FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22054

FusionGeneSummary for MITF_ARL6IP5

check button Fusion gene summary
Fusion gene informationFusion gene name: MITF_ARL6IP5
Fusion gene ID: 22054
HgeneTgene
Gene symbol

MITF

ARL6IP5

Gene ID

4286

10550

Gene namemelanogenesis associated transcription factorADP ribosylation factor like GTPase 6 interacting protein 5
SynonymsCMM8|COMMAD|MI|WS2|WS2A|bHLHe32DERP11|GTRAP3-18|HSPC127|JWA|PRAF3|Yip6b|addicsin|hp22|jmx
Cytomap

3p13

3p14.1

Type of geneprotein-codingprotein-coding
Descriptionmicrophthalmia-associated transcription factorclass E basic helix-loop-helix protein 32microphtalmia-associated transcription factorPRA1 family protein 3ADP-ribosylation factor GTPase 6 interacting protein 5ADP-ribosylation factor-like 6 interacting protein 5ADP-ribosylation factor-like protein 6-interacting protein 5ADP-ribosylation-like factor 6 interacting protein 5ARL-6-inter
Modification date2018052720180519
UniProtAcc

O75030

O75915

Ensembl transtripts involved in fusion geneENST00000352241, ENST00000448226, 
ENST00000472437, ENST00000328528, 
ENST00000314589, ENST00000394355, 
ENST00000314557, ENST00000394351, 
ENST00000531774, ENST00000394348, 
ENST00000273258, ENST00000478935, 
Fusion gene scores* DoF score7 X 3 X 3=633 X 3 X 2=18
# samples 53
** MAII scorelog2(5/63*10)=-0.333423733725192
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MITF [Title/Abstract] AND ARL6IP5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMITF

GO:0010628

positive regulation of gene expression

22234890

HgeneMITF

GO:0045893

positive regulation of transcription, DNA-templated

9647758

HgeneMITF

GO:0045944

positive regulation of transcription by RNA polymerase II

20530484|21209915

HgeneMITF

GO:0065003

protein-containing complex assembly

20530484

HgeneMITF

GO:2000144

positive regulation of DNA-templated transcription, initiation

8995290|12204775

HgeneMITF

GO:2001141

regulation of RNA biosynthetic process

16411896

TgeneARL6IP5

GO:0008631

intrinsic apoptotic signaling pathway in response to oxidative stress

18387645


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-HC-8216-01AMITFchr3

69788852

+ARL6IP5chr3

69150990

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000352241ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
In-frameENST00000352241ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
In-frameENST00000448226ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
In-frameENST00000448226ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000472437ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000472437ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000328528ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000328528ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000314589ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000314589ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394355ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394355ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000314557ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000314557ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394351ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394351ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000531774ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000531774ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394348ENST00000273258MITFchr3

69788852

+ARL6IP5chr3

69150990

+
intron-3CDSENST00000394348ENST00000478935MITFchr3

69788852

+ARL6IP5chr3

69150990

+

Top

FusionProtFeatures for MITF_ARL6IP5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MITF

