FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22154

FusionGeneSummary for MLLT10_SNTG1

check button Fusion gene summary
Fusion gene informationFusion gene name: MLLT10_SNTG1
Fusion gene ID: 22154
HgeneTgene
Gene symbol

MLLT10

SNTG1

Gene ID

8028

54212

Gene nameMLLT10, histone lysine methyltransferase DOT1L cofactorsyntrophin gamma 1
SynonymsAF10G1SYN|SYN4
Cytomap

10p12.31

8q11.21

Type of geneprotein-codingprotein-coding
Descriptionprotein AF-10ALL1-fused gene from chromosome 10 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10type I AF10 proteintype III AF10 protgamma-1-syntrophingamma1-syntrophinsyntrophin 4
Modification date2018052220180519
UniProtAcc

P55197

Q9NSN8

Ensembl transtripts involved in fusion geneENST00000446906, ENST00000377072, 
ENST00000307729, ENST00000377059, 
ENST00000495130, ENST00000377100, 
ENST00000377091, 
ENST00000518864, 
ENST00000522124, ENST00000517473, 
ENST00000276467, ENST00000520697, 
Fusion gene scores* DoF score13 X 10 X 8=10406 X 5 X 4=120
# samples 206
** MAII scorelog2(20/1040*10)=-2.37851162325373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MLLT10 [Title/Abstract] AND SNTG1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMLLT10

GO:0045944

positive regulation of transcription by RNA polymerase II

17868029


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-C8-A278-01AMLLT10chr10

22024164

+SNTG1chr8

51415338

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000446906ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000446906ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000446906ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000446906ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
5CDS-intronENST00000446906ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377072ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377072ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377072ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377072ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
5CDS-intronENST00000377072ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000307729ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000307729ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000307729ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000307729ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
5CDS-intronENST00000307729ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377059ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377059ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377059ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
In-frameENST00000377059ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
5CDS-intronENST00000377059ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000495130ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000495130ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000495130ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000495130ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-intronENST00000495130ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377100ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377100ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377100ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377100ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-intronENST00000377100ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377091ENST00000518864MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377091ENST00000522124MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377091ENST00000517473MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-3CDSENST00000377091ENST00000276467MLLT10chr10

22024164

+SNTG1chr8

51415338

+
intron-intronENST00000377091ENST00000520697MLLT10chr10

22024164

+SNTG1chr8

51415338

+

Top

FusionProtFeatures for MLLT10_SNTG1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MLLT10

P55197

SNTG1

Q9NSN8

Probably involved in transcriptional regulation. Invitro or as fusion protein with KMT2A/MLL1 has transactivationactivity. Binds to cruciform DNA. In cells, binding to unmodifiedhistone H3 regulates DOT1L functions including histone H3 'Lys-79'dimethylation (H3K79me2) and gene activation (PubMed:26439302).{ECO:0000269|PubMed:17868029, ECO:0000269|PubMed:26439302}. Adapter protein that binds to and probably organizes thesubcellular localization of a variety of proteins. May linkvarious receptors to the actin cytoskeleton and the dystrophinglycoprotein complex (By similarity). May participate inregulating the subcellular location of diacylglycerol kinase-zetato ensure that diacylglycerol is rapidly inactivated followingreceptor activation. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123229_2409851069Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224229_24010011476Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123311_6749851069RegionNote=DNA-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123703_7849851069RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123750_7789851069RegionNote=Leucine-zipper
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+212380_2879851069RegionNote=Self-association
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224311_67410011476RegionNote=DNA-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224703_78410011476RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224750_77810011476RegionNote=Leucine-zipper
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+222480_28710011476RegionNote=Self-association
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123135_1989851069Zinc fingerPHD-type 2
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+212322_749851069Zinc fingerPHD-type 1
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+212379_1129851069Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224135_19810011476Zinc fingerPHD-type 2
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+222422_7410011476Zinc fingerPHD-type 1
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+222479_11210011476Zinc fingerC2HC pre-PHD-type
TgeneSNTG1chr10:22024164chr8:51415338ENST00000276467+516283_390121481DomainPH
TgeneSNTG1chr10:22024164chr8:51415338ENST00000517473+617283_390121481DomainPH
TgeneSNTG1chr10:22024164chr8:51415338ENST00000518864+820283_390121518DomainPH
TgeneSNTG1chr10:22024164chr8:51415338ENST00000522124+719283_390121518DomainPH

