATGCTAAAATGATTCTCAGTTAGCATTTTAGTAAC
ACTTCAAAGGTTTTTTTTTGTTTGTTTTCTAGACTTAATAAAAGCTTAGGATTAATTAGAAGAAGCAATCTAGTTAAATTTCCCATTTGT
ATTTTATTTTCTTGAATACTTTTTTCATAGTTATTTGTTTAAAAAGATTTAAAAATCATTGCACTTTGGTCAGAAAAATAATAAATATAT
CTTATAAATGTTTGATTCCCTTCCTTGCTATTTTTATTCAGTAGATTTTTGTTTGGCATCATGTTGAAGCACCGAAAGATAAATGATTTT
TAAAAGGCTATAGAGTCCAAAGGAATATTCTTTTACACCAATTCTTCCTTTAAAAATCTCTGAGGAATTTGTTTTCGCCTTACTTTTTTT
TCTTCTGTCACAATGCTAAGTGGTATCCGAGGTTCTTAATATGAGATTTAAAATCTTAAAATGTTTCTTATTTTCAGCACTTACATCATT
TGGTACACAGGGTCAAATAGGGCAAATAATTTTGTCTTTGTATAATAGATTTGATATTTAAAGTCACTGGAAATAGGACAAGTTAATGGA
TGTTTTTATATTTTAATAGAATCATTTATTTCTATGTGTTATGAAATTCACTTAATGATAAATTTTTCAACATACTTGCCATTAGAAAAC
AAAGTATTGCTAAGTACTATAACATATTGGCCACTAAAATTCATATTGAGATTATCTTGGTTTCTTGGAAGAGATAGGAATGAGTTCTTA
TCTAGTGTTGCAGGCCAGCAAATACAGAGGTGGTTTAATCAAACAGCTCTAGTATGAAGCAAGAGTAAAGACTAAGGTTTCGAGAGCATT
CCTACTCACATAAGTGAAGAAATCTGTCAGATAGGAATCTAAATATTTATAGTGAGATTGTGAAAGCAACCTTAAAGTTTTGAAGAAGAC
TGATGAGACTAGGTGCTTTGCTTCCTTTCATCAGGTATCTTTCTGTGGCATTTGAGAACAGAAACCAAGAAACATGGTAATTACTAAATT
ATGAGGCTTTGCTTTTTGTTTGCTTTTAAGTAGAAAAACATGTTGGCAACATTGAGTTTTGGAGTTGATTGAGATAATATGACTTAACTA
GTTTTGTCATTCCATTTGTTAAAGATACAGTCACCAAGAATGTTTTGAGTTTTTTGAAAGACCCCAATTTAAGCCTTGCTTATTTTTAAA