O75030

ARL6IP5

O75915

Regulates intracellular concentrations of taurine andglutamate. Negatively modulates SLC1A1/EAAC1 glutamate transportactivity by decreasing its affinity for glutamate in a PKCactivity-dependent manner. May be involved in membrane traffic.{ECO:0000250|UniProtKB:Q8R5J9, ECO:0000250|UniProtKB:Q9ES40}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+03103_11758189RegionRequired for homodimer formation and heterodimer formation with ARL6IP1
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+03136_18858189RegionTargeting to endoplasmic reticulum membrane
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+0378_9358189Topological domainCytoplasmic
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+03115_13558189TransmembraneHelical
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+0357_7758189TransmembraneHelical
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+0394_11458189TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMITFchr3:69788852chr3:69150990ENST00000314557+19355_402-46414Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000314589+110355_402-4505Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000328528+110355_402-11520Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000352241+110355_40234521Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000394351+19355_402-40420Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000394355+19355_4020496Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000448226+110355_40234527Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000472437+110355_402-63469Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000531774+19355_4020358Coiled coilOntology_term=ECO:0000305
HgeneMITFchr3:69788852chr3:69150990ENST00000314557+19311_364-46414DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000314589+110311_364-4505DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000328528+110311_364-11520DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000352241+110311_36434521DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000394351+19311_364-40420DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000394355+19311_3640496DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000448226+110311_36434527DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000472437+110311_364-63469DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000531774+19311_3640358DomainbHLH
HgeneMITFchr3:69788852chr3:69150990ENST00000314557+19224_295-46414RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000314557+19374_395-46414RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000314557+19401_431-46414RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000314589+110224_295-4505RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000314589+110374_395-4505RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000314589+110401_431-4505RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000328528+110224_295-11520RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000328528+110374_395-11520RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000328528+110401_431-11520RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000352241+110224_29534521RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000352241+110374_39534521RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000352241+110401_43134521RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000394351+19224_295-40420RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000394351+19374_395-40420RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000394351+19401_431-40420RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000394355+19224_2950496RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000394355+19374_3950496RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000394355+19401_4310496RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000448226+110224_29534527RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000448226+110374_39534527RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000448226+110401_43134527RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000472437+110224_295-63469RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000472437+110374_395-63469RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000472437+110401_431-63469RegionNote=DNA binding regulation
HgeneMITFchr3:69788852chr3:69150990ENST00000531774+19224_2950358RegionNote=Transactivation
HgeneMITFchr3:69788852chr3:69150990ENST00000531774+19374_3950358RegionLeucine-zipper
HgeneMITFchr3:69788852chr3:69150990ENST00000531774+19401_4310358RegionNote=DNA binding regulation
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+031_3558189Topological domainCytoplasmic
TgeneARL6IP5chr3:69788852chr3:69150990ENST00000273258+0336_5658189TransmembraneHelical


Top

FusionGeneSequence for MITF_ARL6IP5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_165aa
MQSESGIVPDFEVGEEFHEEPKTTYELKSQPLKSRFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASTFLIS

>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_65aa

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_165aa
MQSESGIVPDFEVGEEFHEEPKTTYELKSQPLKSRFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASTFLIS

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_65aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_495nt
ATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAA
CCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCC
CACAATAAAGACGTCCTTCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCC
ATGTTTGGAGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGACTTCGGAACCTC
AAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAA

>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_195nt
ATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAA
CCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACCCTCCTATTGTGTCTGAAGTTTCACGTGTGTTTATGAAATCTAATGGGAAATGGATC

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_495nt
ATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAA
CCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCC
CACAATAAAGACGTCCTTCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCC
ATGTTTGGAGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGACTTCGGAACCTC
AAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAA

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_195nt
ATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAA
CCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACCCTCCTATTGTGTCTGAAGTTTCACGTGTGTTTATGAAATCTAATGGGAAATGGATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_2088nt
GTAAACTCCCCGCGCTGGGGCGGGCGGCCGCGAGCCGGCGAGCGGGCAGAGCTCGGCACTGCGCCGGGGCGCACGGCTCGGGGGACCCAG
GCCCAGCTACCTTCCCTCCGCCCCCGGGCTCTGTTCTCACTTTCCAGCAGTGGAAGGACGGGAAGCGGGAGCCATGCAGTCCGAATCGGG
GATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGGTT
TCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCCCACAATAAAGACGTCCT
TCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCCATGTTTGGAGGAGTCAT
GGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGACTTCGGAACCTCAAGAACAAACTGGAGAA
TAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAAGGCATCAACAGACTCAC
TGACTATATCAGCAAAGTGAAGGAATAAACATAACTTACCTGAGCTAGGGTTGCAGCAGAAATTGAGTTGCAGCTTGCCCTTGTCCAGAC
CTATGTTCTGCTTGCGTTTTTGAAACAGGAGGTGCACGTACCACCCAATTATCTATGGCAGCATGCATGTATAGGCCGAACTATTATCAG
CTCTGATGTTTCAGAGAGAAGACCTCAGAAACCGAAAGAAAACCACCACCCTCCTATTGTGTCTGAAGTTTCACGTGTGTTTATGAAATC
TAATGGGAAATGGATCACACGATTTCTTTAAGGGAATTAAAAAAAATAAAAGAATTACGGCTTTTACAGCAACAATACGATTATCTTATA
GGAAAAAAAAAATCATTGTAAAGTATCAAGACAATACGAGTAAATGAAAAGGCTGTTAAAGTAGATGACATCATGTGTTAGCCTGTTCCT
AATCCCCTAGAATTGTAATGTGTGGGATATAAATTAGTTTTTATTATTCTCTTAAAAATCAAAGATGATCTCTATCACTTTGCCACCTGT
TTGATGTGCAGTGGAAACTGGTTAAGCCAGTTGTTCATACTTCCTTTACAAATATAAAGATAGCTGTTTAGGATATTTTGTTACATTTTT
GTAAATTTTTGAAATGCTAGTAATGTGTTTTCACCAGCAAGTATTTGTTGCAAACTTAATGTCATTTTCCTTAAGATGGTTACAGCTATG
TAACCTGTATTATTCTGGACGGACTTATTAAAATACAAACAGACAAAAAATAAAACAAAACTTGAGTTCTATTTACCTTGCACATTTTTT
GTTGTTACAGTGAAAAAAATGGTCCAAGAAAATGTTTGCCATTTTTGCATTGTTTCGTTTTTAACTGGAACATTTAGAAAGAAGGAAATG
AATGTGCATTTTATTAATTCCTTAGGGGCACAAGGAGGACAATAATAGCTGATCTTTTGAAATTTGAAAAACGTCTTTAGATGACCAAGC
AAAAAGACTTTAAAAAATGGTAATGAAAATGGAATGCAGCTACTGCAGCTAATAAAAAATTTTAGATAGCAATTGTTACAACCATATGCC
TTTATAGCTAGACATTAGAATTATGATAGCATGAGTTTATACATTCTATTATTTTTCCTCCCTTTCTCATGTTTTTATAAATAGGTAATA
AAAAATGTTTTGCCTGCCAATTGAATGATTTCGTAGCTGAAGTAGAAACATTTAGGTTTCTGTAGCATTAAATTGTGAAGACAACTGGAG
TGGTACTTACTGAAGAAACTCTCTGTATGTCCTAGAATAAGAAGCAATGATGTGCTGCTTCTGATTTTTCTTGCATTTTAAATTCTCAGC
CAACCTACAGCCATGATCTTTAGCACAGTGATATCACCATGACTTCACAGACATGGTCTAGAATCTGTACCCTTACCCACATATGAAGAA

