FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22150

FusionGeneSummary for MLLT10_PICALM

check button Fusion gene summary
Fusion gene informationFusion gene name: MLLT10_PICALM
Fusion gene ID: 22150
HgeneTgene
Gene symbol

MLLT10

PICALM

Gene ID

8028

8301

Gene nameMLLT10, histone lysine methyltransferase DOT1L cofactorphosphatidylinositol binding clathrin assembly protein
SynonymsAF10CALM|CLTH|LAP
Cytomap

10p12.31

11q14.2

Type of geneprotein-codingprotein-coding
Descriptionprotein AF-10ALL1-fused gene from chromosome 10 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10type I AF10 proteintype III AF10 protphosphatidylinositol-binding clathrin assembly proteinclathrin assembly lymphoid myeloid leukemia protein
Modification date2018052220180523
UniProtAcc

P55197

Q13492

Ensembl transtripts involved in fusion geneENST00000446906, ENST00000377072, 
ENST00000307729, ENST00000377059, 
ENST00000495130, ENST00000377100, 
ENST00000377091, 
ENST00000532317, 
ENST00000526033, ENST00000393346, 
ENST00000528398, ENST00000356360, 
ENST00000528411, 
Fusion gene scores* DoF score13 X 10 X 8=10407 X 12 X 4=336
# samples 2014
** MAII scorelog2(20/1040*10)=-2.37851162325373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/336*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MLLT10 [Title/Abstract] AND PICALM [Title/Abstract] AND fusion [Title/Abstract]

Acute monocytic leukemia with coexpression of minor BCR-ABL1 and PICALM-MLLT10 fusion genes along with overexpression of HOXA9. (pmid: 16518848)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMLLT10

GO:0045944

positive regulation of transcription by RNA polymerase II

17868029

TgenePICALM

GO:0006898

receptor-mediated endocytosis

10436022

TgenePICALM

GO:0032880

regulation of protein localization

10436022

TgenePICALM

GO:0045893

positive regulation of transcription, DNA-templated

11425879

TgenePICALM

GO:0048261

negative regulation of receptor-mediated endocytosis

10436022


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLAMLTCGA-AB-2855-03AMLLT10chr10

21906136

+PICALMchr11

85670103

-
TCGARVLAMLTCGA-AB-2849-03AMLLT10chr10

21906136

+PICALMchr11

85670103

-
ChiTaRS3.1AF060928MLLT10chr10

21823733

+PICALMchr11

85670105

-
ChiTaRS3.1AF060930MLLT10chr10

21827842

+PICALMchr11

85687726

-
ChiTaRS3.1AF060931MLLT10chr10

21827841

+PICALMchr11

85685856

-
ChiTaRS3.1AF060929MLLT10chr10

21860955

+PICALMchr11

85685857

-
ChiTaRS3.1AF060927MLLT10chr10

21827841

+PICALMchr11

85670104

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000446906ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000446906ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000446906ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000446906ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000446906ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
5CDS-intronENST00000446906ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000377072ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377072ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377072ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377072ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000377072ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
5CDS-intronENST00000377072ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000307729ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000307729ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000307729ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000307729ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000307729ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
5CDS-intronENST00000307729ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000377059ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377059ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377059ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000377059ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
In-frameENST00000377059ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
5CDS-intronENST00000377059ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000495130ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000495130ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000495130ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000495130ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000495130ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-intronENST00000495130ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377100ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377100ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377100ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377100ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377100ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-intronENST00000377100ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377091ENST00000532317MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377091ENST00000526033MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377091ENST00000393346MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377091ENST00000528398MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-3CDSENST00000377091ENST00000356360MLLT10chr10

21906136

+PICALMchr11

85670103

-
intron-intronENST00000377091ENST00000528411MLLT10chr10

21906136

+PICALMchr11

85670103

-
Frame-shitENST00000446906ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000446906ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000446906ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000446906ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000446906ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000446906ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377072ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377072ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377072ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377072ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377072ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000377072ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000307729ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000307729ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000307729ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000307729ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000307729ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000307729ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377059ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377059ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377059ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377059ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377059ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000377059ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-3CDSENST00000495130ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-3CDSENST00000495130ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-3CDSENST00000495130ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-3CDSENST00000495130ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-3CDSENST00000495130ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
3UTR-intronENST00000495130ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377100ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377100ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377100ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377100ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377100ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000377100ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377091ENST00000532317MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377091ENST00000526033MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000377091ENST00000393346MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377091ENST00000528398MLLT10chr10

21823733

+PICALMchr11

85670105

-
Frame-shitENST00000377091ENST00000356360MLLT10chr10

21823733

+PICALMchr11

85670105

-
5CDS-intronENST00000377091ENST00000528411MLLT10chr10

21823733

+PICALMchr11

85670105

-
In-frameENST00000446906ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000446906ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000446906ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000446906ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000446906ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000446906ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377072ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377072ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377072ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377072ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377072ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377072ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000307729ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000307729ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000307729ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000307729ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000307729ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000307729ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377059ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377059ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377059ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377059ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377059ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377059ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-3CDSENST00000495130ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-3CDSENST00000495130ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-3CDSENST00000495130ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-3CDSENST00000495130ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-intronENST00000495130ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
3UTR-intronENST00000495130ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377100ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377100ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377100ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377100ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377100ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377100ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377091ENST00000532317MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377091ENST00000526033MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377091ENST00000393346MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000377091ENST00000528398MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377091ENST00000356360MLLT10chr10