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15229_240-59127Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14229_240-119180Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15311_674-59127RegionNote=DNA-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15750_778-59127RegionNote=Leucine-zipper
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+1580_287-59127RegionNote=Self-association
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14311_674-119180RegionNote=DNA-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14750_778-119180RegionNote=Leucine-zipper
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+1480_287-119180RegionNote=Self-association
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15135_198-59127Zinc fingerPHD-type 2
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+1522_74-59127Zinc fingerPHD-type 1
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+1579_112-59127Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14135_198-119180Zinc fingerPHD-type 2
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+1422_74-119180Zinc fingerPHD-type 1
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+1479_112-119180Zinc fingerC2HC pre-PHD-type
TgeneSNTG1chr10:22024164chr8:51415338ENST00000276467+51657_140121481DomainPDZ
TgeneSNTG1chr10:22024164chr8:51415338ENST00000517473+61757_140121481DomainPDZ
TgeneSNTG1chr10:22024164chr8:51415338ENST00000518864+82057_140121518DomainPDZ
TgeneSNTG1chr10:22024164chr8:51415338ENST00000522124+71957_140121518DomainPDZ


Top

FusionGeneSequence for MLLT10_SNTG1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_1398aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF
QQLLNSQQLTPVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWE
KRWCDLRLIPLLHSRFSQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWC
EAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQ
WERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFS

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_1398aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF
QQLLNSQQLTPVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWE
KRWCDLRLIPLLHSRFSQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWC
EAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQ
WERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFS

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_1361aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF
QQLLNSQQLTPVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWE
KRWCDLRLIPLLHSRFSQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWC
EAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQ
WERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKELEFSNLFAVLHCIHSFFAAKVACLDPLFLGNQATASTAASS

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_1361aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNDRGDSSTLTKQELKFIGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSA
VSSAAPAVATTQANTLSGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNS
SLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQ
IHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQP
VTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQF
QQLLNSQQLTPVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWE
KRWCDLRLIPLLHSRFSQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWC
EAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQ
WERAFQTATFLEVERIQCKTTACVLESHLMGLTIDFSTGFICFDAATKELEFSNLFAVLHCIHSFFAAKVACLDPLFLGNQATASTAASS

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_1382aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI
QCKTTACVLESHLMGLTIDFSTGFICFDAATKAVLWRTKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAK

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_1345aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSTDQSLSDSSSHSQDKHHEKEKKKTKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTTTST
SNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGT
KRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQTRHDGACPTTTFSELLNAIHNGITNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL
SGSSLSQAPSHMTGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRTDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLN
SSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVQVLR
NAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRF
SQTVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQDRVYSPT
FLALRGSCLYKFLAPPVTTWDWTRAEKTFSVTEIMCKILKDSDLLDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4194nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAA
AGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGT
GACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAG
AAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCC
TTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCA
ACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGT
GAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCA
CCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTG
CTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAG
TGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATG
GGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAA
GGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCT
AATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACT

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_4194nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAA
AGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGT
GACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAG
AAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCC
TTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCA
ACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGT
GAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCA
CCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTG
CTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAG
TGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATG
GGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAA
GGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCT
AATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACT

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4083nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAA
AGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGT
GACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAG
AAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCC
TTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCA
ACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGT
GAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCA
CCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTG
CTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAG
TGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATG
GGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCAC
TGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCT

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4083nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGAC
AGTTCTACACTAACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGC
TCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCT
GTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGC
AATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTA
GTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGC
AGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAG
GGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTG
ACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAA
ATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGAT
AATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGG
CAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCT
GTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGA
GCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACAT
CCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTT
CAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAA
AGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGT
GACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAG
AAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCC
TTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCA
ACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGT
GAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCA
CCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTG
CTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAG
TGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATG
GGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCAC
TGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCT

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4035nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4494nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAA
GAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGAC
CAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCG
TGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTG
CCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAA
GACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTA
AACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTG
AGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATT
ATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTC
TCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACC
TATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTC
CTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAA
CAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTG

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_5783nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAA
GAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGAC
CAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCG
TGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTG
CCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAA
GACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTA
AACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTG
AGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATT
ATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTC
TCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACC
TATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTC
CTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAA
CAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTG
GACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACT
GAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACACATTTACTCATCATTTTAGACCCTAGAGAAACCATAACATCACCAAGT
CGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGTCATGTGGAACCTCAAAAACACTTCTATTCTGGATGACATCTGTGAAAT
ATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTTGTACCAGTAAGTGTATTGCTTTCACCAAAAGTGGAGACAAAAGAATAA
ATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCTACCTATGAATAAAAATACTTATTAAATGATTACTTCTGTATTTTAGAT
TATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAAACAAATGCCCTATCTTGTATTATGAGGGACATAAAAGAGTTAAAAACC
ATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAGGATGCACTTTAATTTGCTGATGTAAATTTGCCCTTGTGTTCTCATCCC
ATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTAAATATTCCGAAGAACTTCCAAAGGATAATTACATTGACCCATGATAGA
TACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATTGAAATGTCTTATTAGCTGCCAAAGTCAATCAAATATGCCAACAGTGTA
TTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCATTTCTTCCTTGGTTTGAAAGAGATTTGTATTTTACCTAATAAGATTTA
TTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAACCTTTTGTAGAGAAAATAATATAAACAAATATGGTGTGAGAAACAATTC
TTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGTCCCCCGAAAACAGTCCCAAAGCTATTATAGATGTTAATTAAATGACAT
TTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATATTTAAAGATAAAAGTTAAAATTCTTTAACCTCCCTTGTCATGGAAAGTG
ATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGTCCTAAGAATGTAAATGTGAAAGGCTGGGAAATTTGAAAGCCTTAGAGG
TGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGTATAACATGGAACACAGTCTCTGTCCTTCAGTACAGCTTTTTTGAGATA

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4421nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAA
GAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGAC
CAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCG
TGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTG
CCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAA
GACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTA
AACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTG
AGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATT
ATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTC
TCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACC
TATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTG
GAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAAT
CAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCATTGACACACCC

>In-frame_MLLT10_ENST00000446906_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4419nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAGCAATGATGTA
GCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTG
CAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCT
CTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGAT
CAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTA
CAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGG
AGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAAC
CGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACA
ATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGC
CCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCA
TCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACA
GTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGT
AACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACC
CACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAA
CGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAA
GAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGAC
CAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCG
TGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTG
CCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAA
GACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTA
AACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTG
AGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATT
ATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTC
TCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACC
TATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTG
GAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAAT
CAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCATTGACACACCC

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4542nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTA
ACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGT
ACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCA
GCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAAT
TCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGA
AGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAAT
CTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGT
GACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAG
GAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTT
TCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCT
GTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCT
CAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACC
ATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGG
GTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCT
ACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTA
AATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCT
TTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTA
CATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGC
GACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATT
GCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCA
AATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAG
CAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACC
ACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGG
AAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCC
TTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATT
GATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGAT
GATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCT
GTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCT

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_5831nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTA
ACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGT
ACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCA
GCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAAT
TCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGA
AGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAAT
CTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGT
GACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAG
GAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTT
TCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCT
GTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCT
CAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACC
ATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGG
GTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCT
ACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTA
AATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCT
TTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTA
CATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGC
GACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATT
GCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCA
AATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAG
CAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACC
ACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGG
AAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCC
TTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATT
GATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGAT
GATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCT
GTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCT
GCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACA
CATTTACTCATCATTTTAGACCCTAGAGAAACCATAACATCACCAAGTCGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGT
CATGTGGAACCTCAAAAACACTTCTATTCTGGATGACATCTGTGAAATATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTT
GTACCAGTAAGTGTATTGCTTTCACCAAAAGTGGAGACAAAAGAATAAATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCT
ACCTATGAATAAAAATACTTATTAAATGATTACTTCTGTATTTTAGATTATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAA
ACAAATGCCCTATCTTGTATTATGAGGGACATAAAAGAGTTAAAAACCATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAG
GATGCACTTTAATTTGCTGATGTAAATTTGCCCTTGTGTTCTCATCCCATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTA
AATATTCCGAAGAACTTCCAAAGGATAATTACATTGACCCATGATAGATACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATT
GAAATGTCTTATTAGCTGCCAAAGTCAATCAAATATGCCAACAGTGTATTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCA
TTTCTTCCTTGGTTTGAAAGAGATTTGTATTTTACCTAATAAGATTTATTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAAC
CTTTTGTAGAGAAAATAATATAAACAAATATGGTGTGAGAAACAATTCTTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGT
CCCCCGAAAACAGTCCCAAAGCTATTATAGATGTTAATTAAATGACATTTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATAT
TTAAAGATAAAAGTTAAAATTCTTTAACCTCCCTTGTCATGGAAAGTGATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGT
CCTAAGAATGTAAATGTGAAAGGCTGGGAAATTTGAAAGCCTTAGAGGTGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGT

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4469nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTA
ACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGT
ACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCA
GCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAAT
TCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGA
AGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAAT
CTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGT
GACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAG
GAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTT
TCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCT
GTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCT
CAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACC
ATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGG
GTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCT
ACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTA
AATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCT
TTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTA
CATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGC
GACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATT
GCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCA
AATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAG
CAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACC
ACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGG
AAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCC
TTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATT
GATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCC
TTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGC

>In-frame_MLLT10_ENST00000377072_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4467nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACACAAACAGAAA
CACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAGCAACAACTCT
ATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACACCTCTAGTGGA
AAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAAGCCTGGTGGT
GGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAAGTCATCTTCT
GGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCAACAGTCATCA
GCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCCTTCAACCTCA
GCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAAGCGGGCTCAA
ACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACCCAAAGGAAAC
AAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCATAACAAGCTCT
AGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGAAATTTCCATG
CAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGACAGAGGTGACAGTTCTACACTA
ACAAAGCAAGAACTTAAATTCATAGGTATTTATAACAGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGT
ACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCA
GCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAAT
TCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGA
AGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAAT
CTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGT
GACATTTTAGGAATGCTGAAGTCATTACACCAACTTCAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAG
GAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTT
TCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCT
GTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCT
CAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACC
ATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGG
GTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCT
ACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTA
AATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCT
TTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTA
CATCTCAACTACCATCCCAACAATACAGACACATTATCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGC
GACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATT
GCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCA
AATCTCACAAAGCACAATATTAAAAAAATCAACAGAAACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAG
CAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACC
ACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGG
AAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCC
TTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATT
GATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCC
TTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGC

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4324nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACA
CAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAG
CAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACAC
CTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAA
GCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAA
GTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCA
ACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCC
TTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAA
GCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACC
CAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCAT
AACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGA
AATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAG
CAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTC
TGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATC
TGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAA
TCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGT
AAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGA
GAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCA
AGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCC
TTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAG
CAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTAC
CAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAA
TGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGC
TTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTAC
CCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTC
TGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAA
TGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGC
TCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATC
ATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTC
TCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCT
CTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAA
CTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTT
CCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGT
TTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGA
CCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACA
GTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAAC
AAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCC
AGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGT
AGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAAC

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_5613nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACA
CAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAG
CAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACAC
CTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAA
GCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAA
GTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCA
ACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCC
TTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAA
GCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACC
CAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCAT
AACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGA
AATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAG
CAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTC
TGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATC
TGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAA
TCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGT
AAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGA
GAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCA
AGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCC
TTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAG
CAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTAC
CAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAA
TGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGC
TTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTAC
CCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTC
TGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAA
TGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGC
TCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATC
ATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTC
TCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCT
CTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAA
CTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTT
CCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGT
TTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGA
CCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACA
GTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAAC
AAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAATCC
AGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGT
AGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAAC
TTGACATACTGAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACACATTTACTCATCATTTTAGACCCTAGAGAAACCATAAC
ATCACCAAGTCGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGTCATGTGGAACCTCAAAAACACTTCTATTCTGGATGACA
TCTGTGAAATATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTTGTACCAGTAAGTGTATTGCTTTCACCAAAAGTGGAGAC
AAAAGAATAAATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCTACCTATGAATAAAAATACTTATTAAATGATTACTTCTG
TATTTTAGATTATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAAACAAATGCCCTATCTTGTATTATGAGGGACATAAAAGA
GTTAAAAACCATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAGGATGCACTTTAATTTGCTGATGTAAATTTGCCCTTGTG
TTCTCATCCCATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTAAATATTCCGAAGAACTTCCAAAGGATAATTACATTGAC
CCATGATAGATACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATTGAAATGTCTTATTAGCTGCCAAAGTCAATCAAATATGC
CAACAGTGTATTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCATTTCTTCCTTGGTTTGAAAGAGATTTGTATTTTACCTA
ATAAGATTTATTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAACCTTTTGTAGAGAAAATAATATAAACAAATATGGTGTGA
GAAACAATTCTTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGTCCCCCGAAAACAGTCCCAAAGCTATTATAGATGTTAAT
TAAATGACATTTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATATTTAAAGATAAAAGTTAAAATTCTTTAACCTCCCTTGTC
ATGGAAAGTGATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGTCCTAAGAATGTAAATGTGAAAGGCTGGGAAATTTGAAA
GCCTTAGAGGTGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGTATAACATGGAACACAGTCTCTGTCCTTCAGTACAGCTT

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4251nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACA
CAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAG
CAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACAC
CTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAA
GCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAA
GTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCA
ACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCC
TTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAA
GCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACC
CAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCAT
AACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGA
AATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAG
CAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTC
TGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATC
TGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAA
TCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGT
AAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGA
GAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCA
AGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCC
TTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAG
CAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTAC
CAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAA
TGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGC
TTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTAC
CCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTC
TGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAA
TGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGC
TCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATC
ATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTC
TCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCT
CTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAA
CTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTT
CCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGT
TTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGA
CCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACA
GTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAAC
AAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATT
TTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCAT

>In-frame_MLLT10_ENST00000307729_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4249nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAACA
CAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACTAG
CAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACACAC
CTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGAAA
GCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTAAA
GTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCCCA
ACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTCCC
TTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATATAA
GCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGACC
CAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGCAT
AACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCAGA
AATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAACAG
CAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCTTC
TGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTATC
TGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAACAA
TCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCTGT
AAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTGGA
GAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTTCA
AGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTGCC
TTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAACAG
CAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGTAC
CAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTCAA
TGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGAGC
TTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCTAC
CCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTTTC
TGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGGAA
TGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGTGC
TCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTATC
ATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTCTC
TCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGCCT
CTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGAAA
CTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACCTT
CCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCAGT
TTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAGGA
CCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATACA
GTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCAAC
AAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTATT
TTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTCAT

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000518864_chr8_51415338_+_4146nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000522124_chr8_51415338_+_5435nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGCTGTCCTTTGGAGGTATAAATTCTCTCAGCTTAAAGGTTCTTCAGATGATGGCAAGAGCAAAATCAAATTTTTGTTTCAGAAT
CCAGATACTAAACAGATTGAAGCAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAG
GTAGCTTGTTTGGACCCTCTATTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACA
ACTTGACATACTGAACTCTTCATTGACACACCCCATGACTGTATAAGCAGGACACATTTACTCATCATTTTAGACCCTAGAGAAACCATA
ACATCACCAAGTCGACAGTGGAGGCAAATCAAAATTTCGGCAGAAAAAGAAGGTCATGTGGAACCTCAAAAACACTTCTATTCTGGATGA
CATCTGTGAAATATACTACATGAACAGAACAGCTTGTTCTCACTCAGTTGCTTTGTACCAGTAAGTGTATTGCTTTCACCAAAAGTGGAG
ACAAAAGAATAAATTATTTGAAGAAGTATGTAAATAACATAAAAATAGTAAGCTACCTATGAATAAAAATACTTATTAAATGATTACTTC
TGTATTTTAGATTATTTTGTATGACTAGTACATGTTGGGCAGAGTCATAGGAAAACAAATGCCCTATCTTGTATTATGAGGGACATAAAA
GAGTTAAAAACCATAAATCAGCAAGGAGCATGCAAAAAAATCTCATCAAAGAAGGATGCACTTTAATTTGCTGATGTAAATTTGCCCTTG
TGTTCTCATCCCATGATTTGACACTGGCATTCCAATTGTTTTTATCTTATTGTAAATATTCCGAAGAACTTCCAAAGGATAATTACATTG
ACCCATGATAGATACAATGTGAAATGGACTATTCTCCCTTGGATCACTGTTATTGAAATGTCTTATTAGCTGCCAAAGTCAATCAAATAT
GCCAACAGTGTATTAATTTAATTATGAGTGATGGAAAATTTCATGAACCTCTCATTTCTTCCTTGGTTTGAAAGAGATTTGTATTTTACC
TAATAAGATTTATTATCAAATTAAAGTTTCATAAATTTTCAGTGAACCCAAAACCTTTTGTAGAGAAAATAATATAAACAAATATGGTGT
GAGAAACAATTCTTTGTAATCCGAAGTCTACTAGTTAATCATGAACTAAAATGTCCCCCGAAAACAGTCCCAAAGCTATTATAGATGTTA
ATTAAATGACATTTTTTCATTTTAGTACTATTTTATGAGAAACAAAGGTGATATTTAAAGATAAAAGTTAAAATTCTTTAACCTCCCTTG
TCATGGAAAGTGATTAAGTAATGCCAACTATGCAGGTTGTTTTAGGTATTTTGTCCTAAGAATGTAAATGTGAAAGGCTGGGAAATTTGA
AAGCCTTAGAGGTGTGCAATTTACTCAGATTCCAGGTATTATTCAACTAGTTGTATAACATGGAACACAGTCTCTGTCCTTCAGTACAGC

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000517473_chr8_51415338_+_4073nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA
TTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTC

>In-frame_MLLT10_ENST00000377059_chr10_22024164_+_SNTG1_ENST00000276467_chr8_51415338_+_4071nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAAAATATAAAGAGAAGGACAAA
CACAAACAGAAACACAAGAAGCAGCCAGAACCATCACCTGCATTGGTTCCATCCTTGACTGTTACTACAGAAAAAACTTATACAAGCACT
AGCAACAACTCTATATCTGGATCATTGAAGCGCTTGGAAGATACTACTGCACGATTTACAAATGCAAATTTCCAGGAAGTCTCTGCACAC
ACCTCTAGTGGAAAAGATGTTTCAGAGACTAGAGGGTCAGAGGGCAAAGGGAAGAAATCTTCAGCTCACAGCTCAGGTCAAAGGGGAAGA
AAGCCTGGTGGTGGAAGAAATCCAGGAACAACTGTGTCAGCAGCTAGCCCTTTTCCTCAAGGCAGTTTTTCAGGAACTCCAGGCAGTGTA
AAGTCATCTTCTGGAAGTTCAGTGCAGTCTCCCCAGGATTTCCTGAGCTTTACAGACTCAGATCTGCGTAATGACAGTTACTCTCACTCC
CAACAGTCATCAGCAACCAAAGATGTACATAAAGGAGAGTCTGGAAGCCAGGAAGGGGGGGTAAATAGTTTTAGTACCTTAATTGGCCTC
CCTTCAACCTCAGCTGTTACTTCACAGCCTAAAAGCTTTGAAAATTCACCTGGAGATTTGGGTAATTCCAGCCTTCCTACAGCAGGATAT
AAGCGGGCTCAAACTTCTGGCATAGAAGAAGAAACTGTAAAGGAAAAGAAAAGGAAAGGAAATAAACAAAGTAAGCATGGGCCTGGCAGA
CCCAAAGGAAACAAAAATCAAGAGAATGTTTCTCATCTCTCAGTTTCTTCTGCTTCACCAACATCATCTGTAGCATCAGCTGCAGGAAGC
ATAACAAGCTCTAGTCTGCAGAAATCTCCTACATTGCTCAGGAATGGAAGTTTACAGAGCCTCAGTGTTGGCTCATCTCCAGTTGGTTCA
GAAATTTCCATGCAGTATCGGCATGATGGAGCTTGCCCAACAACTACGTTCTCAGAGTTGCTGAATGCAATACACAACGGTATTTATAAC
AGCAATGATGTAGCAGTATCGTTTCCAAATGTAGTATCTGGCTCGGGATCTAGTACTCCTGTCTCCAGCTCTCACTTACCTCAGCAGTCT
TCTGGGCATTTGCAACAAGTAGGAGCGCTCTCTCCCTCAGCTGTGTCATCTGCAGCCCCTGCTGTTGCTACAACTCAGGCAAATACTCTA
TCTGGATCTTCTCTCAGTCAGGCACCATCTCATATGTATGGCAATAGATCAAATTCATCAATGGCAGCTCTTATAGCTCAGTCTGAAAAC
AATCAAACAGATCAAGATCTTGGAGACAATAGCCGCAACCTAGTTGGCAGAGGAAGCTCACCCCGAGGAAGTCTCTCGCCACGATCCCCT
GTAAGCAGCTTACAGATTCGCTATGATCAACCAGGCAACAGCAGTTTGGAAAATCTGCCTCCAGTAGCAGCCAGCATAGAACAGCTTTTG
GAGAGGCAGTGGAGTGAAGGACAGCAATTTTTACTAGAACAGGGTACTCCTAGTGACATTTTAGGAATGCTGAAGTCATTACACCAACTT
CAAGTTGAAAACCGAAGATTAGAGGAACAAATTAAAAACTTGACTGCCAAAAAGGAACGGCTTCAGTTATTGAATGCACAGCTTTCAGTG
CCTTTTCCAACAATAACAGCAAATCCTAGTCCGTCTCATCAAATACACACATTTTCAGCACAGACTGCTCCTACTACTGATTCCTTGAAC
AGCAGTAAGAGCCCTCATATAGGAAACAGCTTTTTACCTGATAATTCTCTTCCTGTATTAAATCAGGACTTAACCTCCAGTGGACAAAGT
ACCAGCAGCTCATCAGCTCTTTCTACCCCACCTCCTGCTGGGCAGAGTCCGGCTCAACAAGGCTCAGGAGTGAGTGGAGTTCAGCAGGTC
AATGGCGTGACAGTGGGGGCACTAGCTAGTGGAATGCAGCCTGTAACTTCCACCATTCCTGCCGTGTCTGCAGTGGGTGGAATAATTGGA
GCTTTGCCAGGTAACCAACTGGCAATTAATGGCATTGTAGGAGCTTTAAATGGGGTTATGCAGACTCCTGTCACAATGTCCCAGAACCCT