>In-frame_MITF_ENST00000352241_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_1513nt
GTAAACTCCCCGCGCTGGGGCGGGCGGCCGCGAGCCGGCGAGCGGGCAGAGCTCGGCACTGCGCCGGGGCGCACGGCTCGGGGGACCCAG
GCCCAGCTACCTTCCCTCCGCCCCCGGGCTCTGTTCTCACTTTCCAGCAGTGGAAGGACGGGAAGCGGGAGCCATGCAGTCCGAATCGGG
GATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCATGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGGTT
TCTGAGTCCCTTCAACCCTCCTATTGTGTCTGAAGTTTCACGTGTGTTTATGAAATCTAATGGGAAATGGATCACACGATTTCTTTAAGG
GAATTAAAAAAAATAAAAGAATTACGGCTTTTACAGCAACAATACGATTATCTTATAGGAAAAAAAAAATCATTGTAAAGTATCAAGACA
ATACGAGTAAATGAAAAGGCTGTTAAAGTAGATGACATCATGTGTTAGCCTGTTCCTAATCCCCTAGAATTGTAATGTGTGGGATATAAA
TTAGTTTTTATTATTCTCTTAAAAATCAAAGATGATCTCTATCACTTTGCCACCTGTTTGATGTGCAGTGGAAACTGGTTAAGCCAGTTG
TTCATACTTCCTTTACAAATATAAAGATAGCTGTTTAGGATATTTTGTTACATTTTTGTAAATTTTTGAAATGCTAGTAATGTGTTTTCA
CCAGCAAGTATTTGTTGCAAACTTAATGTCATTTTCCTTAAGATGGTTACAGCTATGTAACCTGTATTATTCTGGACGGACTTATTAAAA
TACAAACAGACAAAAAATAAAACAAAACTTGAGTTCTATTTACCTTGCACATTTTTTGTTGTTACAGTGAAAAAAATGGTCCAAGAAAAT
GTTTGCCATTTTTGCATTGTTTCGTTTTTAACTGGAACATTTAGAAAGAAGGAAATGAATGTGCATTTTATTAATTCCTTAGGGGCACAA
GGAGGACAATAATAGCTGATCTTTTGAAATTTGAAAAACGTCTTTAGATGACCAAGCAAAAAGACTTTAAAAAATGGTAATGAAAATGGA
ATGCAGCTACTGCAGCTAATAAAAAATTTTAGATAGCAATTGTTACAACCATATGCCTTTATAGCTAGACATTAGAATTATGATAGCATG
AGTTTATACATTCTATTATTTTTCCTCCCTTTCTCATGTTTTTATAAATAGGTAATAAAAAATGTTTTGCCTGCCAATTGAATGATTTCG
TAGCTGAAGTAGAAACATTTAGGTTTCTGTAGCATTAAATTGTGAAGACAACTGGAGTGGTACTTACTGAAGAAACTCTCTGTATGTCCT
AGAATAAGAAGCAATGATGTGCTGCTTCTGATTTTTCTTGCATTTTAAATTCTCAGCCAACCTACAGCCATGATCTTTAGCACAGTGATA