>In-frame_MORN1_ENST00000378529_chr1_2316417_-_CMPK1_ENST00000371873_chr1_47834141_+_3321nt
GACAGCGGCGGAAACGCGCACAGGCGCAGCTGCGTCCTCTGGCTCCGGGCCCGGCTAGCTTCGCTCCAGAGATTGCGCGGGCTCAGGGAC
TAGGCCCGTGGCCACACCCCCCCTTGCGACAAAGACCAATGGAAGCGGGCGTTGCTGGTCGCTAAGAGAACCCTCGGCGGCAAGATGGCA
GCGGCGGGCGAGGGCACCCCGAGCTCCCGCGGGCCGCGTCGGGACCCGCCTAGGCGGCCGCCCCGGAACGGTTATGGTGTCTACGTATAC
CCAAATTCCTTCTTTCGATATGAAGGAGAATGGAAAGCAGGGAGGAAGCACGGTCACGGGAAGTTGTTATTTAAAGATGGCAGTTATTAC
GAAGGGGCGTTTGTGGACGGAGAGATCACGGGAGAAGGCCGCCGGCACTGGGCCTGGTCAGGAGACACCTTCTCTGGACAGTTTGTTCTG
GGAGAGCCTCAAGGCTACGGCGTCATGGAGTACAAAGCCGGCGGATGTTATGAAGGGGAGGTCTCCCACGGCATGCGGGAAGGACACGGG
TTTCTGGTGGACCGGGATGGACAAGTGTACCAGGGCTCCTTCCATGACAACAAGAGGCACGGCCCTGGGCAGATGCTCTTTCAGAACGGT
GACAAGTACGACGGCGACTGGGTCCGGGACCGGCGTCAGGGACACGGGGTGCTGCGCTGCGCCGACGGCTCCACCTACAAGAAATATGGC
TACACACACCTTTCTGCAGGAGAGCTGCTTCGTGATGAAAGGAAGAACCCAGATTCACAGTATGGTGAACTTATTGAAAAGTACATTAAA
GAAGGAAAGATTGTACCAGTTGAGATAACCATCAGTTTATTAAAGAGGGAAATGGATCAGACAATGGCTGCCAATGCTCAGAAGAATAAA
TTCTTGATTGATGGGTTTCCAAGAAATCAAGACAACCTTCAAGGATGGAACAAGACCATGGATGGGAAGGCAGATGTATCTTTCGTTCTC
TTTTTTGACTGTAATAATGAGATTTGTATTGAACGATGTCTTGAGAGGGGAAAGAGTAGTGGTAGGAGTGATGACAACAGAGAGAGCTTG
GAAAAGAGAATTCAGACCTACCTTCAGTCAACAAAGCCAATTATTGACTTATATGAAGAAATGGGGAAAGTCAAGAAAATAGATGCTTCT
AAATCTGTTGATGAAGTTTTTGATGAAGTTGTGCAGATTTTTGACAAGGAAGGCTAATTCTAAACCTGAAGGCATCCTTGAAATCATGCT
TGAATATTGCTTTGATAGCTGCTATCATGACCCCTTTTTAAGGCAATTCTAATCTTTCATAACTACATCTCAATTAGTGGCTGGAAAGTA
CATGGTAAAACAAAGTAAATTTTTTTATGTTCTTTTTTTTGGTCACAGGAGTAGACAGTGAATTCAGGTTTAACTTCACCTTAGTTATGG
TGCTCACCAAACGAAGGGTATCAGCTATTTTTTTTAAAATTCAAAAAGAATATCCCTTTTATAGTTTGTGCCTTCTGTGAGCAAAACTTT
TTAGTACGCGTATATATCCCTCTAGTAATCACAACATTTTAGGATTTAGGGATACCCGCTTCCTCTTTTTCTTGCAAGTTTTAAATTTCC
AACCTTAAGTGAATTTGTGGACCAAATTTCAAAGGAACTTTTTGTGTAGTCAGTTCTTGCACAATGTGTTTGGTAAACAAACTCAAAATG
GATTCTTAGGAGCATTTTAGTGTTTATTAAATAACTGACCATTTGCTGTAGAAAGATGAGAAAACTTAAGCTTTGTTTTACTACAACTTG
TACAAAGTTGTATGACAGGGCATATTCTTTGCTTCCAAGATTTGGGTTGGGGGCACTAGGGGTTCAGAGCCTGGCAGAATTGTCAGCTTT
AGTCTGACATAATCTAAGGGTATGGGGCAAGGATCACATCTAATGCTTGTGTTCCTTATACTCTATTATATAGTGTTATTCATGATTCAG
CTGATCTTAACAAAATTCGTAGCAGTGGAACCTTGAAATGCATGTGGCTAGATTTATGCTAAAATGATTCTCAGTTAGCATTTTAGTAAC
ACTTCAAAGGTTTTTTTTTGTTTGTTTTCTAGACTTAATAAAAGCTTAGGATTAATTAGAAGAAGCAATCTAGTTAAATTTCCCATTTGT
ATTTTATTTTCTTGAATACTTTTTTCATAGTTATTTGTTTAAAAAGATTTAAAAATCATTGCACTTTGGTCAGAAAAATAATAAATATAT
CTTATAAATGTTTGATTCCCTTCCTTGCTATTTTTATTCAGTAGATTTTTGTTTGGCATCATGTTGAAGCACCGAAAGATAAATGATTTT
TAAAAGGCTATAGAGTCCAAAGGAATATTCTTTTACACCAATTCTTCCTTTAAAAATCTCTGAGGAATTTGTTTTCGCCTTACTTTTTTT
TCTTCTGTCACAATGCTAAGTGGTATCCGAGGTTCTTAATATGAGATTTAAAATCTTAAAATGTTTCTTATTTTCAGCACTTACATCATT
TGGTACACAGGGTCAAATAGGGCAAATAATTTTGTCTTTGTATAATAGATTTGATATTTAAAGTCACTGGAAATAGGACAAGTTAATGGA
TGTTTTTATATTTTAATAGAATCATTTATTTCTATGTGTTATGAAATTCACTTAATGATAAATTTTTCAACATACTTGCCATTAGAAAAC
AAAGTATTGCTAAGTACTATAACATATTGGCCACTAAAATTCATATTGAGATTATCTTGGTTTCTTGGAAGAGATAGGAATGAGTTCTTA
TCTAGTGTTGCAGGCCAGCAAATACAGAGGTGGTTTAATCAAACAGCTCTAGTATGAAGCAAGAGTAAAGACTAAGGTTTCGAGAGCATT
CCTACTCACATAAGTGAAGAAATCTGTCAGATAGGAATCTAAATATTTATAGTGAGATTGTGAAAGCAACCTTAAAGTTTTGAAGAAGAC
TGATGAGACTAGGTGCTTTGCTTCCTTTCATCAGGTATCTTTCTGTGGCATTTGAGAACAGAAACCAAGAAACATGGTAATTACTAAATT
ATGAGGCTTTGCTTTTTGTTTGCTTTTAAGTAGAAAAACATGTTGGCAACATTGAGTTTTGGAGTTGATTGAGATAATATGACTTAACTA
GTTTTGTCATTCCATTTGTTAAAGATACAGTCACCAAGAATGTTTTGAGTTTTTTGAAAGACCCCAATTTAAGCCTTGCTTATTTTTAAA


Top

FusionGenePPI for MORN1_CMPK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MORN1CMPK1ELAVL1, MOV10, NXF1, TTC19, ACOT13, ETFA, ECE2, NIT2, TATDN1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MORN1_CMPK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCMPK1P30085DB00441GemcitabineUMP-CMP kinase {ECO:0000255|HAMAP-Rule:MF_03172}small moleculeapproved

Top

RelatedDiseases for MORN1_CMPK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMORN1C0032460Polycystic Ovary Syndrome1CTD_human