ACCCCTCTCACCCACACAACCGTACCACCTAATGCAACACATCCAATGCCAGCTACACTGACTAACAGTGCCTCAGGACTAGGATTACTT
TCTGACCAGCAACGACAAATACTTATTCATCAACAGCAGTTTCAGCAGTTGTTAAATTCTCAACAGCTCACACCAGTTCAGGTTCTTCGG
AATGCTGGAGAAGAAGTGACTCTAACAGTGTCATTTTTAAAAAGAGCACCTGCTTTCCTCAAACTCCCATTGAATGAAGATTGTGCATGT
GCTCCAAGTGACCAGAGCAGTGGCACCTCCTCTCCTCTCTGTGACAGTGGCTTACATCTCAACTACCATCCCAACAATACAGACACATTA
TCATGCTCGTCGTGGCCGACGTCTCCAGGCTTGAGGTGGGAGAAGCGATGGTGCGACCTCAGACTGATCCCTCTACTTCATTCGCGCTTC
TCTCAGTATGTGCCCGGCACAGATTTGAGTCGGCAGAATGCCTTTCAAGTCATTGCTGTGGATGGGGTCTGCACTGGGATTATTCAGTGC
CTCTCTGCTGAAGACTGCGTTGACTGGCTACAAGCAATAGCAACTAACATTTCAAATCTCACAAAGCACAATATTAAAAAAATCAACAGA
AACTTTCCTGTAAACCAGCAGATTGTCTACATGGGCTGGTGTGAAGCCCGGGAGCAAGACCCCCTCCAGGACAGAGTGTACTCCCCGACC
TTCCTGGCCCTGAGGGGCTCATGTCTCTACAAGTTTCTGGCACCTCCAGTGACCACCTGGGACTGGACGAGAGCAGAGAAAACATTCTCA
GTTTATGAGATTATGTGCAAGATCCTCAAGGACAGTGACCTGCTGGACCGACGGAAACAGTGCTTCACCGTGCAGTCTGAGTCTGGGGAG
GACCTGTACTTCTCAGTGGAGCTGGAAAGTGACCTCGCCCAGTGGGAAAGAGCCTTCCAGACAGCAACCTTTCTAGAAGTAGAACGGATA
CAGTGCAAGACCTATGCATGTGTGCTAGAAAGTCATCTAATGGGACTCACAATTGATTTCAGCACAGGATTTATCTGCTTTGATGCTGCA
ACAAAGGAGTTGGAATTTTCTAATTTATTTGCTGTTCTTCACTGCATTCATTCCTTCTTTGCTGCCAAGGTAGCTTGTTTGGACCCTCTA
TTTTTAGGCAATCAAGCTACTGCTTCTACTGCTGCCAGCTCTGCTACCACGAGCAAAGCAAAGTATACAACTTGACATACTGAACTCTTC


Top

FusionGenePPI for MLLT10_SNTG1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MLLT10YEATS4, SMARCB1, SS18, MLLT10, DOT1L, MLLT1, MLLT3, AFF1, DISC1, NDEL1, ELAVL1, CENPJ, TMPO, ZNF526, MLLT6, TCP10L, KIF6, PMF1SNTG1SNAP23, STXBP3, VPS45, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneMLLT10chr10:22024164chr8:51415338ENST00000307729+2123141_2339851069FSTL3
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377072+2224141_23310011476FSTL3


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377091+15141_233-59127FSTL3
HgeneMLLT10chr10:22024164chr8:51415338ENST00000377100+14141_233-119180FSTL3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MLLT10_SNTG1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MLLT10_SNTG1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMLLT10C0007134Renal Cell Carcinoma1CTD_human
HgeneMLLT10C0025202melanoma1CTD_human
HgeneMLLT10C0025286Meningioma1CTD_human