21827842

+PICALMchr11

85687726

-
5CDS-intronENST00000377091ENST00000528411MLLT10chr10

21827842

+PICALMchr11

85687726

-
In-frameENST00000446906ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000446906ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000446906ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000446906ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000446906ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000446906ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377072ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377072ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377072ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377072ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377072ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000377072ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000307729ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000307729ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000307729ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000307729ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000307729ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000307729ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377059ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377059ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377059ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377059ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377059ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000377059ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-3CDSENST00000495130ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-3CDSENST00000495130ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-3CDSENST00000495130ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-3CDSENST00000495130ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-3CDSENST00000495130ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
3UTR-intronENST00000495130ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377100ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377100ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377100ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377100ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377100ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000377100ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377091ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377091ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377091ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377091ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85685856

-
In-frameENST00000377091ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85685856

-
5CDS-intronENST00000377091ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85685856

-
intron-3CDSENST00000446906ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000446906ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000446906ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000446906ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000446906ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000446906ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377072ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377072ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377072ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377072ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377072ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000377072ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000307729ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000307729ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000307729ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000307729ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000307729ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000307729ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377059ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377059ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377059ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377059ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377059ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000377059ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000495130ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000495130ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000495130ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000495130ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000495130ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000495130ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377100ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377100ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377100ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377100ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377100ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000377100ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377091ENST00000532317MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377091ENST00000526033MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377091ENST00000393346MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377091ENST00000528398MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-3CDSENST00000377091ENST00000356360MLLT10chr10

21860955

+PICALMchr11

85685857

-
intron-intronENST00000377091ENST00000528411MLLT10chr10

21860955

+PICALMchr11

85685857

-
In-frameENST00000446906ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000446906ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000446906ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000446906ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000446906ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000446906ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377072ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377072ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377072ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377072ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377072ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000377072ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000307729ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000307729ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000307729ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000307729ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000307729ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000307729ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377059ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377059ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377059ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377059ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377059ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000377059ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-3CDSENST00000495130ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-3CDSENST00000495130ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-3CDSENST00000495130ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-3CDSENST00000495130ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-3CDSENST00000495130ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
3UTR-intronENST00000495130ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377100ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377100ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377100ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377100ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377100ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000377100ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377091ENST00000532317MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377091ENST00000526033MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377091ENST00000393346MLLT10chr10

21827841

+PICALMchr11

85670104

-
Frame-shitENST00000377091ENST00000528398MLLT10chr10

21827841

+PICALMchr11

85670104

-
In-frameENST00000377091ENST00000356360MLLT10chr10

21827841

+PICALMchr11

85670104

-
5CDS-intronENST00000377091ENST00000528411MLLT10chr10

21827841

+PICALMchr11

85670104

-

Top

FusionProtFeatures for MLLT10_PICALM


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MLLT10

P55197

PICALM

Q13492

Probably involved in transcriptional regulation. Invitro or as fusion protein with KMT2A/MLL1 has transactivationactivity. Binds to cruciform DNA. In cells, binding to unmodifiedhistone H3 regulates DOT1L functions including histone H3 'Lys-79'dimethylation (H3K79me2) and gene activation (PubMed:26439302).{ECO:0000269|PubMed:17868029, ECO:0000269|PubMed:26439302}. Assembly protein recruiting clathrin and adapter proteincomplex 2 (AP2) to cell membranes at sites of coated-pit formationand clathrin-vesicle assembly. May be required to determine theamount of membrane to be recycled, possibly by regulating the sizeof the clathrin cage. Involved in AP2-dependent clathrin-mediatedendocytosis at the neuromuscular junction.{ECO:0000269|PubMed:10436022}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+32322_74801069Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+32422_74801476Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+3522_7480127Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+3422_7480180Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+32322_74801069Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+32422_74801476Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+3522_7480127Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+3422_7480180Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+32322_74801069Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+32422_74801476Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+3522_7480127Zinc fingerPHD-type 1
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+3422_7480180Zinc fingerPHD-type 1
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823135_1982331069Zinc fingerPHD-type 2
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+82322_742331069Zinc fingerPHD-type 1
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+82379_1122331069Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824135_1982331476Zinc fingerPHD-type 2
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+82422_742331476Zinc fingerPHD-type 1
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+82479_1122331476Zinc fingerC2HC pre-PHD-type
TgenePICALMchr10:21827842chr11:85687726ENST00000356360-01914_1450633DomainENTH