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000273258_chr3_69150990_+_2052nt
GGCGAGCGGGCAGAGCTCGGCACTGCGCCGGGGCGCACGGCTCGGGGGACCCAGGCCCAGCTACCTTCCCTCCGCCCCCGGGCTCTGTTC
TCACTTTCCAGCAGTGGAAGGACGGGAAGCGGGAGCCATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCA
TGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGT
GGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCCCACAATAAAGACGTCCTTCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGT
TATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCCATGTTTGGAGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTT
GATGTTTATCCATGCATCGTTGAGACTTCGGAACCTCAAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGAT
GGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAAGGCATCAACAGACTCACTGACTATATCAGCAAAGTGAAGGAATAAACATAACT
TACCTGAGCTAGGGTTGCAGCAGAAATTGAGTTGCAGCTTGCCCTTGTCCAGACCTATGTTCTGCTTGCGTTTTTGAAACAGGAGGTGCA
CGTACCACCCAATTATCTATGGCAGCATGCATGTATAGGCCGAACTATTATCAGCTCTGATGTTTCAGAGAGAAGACCTCAGAAACCGAA
AGAAAACCACCACCCTCCTATTGTGTCTGAAGTTTCACGTGTGTTTATGAAATCTAATGGGAAATGGATCACACGATTTCTTTAAGGGAA
TTAAAAAAAATAAAAGAATTACGGCTTTTACAGCAACAATACGATTATCTTATAGGAAAAAAAAAATCATTGTAAAGTATCAAGACAATA
CGAGTAAATGAAAAGGCTGTTAAAGTAGATGACATCATGTGTTAGCCTGTTCCTAATCCCCTAGAATTGTAATGTGTGGGATATAAATTA
GTTTTTATTATTCTCTTAAAAATCAAAGATGATCTCTATCACTTTGCCACCTGTTTGATGTGCAGTGGAAACTGGTTAAGCCAGTTGTTC
ATACTTCCTTTACAAATATAAAGATAGCTGTTTAGGATATTTTGTTACATTTTTGTAAATTTTTGAAATGCTAGTAATGTGTTTTCACCA
GCAAGTATTTGTTGCAAACTTAATGTCATTTTCCTTAAGATGGTTACAGCTATGTAACCTGTATTATTCTGGACGGACTTATTAAAATAC
AAACAGACAAAAAATAAAACAAAACTTGAGTTCTATTTACCTTGCACATTTTTTGTTGTTACAGTGAAAAAAATGGTCCAAGAAAATGTT
TGCCATTTTTGCATTGTTTCGTTTTTAACTGGAACATTTAGAAAGAAGGAAATGAATGTGCATTTTATTAATTCCTTAGGGGCACAAGGA
GGACAATAATAGCTGATCTTTTGAAATTTGAAAAACGTCTTTAGATGACCAAGCAAAAAGACTTTAAAAAATGGTAATGAAAATGGAATG
CAGCTACTGCAGCTAATAAAAAATTTTAGATAGCAATTGTTACAACCATATGCCTTTATAGCTAGACATTAGAATTATGATAGCATGAGT
TTATACATTCTATTATTTTTCCTCCCTTTCTCATGTTTTTATAAATAGGTAATAAAAAATGTTTTGCCTGCCAATTGAATGATTTCGTAG
CTGAAGTAGAAACATTTAGGTTTCTGTAGCATTAAATTGTGAAGACAACTGGAGTGGTACTTACTGAAGAAACTCTCTGTATGTCCTAGA
ATAAGAAGCAATGATGTGCTGCTTCTGATTTTTCTTGCATTTTAAATTCTCAGCCAACCTACAGCCATGATCTTTAGCACAGTGATATCA

>In-frame_MITF_ENST00000448226_chr3_69788852_+_ARL6IP5_ENST00000478935_chr3_69150990_+_1477nt
GGCGAGCGGGCAGAGCTCGGCACTGCGCCGGGGCGCACGGCTCGGGGGACCCAGGCCCAGCTACCTTCCCTCCGCCCCCGGGCTCTGTTC
TCACTTTCCAGCAGTGGAAGGACGGGAAGCGGGAGCCATGCAGTCCGAATCGGGGATCGTGCCGGATTTCGAAGTCGGGGAGGAGTTTCA
TGAAGAGCCCAAAACCTATTACGAACTCAAAAGTCAACCGCTGAAGAGCAGGTTTCTGAGTCCCTTCAACCCTCCTATTGTGTCTGAAGT
TTCACGTGTGTTTATGAAATCTAATGGGAAATGGATCACACGATTTCTTTAAGGGAATTAAAAAAAATAAAAGAATTACGGCTTTTACAG
CAACAATACGATTATCTTATAGGAAAAAAAAAATCATTGTAAAGTATCAAGACAATACGAGTAAATGAAAAGGCTGTTAAAGTAGATGAC
ATCATGTGTTAGCCTGTTCCTAATCCCCTAGAATTGTAATGTGTGGGATATAAATTAGTTTTTATTATTCTCTTAAAAATCAAAGATGAT
CTCTATCACTTTGCCACCTGTTTGATGTGCAGTGGAAACTGGTTAAGCCAGTTGTTCATACTTCCTTTACAAATATAAAGATAGCTGTTT
AGGATATTTTGTTACATTTTTGTAAATTTTTGAAATGCTAGTAATGTGTTTTCACCAGCAAGTATTTGTTGCAAACTTAATGTCATTTTC
CTTAAGATGGTTACAGCTATGTAACCTGTATTATTCTGGACGGACTTATTAAAATACAAACAGACAAAAAATAAAACAAAACTTGAGTTC
TATTTACCTTGCACATTTTTTGTTGTTACAGTGAAAAAAATGGTCCAAGAAAATGTTTGCCATTTTTGCATTGTTTCGTTTTTAACTGGA
ACATTTAGAAAGAAGGAAATGAATGTGCATTTTATTAATTCCTTAGGGGCACAAGGAGGACAATAATAGCTGATCTTTTGAAATTTGAAA
AACGTCTTTAGATGACCAAGCAAAAAGACTTTAAAAAATGGTAATGAAAATGGAATGCAGCTACTGCAGCTAATAAAAAATTTTAGATAG
CAATTGTTACAACCATATGCCTTTATAGCTAGACATTAGAATTATGATAGCATGAGTTTATACATTCTATTATTTTTCCTCCCTTTCTCA
TGTTTTTATAAATAGGTAATAAAAAATGTTTTGCCTGCCAATTGAATGATTTCGTAGCTGAAGTAGAAACATTTAGGTTTCTGTAGCATT
AAATTGTGAAGACAACTGGAGTGGTACTTACTGAAGAAACTCTCTGTATGTCCTAGAATAAGAAGCAATGATGTGCTGCTTCTGATTTTT
CTTGCATTTTAAATTCTCAGCCAACCTACAGCCATGATCTTTAGCACAGTGATATCACCATGACTTCACAGACATGGTCTAGAATCTGTA