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323229_240801069Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324229_240801476Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35229_24080127Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34229_24080180Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323229_240801069Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324229_240801476Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35229_24080127Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34229_24080180Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323229_240801069Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324229_240801476Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35229_24080127Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34229_24080180Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823229_2402331069Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824229_2402331476Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15229_240-59127Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14229_240-119180Compositional biasNote=Glu/Lys-rich
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323311_674801069RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323703_784801069RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323750_778801069RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+32380_287801069RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324311_674801476RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324703_784801476RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324750_778801476RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+32480_287801476RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35311_67480127RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35703_78480127RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35750_77880127RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+3580_28780127RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34311_67480180RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34703_78480180RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34750_77880180RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+3480_28780180RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323311_674801069RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323703_784801069RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323750_778801069RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+32380_287801069RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324311_674801476RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324703_784801476RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324750_778801476RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+32480_287801476RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35311_67480127RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35703_78480127RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35750_77880127RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+3580_28780127RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34311_67480180RegionNote=DNA-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34703_78480180RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34750_77880180RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+3480_28780180RegionNote=Self-association
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323311_674801069RegionNote=DNA-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323703_784801069RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323750_778801069RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+32380_287801069RegionNote=Self-association
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324311_674801476RegionNote=DNA-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324703_784801476RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324750_778801476RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+32480_287801476RegionNote=Self-association
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35311_67480127RegionNote=DNA-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35703_78480127RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35750_77880127RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+3580_28780127RegionNote=Self-association
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34311_67480180RegionNote=DNA-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34703_78480180RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34750_77880180RegionNote=Leucine-zipper
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+3480_28780180RegionNote=Self-association
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823311_6742331069RegionNote=DNA-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823703_7842331069RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823750_7782331069RegionNote=Leucine-zipper
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+82380_2872331069RegionNote=Self-association
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824311_6742331476RegionNote=DNA-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824703_7842331476RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824750_7782331476RegionNote=Leucine-zipper
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+82480_2872331476RegionNote=Self-association
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15311_674-59127RegionNote=DNA-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15703_784-59127RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15750_778-59127RegionNote=Leucine-zipper
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+1580_287-59127RegionNote=Self-association
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14311_674-119180RegionNote=DNA-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14703_784-119180RegionNote=Transactivation domain%3B required for DOT1L-binding
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14750_778-119180RegionNote=Leucine-zipper
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+1480_287-119180RegionNote=Self-association
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323135_198801069Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+32379_112801069Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324135_198801476Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+32479_112801476Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35135_19880127Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+3579_11280127Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34135_19880180Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+3479_11280180Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323135_198801069Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+32379_112801069Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324135_198801476Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+32479_112801476Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35135_19880127Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+3579_11280127Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34135_19880180Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+3479_11280180Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323135_198801069Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+32379_112801069Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324135_198801476Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+32479_112801476Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35135_19880127Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+3579_11280127Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34135_19880180Zinc fingerPHD-type 2
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+3479_11280180Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15135_198-59127Zinc fingerPHD-type 2
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+1522_74-59127Zinc fingerPHD-type 1
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+1579_112-59127Zinc fingerC2HC pre-PHD-type
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14135_198-119180Zinc fingerPHD-type 2
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+1422_74-119180Zinc fingerPHD-type 1
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+1479_112-119180Zinc fingerC2HC pre-PHD-type
TgenePICALMchr10:21827841chr11:85670104ENST00000356360-171914_145628633DomainENTH
TgenePICALMchr10:21827841chr11:85670104ENST00000393346-182014_145648653DomainENTH
TgenePICALMchr10:21827841chr11:85670104ENST00000526033-182014_145641646DomainENTH
TgenePICALMchr10:21827841chr11:85670104ENST00000528398-171914_145547552DomainENTH
TgenePICALMchr10:21827841chr11:85670104ENST00000532317-182014_145606611DomainENTH
TgenePICALMchr10:21827841chr11:85685856ENST00000356360-161914_145593633DomainENTH
TgenePICALMchr10:21827841chr11:85685856ENST00000393346-172014_145613653DomainENTH
TgenePICALMchr10:21827841chr11:85685856ENST00000526033-172014_145606646DomainENTH
TgenePICALMchr10:21827841chr11:85685856ENST00000528398-161914_145512552DomainENTH
TgenePICALMchr10:21827841chr11:85685856ENST00000532317-172014_145571611DomainENTH
TgenePICALMchr10:21827842chr11:85687726ENST00000393346-162014_145593653DomainENTH
TgenePICALMchr10:21827842chr11:85687726ENST00000526033-162014_145586646DomainENTH
TgenePICALMchr10:21827842chr11:85687726ENST00000528398-151914_145492552DomainENTH
TgenePICALMchr10:21827842chr11:85687726ENST00000532317-162014_145551611DomainENTH
TgenePICALMchr10:21906136chr11:85670103ENST00000356360-171914_145628633DomainENTH
TgenePICALMchr10:21906136chr11:85670103ENST00000393346-182014_145648653DomainENTH
TgenePICALMchr10:21906136chr11:85670103ENST00000526033-182014_145641646DomainENTH
TgenePICALMchr10:21906136chr11:85670103ENST00000528398-171914_145547552DomainENTH
TgenePICALMchr10:21906136chr11:85670103ENST00000532317-182014_145606611DomainENTH


Top

FusionGeneSequence for MLLT10_PICALM


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_238aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVRCELCPHKDG
ALKRTDNGGWAHVVCALTIPEVQFANVSTMEPIVLQSVPHDRTNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_140aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVAPPVMATPAT

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_120aa
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVTCDGHGCSVAVHQACTGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVM

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_85aa

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_85aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_714nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_420nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_360nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_255nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_2424nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGGAAGAAAATGG
AATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCT
TCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATA
AAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATC
AGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGT
ATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACA
ATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTAT
CAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAAT
GAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCT
CGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACT
GACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCAT
TTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTAC
AAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAG
TATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAA
CATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTC

>In-frame_MLLT10_ENST00000446906_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_1121nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGGAAGAAAATGG

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_2424nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGGAAGAAAATGG
AATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCT
TCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATA
AAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATC
AGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGT
ATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACA
ATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTAT
CAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAAT
GAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCT
CGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACT
GACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCAT
TTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTAC
AAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAG
TATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAA
CATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTC

>In-frame_MLLT10_ENST00000377072_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_1121nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGCTTTAAAAAGA
ACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGAACCAATTGTT
TTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCACTGGTGCTTGC
ATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGAAGGTAATGGT
GCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTCATATGATCAA
AGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGGAAGAAAATGG

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_2254nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGG
AAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCT
TAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAAT
ACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAAT
ACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGT
CCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAA
TACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTAT
TTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTAT
CCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCT
TAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGA
ACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCAT
TATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAG
AAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAA
GGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAAT
ACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTT
GCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTCCAC

>In-frame_MLLT10_ENST00000307729_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_951nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGAGC
TTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATGGA
ACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCCAC
TGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAAGA
AGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGGTC
ATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGATGG

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000532317_chr11_85670103_-_2076nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGAT
GGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCT
CTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCA
ATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTA
ATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGT
GTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACA
AATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTT
ATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTT
ATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCT
CTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGG
GAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTC
ATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCT
AGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAAT
AAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAA
ATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTG
TTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTCC

>In-frame_MLLT10_ENST00000377059_chr10_21906136_+_PICALM_ENST00000356360_chr11_85670103_-_773nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGAGATGTGAACTTTGTCCCCATAAGGATGGA
GCTTTAAAAAGAACAGATAATGGGGGTTGGGCCCATGTGGTTTGTGCCCTGTATATTCCAGAGGTACAATTTGCCAATGTTTCCACAATG
GAACCAATTGTTTTACAGTCTGTTCCGCATGATCGTTATAATAAGACTTGCTACATTTGTGATGAACAAGGAAGAGAAAGCAAAGCAGCC
ACTGGTGCTTGCATGACATGTAATAAACATGGATGTCGACAGGCTTTCCATGTAACATGCGCTCAGTTTGCCGGACTGCTTTGTGAAGAA
GAAGGTAATGGTGCCGATAATGTCCAATACTGTGGCTACTGTAAATACCATTTTAGTAAGCTGAAAAAGAGCAAACGGGGATCTAATAGG
TCATATGATCAAAGTTTAAGTGATTCTTCCTCTCACTCTCAGGATAAACATCATGAGAAAGAGAAAAAAATACAGTTTATGTAACTTGAT

>In-frame_MLLT10_ENST00000446906_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1881nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGAAGAAAATG
GAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTC
TTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTAT
AAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAAT
CAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTG
TATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAAC
AATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTA
TCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAA
TGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTC
TCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCAC
TGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCA
TTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTA
CAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATA
GTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTA
ACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCT

>In-frame_MLLT10_ENST00000446906_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_755nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGAAGAAAATG
GAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTC
TTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTAT

>In-frame_MLLT10_ENST00000377072_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1881nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGAAGAAAATG
GAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTC
TTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTAT
AAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAAT
CAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTG
TATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAAC
AATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTA
TCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAA
TGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTC
TCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCAC
TGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCA
TTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTA
CAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATA
GTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTA
ACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCT

>In-frame_MLLT10_ENST00000377072_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_755nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGAAGAAAATG
GAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTC
TTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTAT

>In-frame_MLLT10_ENST00000307729_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1711nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATG
GAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTC
TTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAA
TACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAA
TACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTG
TCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAA
ATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTA
TTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTA
TCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTC
TTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGG
AACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCA
TTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTA
GAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATA
AGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAA
TACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGT
TGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTCCA

>In-frame_MLLT10_ENST00000307729_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_585nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATG
GAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTC
TTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAA

>In-frame_MLLT10_ENST00000377059_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1533nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGA
TGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATC
TCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATC
AATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTT
AATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTG
TGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCAC
AAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATT
TATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTT
TATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATC
TCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAG
GGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGT
CATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTC
TAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAA
TAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTA
AATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTT
GTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTC

>In-frame_MLLT10_ENST00000377059_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_407nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGA
TGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATC
TCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATC

>In-frame_MLLT10_ENST00000377100_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1889nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA
CAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATA
CCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTC
CTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAAT
ACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATT
TATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATC
CACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTT
AAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAA
CAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATT
ATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGA
AGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAG
GGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATA
CATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTG

>In-frame_MLLT10_ENST00000377100_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_763nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA

>In-frame_MLLT10_ENST00000377091_chr10_21823733_+_PICALM_ENST00000526033_chr11_85670105_-_1709nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA
CAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATA
CCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTC
CTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAAT
ACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATT
TATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATC
CACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTT
AAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAA
CAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATT
ATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGA
AGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAG
GGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATA
CATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTG

>In-frame_MLLT10_ENST00000377091_chr10_21823733_+_PICALM_ENST00000393346_chr11_85670105_-_583nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGATACAGTTTATGTAACTTGATGGA
AGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTT
AAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATA

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_2130nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA
GACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTT
ATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGG
ATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTT
TTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACATTAATATTG
TATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCT
CAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAG
CATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTA
AATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAAT
GAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAG
TCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCC
AAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAA
GAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAA

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_2126nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA
GACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTT
ATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGG
ATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTT
TTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACATTAATATTG
TATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCT
CAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAG
CATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTA
AATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAAT
GAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAG
TCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCC
AAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAA
GAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAA

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_1000nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA

>In-frame_MLLT10_ENST00000446906_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_975nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_2130nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA
GACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTT
ATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGG
ATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTT
TTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACATTAATATTG
TATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCT
CAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAG
CATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTA
AATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAAT
GAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAG
TCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCC
AAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAA
GAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAA

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_2126nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA
GACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTT
ATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGG
ATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTT
TTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACATTAATATTG
TATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCT
CAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAG
CATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTA
AATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAAT
GAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAG
TCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCC
AAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAA
GAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAA

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_1000nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA
ACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAA

>In-frame_MLLT10_ENST00000377072_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_975nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGGC
ATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCT
CCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCT
CAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTA

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_1960nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTAC
ACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGT
CATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAA
GACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAAT
GCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGC
TATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAG
AAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACT
CTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAA
CTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAAC
ATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGA
ATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGA
TTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCA
CTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCC
TTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAG
GGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTA
ATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGA
GGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_1956nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTAC
ACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGT
CATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAA
GACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAAT
GCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGC
TATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAG
AAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACT
CTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAA
CTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAAC
ATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGA
ATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGA
TTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCA
CTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCC
TTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAG
GGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTA
ATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGA
GGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTT

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_830nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTAC
ACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGT
CATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAA
GACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAAT
GCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGC

>In-frame_MLLT10_ENST00000307729_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_805nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTAC
ACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGT
CATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAA
GACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_1782nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT
GTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAA
AAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGA
ATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATT
GCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCA
AGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGA
CTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATT
AACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATA
ACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCA
GAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGG
GATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAG
CACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGG
CCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGA
AGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGT
TAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGA
GAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_1778nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT
GTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAA
AAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGA
ATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATT
GCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCA
AGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGA
CTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATT
AACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATA
ACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCA
GAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGG
GATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAG
CACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGG
CCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGA
AGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGT
TAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGA
GAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTAT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_652nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT
GTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAA
AAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGA
ATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATT

>In-frame_MLLT10_ENST00000377059_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_627nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACT
ACACCAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCT
GTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAA
AAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGA

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_2138nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA
TGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAA
AAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCT
TTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACT
TTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACAT
TAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAAT
GCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATT
TAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACT
ACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTT
TCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGG
GGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAAT
GTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGG
GGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_2134nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA
TGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAA
AAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCT
TTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACT
TTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACAT
TAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAAT
GCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATT
TAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACT
ACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTT
TCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGG
GGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAAT
GTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGG
GGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTT

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_1008nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA

>In-frame_MLLT10_ENST00000377100_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_983nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000532317_chr11_85687726_-_1958nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA
TGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAA
AAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCT
TTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACT
TTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACAT
TAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAAT
GCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATT
TAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACT
ACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTT
TCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGG
GGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAAT
GTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGG
GGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000526033_chr11_85687726_-_1954nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA
TGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTATCAAGAA
AAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACAGGACTCT
TTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAAATTAACT
TTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTACATAACAT
TAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGATTCAGAAT
GCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTGTGGGATT
TAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAAAAGCACT
ACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTAGGGCCTT
TCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGG
GGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAAAGTTAAT
GTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGTGGAGAGG
GGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTCTATTTTT

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000393346_chr11_85687726_-_828nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC
TACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGAATTGCTA

>In-frame_MLLT10_ENST00000377091_chr10_21827842_+_PICALM_ENST00000528398_chr11_85687726_-_803nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGGCACCCCCTGTAATGGCCTATCCTGCTACTACAC
CAACAGGCATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATACAGCCAGCCTGTCA
TGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCCAAAAAGA
CAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATTAGAATGC

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_2070nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG
TTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCC
ATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTT
TACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACA
GAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTAT
GATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCAC
AAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAG
AATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAG
TTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATT
TTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGG
TGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGG
AAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACAT
CTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCAT
TGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTCCACAAAA

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_2066nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG
TTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCC
ATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTT
TACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACA
GAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTAT
GATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCAC
AAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAG
AATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAG
TTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATT
TTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGG
TGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGG
AAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACAT
CTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCAT

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_940nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_915nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_767nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_2070nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG
TTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCC
ATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTT
TACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACA
GAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTAT
GATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCAC
AAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAG
AATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAG
TTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATT
TTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGG
TGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGG
AAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACAT
CTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCAT
TGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTTCCACAAAA

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_2066nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG
TTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCC
ATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTT
TACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACA
GAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTAT
GATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCAC
AAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAG
AATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAG
TTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATT
TTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGG
TGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGG
AAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACAT
CTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCAT

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_940nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_915nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA
AAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAA
CTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAG

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_767nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACC
TTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTGATGGAAGA

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_1900nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGAC
GCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACT
TGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAA
ATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGT
ATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCT
GTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAA
CTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCT
CACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGT
ATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGAT
TTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGA
ATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGC
CAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCA
TGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAA
CTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTT
AAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGT
GTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATT
CTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGC

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_1896nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGAC
GCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACT
TGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAA
ATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGT
ATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCT
GTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAA
CTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCT
CACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGT
ATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGAT
TTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGA
ATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGC
CAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCA
TGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAA
CTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTT
AAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGT
GTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATT
CTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGC

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_770nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGAC
GCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACT
TGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAA
ATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGT

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_745nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGAC
GCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACT
TGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAA
ATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGT

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_597nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGAC
GCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACT

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_1722nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA
CTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTT
AAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAAC
GTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTC
CTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAG
AACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTC
CTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTT
GTATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTG
ATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCT
GAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTT
GCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGG
CATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAA
AACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTT
TTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTT
GTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCA
TTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_1718nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA
CTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTT
AAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAAC
GTATCAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTC
CTGTTAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAG
AACTGTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTC
CTCACAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTT
GTATTTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTG
ATTTTTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCT
GAATCTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTT
GCCAGGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGG
CATGTCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAA
AACTCTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTT
TTAAATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTT
GTGTAAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCA
TTCTTGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCA

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_592nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA
CTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTT
AAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAAC

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_567nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA
CTTGATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTT
AAATCTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAAC

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_419nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATG
ACGCAACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_2078nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT
CAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGT
TAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACT
GTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCA
CAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTAT
TTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTT
TTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAAT
CTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCA
GGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATG
TCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACT
CTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAA
ATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGT
AAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCT
TGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTT

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_2074nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT
CAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGT
TAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACT
GTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCA
CAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTAT
TTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTT
TTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAAT
CTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCA
GGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATG
TCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACT
CTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAA
ATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGT
AAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCT
TGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTT

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_948nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_923nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_775nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85685856_-_1898nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT
CAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGT
TAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACT
GTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCA
CAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTAT
TTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTT
TTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAAT
CTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCA
GGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATG
TCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACT
CTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAA
ATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGT
AAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCT
TGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTT

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000526033_chr11_85685856_-_1894nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT
CAATACAGTTTATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGT
TAATACCCATAATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACT
GTGTCCTTTACTGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCA
CAAATACAGAAACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTAT
TTATTTATGATTATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTT
TTATCCACAAGAATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAAT
CTCTTAAGAATTCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCA
GGGAACAGTTCACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATG
TCATTATTTTCCATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACT
CTAGAAGGTGTTACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAA
ATAAGGGGAAATAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGT
AAATACATCTTTAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCT
TGTTGCATTGTCTCTGCAGATTCTATTTTTGTTTACAATATTAAAATGTATGTTAGCAAAATGGGTGGATTTTCAAATAAAATGCAGCTT

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000393346_chr11_85685856_-_768nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000528398_chr11_85685856_-_743nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG
ATGGAAGAAAATGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAAT
CTCTTAAACTCTCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTAT

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85685856_-_595nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGCCTCCACAAATGGGAAGTGTTCCTGTAATGACGC
AACCAACCTTAATATACAGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATGTAACTTG

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1965nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCC
AAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATT
AGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGA
ATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTA
TCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACA
GGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAA
ATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTAC
ATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGAT
TCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTG
TGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAA
AAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTA
GGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAG
GGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAA
AGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGT
GGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTC

>In-frame_MLLT10_ENST00000446906_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_662nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCC

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1965nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCC
AAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTTCTTCCATT
AGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAAAGCCAAGA
ATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCAGTAACCTA
TCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTATTTCAACA
GGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAATAACTGAA
ATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATCAATTTTAC
ATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATGAATCTGAT
TCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTCGGCCTCTG
TGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTGACTAGGAA
AAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATTTGACATTA
GGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACAAGGGGGAG
GGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGTATCTTTAA
AGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAACATTTGGGT
GGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCTGCAGATTC

>In-frame_MLLT10_ENST00000377072_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_662nt
CGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGAGGAGGAAG
CGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCTTGATTATG
TGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAGGCGGTGGA
GGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGGTCTCTAGC
GACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGAGAGGCTGG
GCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTACCCACTGGA
CCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGAATTACTCC

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1795nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATG
GAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTC
TTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTAT
AAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAAT
CAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTG
TATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAAC
AATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTA
TCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAA
TGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTC
TCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCAC
TGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCA
TTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTA
CAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATA
GTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTA
ACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCT

>In-frame_MLLT10_ENST00000307729_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_492nt
CTTGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGG
AGGCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAAT
GGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGA
GAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGT
ACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATG

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1617nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAA
TGGAATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTC
TCTTCTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTT
ATAAAGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATA
ATCAGTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTAC
TGTATTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAA
ACAATAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGAT
TATCAATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAG
AATGAATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAAT
TCTCGGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTC
ACTGACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTC
CATTTGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGT
TACAAGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAA
TAGTATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTT
TAACATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGT

>In-frame_MLLT10_ENST00000377059_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_314nt
ATGGTCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGAC
GAGAGAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAA
GTACCCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAA

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1973nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGA
ATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTT
CTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAA
AGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCA
GTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTA
TTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAA
TAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATC
AATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATG
AATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTC
GGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTG
ACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATT
TGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACA
AGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGT
ATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAAC
ATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCT

>In-frame_MLLT10_ENST00000377100_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_670nt
CGCGGCAGCGCGCACGCAGGGCTAGCCTCGCCCAGGCCTCCTCCCTCACGCCGGCCGCAGGACGGGCGCGCACGCCAAGTGACGCTCCGA
GGAGGAAGCGCAGCCCCCTTCCCCTCCCTCGCTGCCCCTGGCCCAGCGGGAGCCCCCCCTCCCCCCAGTGCGCCTGTGCGGAGGCCCTCT
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGA

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000532317_chr11_85670104_-_1793nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGA
ATTACTCCAAAAAGACAAGTGCTCAAGCAGCAAAATCCTTACTTCCAGCAAAATCCAAACTGCTGTCTCTTAAATCTCTTAAACTCTCTT
CTTCCATTAGAATGCTACAAGTAACTCAGTGAAGGCCCATGAAGGAAATTGGGACTAGTTTATAGGAGAACGTATCAATACAGTTTATAA
AGCCAAGAATTGCTATGATTTAAGACTAAGATCTGTCTTTTTGGTGACTAACCCTTCAATTCTTTCAACTCCTGTTAATACCCATAATCA
GTAACCTATCAAGAAAAGCCCTTATTTGGAAAGTGTGAAATTTGTATTTGGAAAAGCTGCCTGGAGAGAAGAACTGTGTCCTTTACTGTA
TTTCAACAGGACTCTTTTGGGGGATCAAAATTAAAATTCCTAATTATGCATTATCTTTCTTTTCTCCAGTCCTCACAAATACAGAAACAA
TAACTGAAATTAACTTTTCTTTTTTTAAAAAAAATTATATTCAGTTTGCAGTAGACATTCCTTAAGTATTTGTATTTATTTATGATTATC
AATTTTACATAACATTAATATTGTATCAGACCTCCTTATGAAAATGAGTATGGATGTGCACAGTATGTTTGATTTTTATCCACAAGAATG
AATCTGATTCAGAATGCTTTTCTCAGCTGACATACAGAGCACTAAATATTTTAAGGCAAGTCCATAGGTCTGAATCTCTTAAGAATTCTC
GGCCTCTGTGGGATTTAGGGAAGCATTATAAATGCATTAATCCTTATAGTCAATTCTGTGCCTAGGATTTTGCCAGGGAACAGTTCACTG
ACTAGGAAAAGCACTACATTTTAAATTCAGCATTAGTGCATTGGGAAGGATCTTTACTGCTTTGTGCTTGGCATGTCATTATTTTCCATT
TGACATTAGGGCCTTTCCAAAATGAATGTGAGGAATTGCTTTCACTTCAAGACTTTCCTTCTTTTCACTAAAACTCTAGAAGGTGTTACA
AGGGGGAGGGAAGGGGGGCAAAGTCCTTGAACATTTTCTTTGGCTCGTGCCATGTTATGATCATATACCTTTTAAATAAGGGGAAATAGT
ATCTTTAAAGTTAATGTCTAGCCAAGAGTTTAGTAAACGAAGAATTAAACTGCACTGTTGATCGGTGCTTTGTGTAAATACATCTTTAAC
ATTTGGGTGGAGAGGGGCCTTAAGAAGGACAGTTCATTGTAGGAAAGCAATTCTGTACATGAGTTTAAGCATTCTTGTTGCATTGTCTCT

>In-frame_MLLT10_ENST00000377091_chr10_21827841_+_PICALM_ENST00000356360_chr11_85670104_-_490nt
TGATTATGTGTGCCCTCTCCGGGCGCCCGCGTTAGCGGCCGGGTGGAGGTGGGGAGGGAAGACGCTGAGGAGGAGGAGGAGGCGGAGGAG
GCGGTGGAGGGGAGGTGGGGGGAATCAGCAAGGACATGGCTCCTGACTCCTGTGCGGAACGTGAGTGACTGAGCGGCAAAGCCCGAATGG
TCTCTAGCGACCGGCCCGTGTCACTGGAGGACGAGGTCTCCCATAGTATGAAGGAGATGATTGGAGGCTGTTGCGTTTGCTCAGACGAGA
GAGGCTGGGCCGAGAACCCGCTGGTTTATTGCGACGGGCACGGCTGCAGCGTCGCGGTGCATCAAGCTTGCTATGGCATTGTTCAAGTAC
CCACTGGACCGTGGTTTTGCAGGAAATGTGAATCTCAGGAGAGAGCAGCCAGAGTGATACAGTTTATGTAACTTGATGGAAGAAAATGGA