Top

FusionGenePPI for MITF_ARL6IP5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MITFLEF1, PIAS3, PATZ1, UBE2I, TFE3, FOS, SPI1, PAX6, TFEC, SUMO1, PIAS1, PIAS2, PSMD14, MARK3, CDK2, ELAVL1, HINT1, APP, EPAS1, STUB1, HK3, EBP, EP300, XPO1, TFEB, RBM6, KLHL20, TRIM25ARL6IP5ARL6, SLC1A1, XRCC1, RPL5, MAX, USP9X, PARP4, NOC4L, CLN8, VKORC1, UBL4A, ATP4A, RNF185, DERL1, DERL2, ESYT1, ICAM2, ATP1B3, NPDC1, LPAR6, P2RY12, TMEM185A, RTN4, HTR3E, EVI2A, FAM134C, HTR3C, TCTN2, TCTN3, SCLT1, TMEM216, GYPB, S1PR2, C5AR2, TACR1, TSPAN2, FPR2, SLC6A5, RTN1, SLC22A9, LPAR1, TSPAN11, UPK1A, TMEM128, VIPR1, SLC6A15, PPP2R1A, SDHA, KRAS, NOTCH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MITF_ARL6IP5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MITF_ARL6IP5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMITFC3152204MELANOMA, CUTANEOUS MALIGNANT, SUSCEPTIBILITY TO, 82CTD_human;ORPHANET;UNIPROT
HgeneMITFC0007134Renal Cell Carcinoma1CTD_human
HgeneMITFC0007621Neoplastic Cell Transformation1CTD_human
HgeneMITFC0011053Deafness1CTD_human
HgeneMITFC0025202melanoma1CTD_human;HPO
HgeneMITFC0078918Albinism, Oculocutaneous1CTD_human
HgeneMITFC0151779Cutaneous Melanoma1CTD_human
HgeneMITFC0391816Tietz syndrome1CTD_human;ORPHANET;UNIPROT
HgeneMITFC0549567Pigmentation Disorders1CTD_human
HgeneMITFC1860339WAARDENBURG SYNDROME, TYPE IIA1CTD_human;UNIPROT
HgeneMITFC2700265Waardenburg Syndrome Type 21CTD_human;ORPHANET
TgeneARL6IP5C0038356Stomach Neoplasms1CTD_human
TgeneARL6IP5C0038587Substance Withdrawal Syndrome1CTD_human