Top

FusionGenePPI for MLLT10_PICALM


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MLLT10YEATS4, SMARCB1, SS18, MLLT10, DOT1L, MLLT1, MLLT3, AFF1, DISC1, NDEL1, ELAVL1, CENPJ, TMPO, ZNF526, MLLT6, TCP10L, KIF6, PMF1PICALMPLCG1, CLTC, ITSN1, AP2A1, HIP1R, LAMTOR3, EEF1A1, SEC24D, DNM2, EGFR, FLOT1, SEC24C, ATP6V1E1, ILF3, HNRNPDL, SH3GLB2, ABCC2, ATP6V1F, CD55, SIRT1, FN1, VCAM1, ITGA4, PELI2, KLHL20, SLC25A41, ITLN1, ATF6B, SLC25A32, SOX2, FAM64A, CYP1A1, HNRNPA1, UNK, NTRK1, C14orf166, CARS, CPPED1, HNRNPD, ILVBL, ITGB1, LPP, PAPOLA, DDX1, EWSR1, FERMT2, FUS, ILK, NPLOC4, PFKM, PTPRF, VCL, PXN, STXBP1, TRIM25, UNC13D, XPO1, AP2B1, AP2M1, CLTA, CLTB, DAB2, EPS15, GAK, MYO6, PIK3C2A, SEC13, CLTCL1, CAPZA2, DBN1, MYH9, LIMA1, GTSE1, ANLN, MYO19, MYO18A, CLINT1, SEC16A, TNRC6A, BMP2K, MICAL3, DENND1A, WNK1, PRRC2B, STON2, FCHO2, MCM2, SNW1, CDC5L, SMURF1, CDH1, STAMBPL1, RALBP1, SNRNP27, DLST


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneMLLT10chr10:21906136chr11:85670103ENST00000307729+823141_2332331069FSTL3
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377072+824141_2332331476FSTL3
TgenePICALMchr10:21827842chr11:85687726ENST00000356360-019221_2940633PIMREG


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMLLT10chr10:21827841chr11:85670104ENST00000307729+323141_233801069FSTL3
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377072+324141_233801476FSTL3
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377091+35141_23380127FSTL3
HgeneMLLT10chr10:21827841chr11:85670104ENST00000377100+34141_23380180FSTL3
HgeneMLLT10chr10:21827841chr11:85685856ENST00000307729+323141_233801069FSTL3
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377072+324141_233801476FSTL3
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377091+35141_23380127FSTL3
HgeneMLLT10chr10:21827841chr11:85685856ENST00000377100+34141_23380180FSTL3
HgeneMLLT10chr10:21827842chr11:85687726ENST00000307729+323141_233801069FSTL3
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377072+324141_233801476FSTL3
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377091+35141_23380127FSTL3
HgeneMLLT10chr10:21827842chr11:85687726ENST00000377100+34141_23380180FSTL3
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377091+15141_233-59127FSTL3
HgeneMLLT10chr10:21906136chr11:85670103ENST00000377100+14141_233-119180FSTL3
TgenePICALMchr10:21827841chr11:85670104ENST00000356360-1719221_294628633PIMREG
TgenePICALMchr10:21827841chr11:85670104ENST00000393346-1820221_294648653PIMREG
TgenePICALMchr10:21827841chr11:85670104ENST00000526033-1820221_294641646PIMREG
TgenePICALMchr10:21827841chr11:85670104ENST00000528398-1719221_294547552PIMREG
TgenePICALMchr10:21827841chr11:85670104ENST00000532317-1820221_294606611PIMREG
TgenePICALMchr10:21827841chr11:85685856ENST00000356360-1619221_294593633PIMREG
TgenePICALMchr10:21827841chr11:85685856ENST00000393346-1720221_294613653PIMREG
TgenePICALMchr10:21827841chr11:85685856ENST00000526033-1720221_294606646PIMREG
TgenePICALMchr10:21827841chr11:85685856ENST00000528398-1619221_294512552PIMREG
TgenePICALMchr10:21827841chr11:85685856ENST00000532317-1720221_294571611PIMREG
TgenePICALMchr10:21827842chr11:85687726ENST00000393346-1620221_294593653PIMREG
TgenePICALMchr10:21827842chr11:85687726ENST00000526033-1620221_294586646PIMREG
TgenePICALMchr10:21827842chr11:85687726ENST00000528398-1519221_294492552PIMREG
TgenePICALMchr10:21827842chr11:85687726ENST00000532317-1620221_294551611PIMREG
TgenePICALMchr10:21906136chr11:85670103ENST00000356360-1719221_294628633PIMREG
TgenePICALMchr10:21906136chr11:85670103ENST00000393346-1820221_294648653PIMREG
TgenePICALMchr10:21906136chr11:85670103ENST00000526033-1820221_294641646PIMREG
TgenePICALMchr10:21906136chr11:85670103ENST00000528398-1719221_294547552PIMREG
TgenePICALMchr10:21906136chr11:85670103ENST00000532317-1820221_294606611PIMREG


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MLLT10_PICALM


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MLLT10_PICALM


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMLLT10C0007134Renal Cell Carcinoma1CTD_human
HgeneMLLT10C0025202melanoma1CTD_human
HgeneMLLT10C0025286Meningioma1CTD_human
TgenePICALMC0002395Alzheimer's Disease2CTD_human