FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21969

FusionGeneSummary for MINK1_USO1

check button Fusion gene summary
Fusion gene informationFusion gene name: MINK1_USO1
Fusion gene ID: 21969
HgeneTgene
Gene symbol

MINK1

USO1

Gene ID

50488

8615

Gene namemisshapen like kinase 1USO1 vesicle transport factor
SynonymsB55|MAP4K6|MINK|YSK2|ZC3P115|TAP|VDP
Cytomap

17p13.2

4q21.1

Type of geneprotein-codingprotein-coding
Descriptionmisshapen-like kinase 1GCK family kinase MINKMAPK/ERK kinase kinase kinase 6MEK kinase kinase 6MEKKK 6misshapen/NIK-related kinasemitogen-activated protein kinase kinase kinase kinase 6general vesicular transport factor p115USO1 vesicle docking protein homologtranscytosis associated proteinvesicle docking protein p115
Modification date2018052320180523
UniProtAcc

Q8N4C8

O60763

Ensembl transtripts involved in fusion geneENST00000355280, ENST00000347992, 
ENST00000453408, 
ENST00000538159, 
ENST00000514213, 
Fusion gene scores* DoF score8 X 4 X 5=1604 X 4 X 3=48
# samples 95
** MAII scorelog2(9/160*10)=-0.830074998557688
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MINK1 [Title/Abstract] AND USO1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMINK1

GO:0046777

protein autophosphorylation

15469942


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-38-4632-01AMINK1chr17

4736935

+USO1chr4

76720775

+
TCGALDLUADTCGA-38-4632-01AMINK1chr17

4762623

+USO1chr4

76720775

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355280ENST00000538159MINK1chr17

4736935

+USO1chr4

76720775

+
In-frameENST00000355280ENST00000514213MINK1chr17

4736935

+USO1chr4

76720775

+
In-frameENST00000347992ENST00000538159MINK1chr17

4736935

+USO1chr4

76720775

+
In-frameENST00000347992ENST00000514213MINK1chr17

4736935

+USO1chr4

76720775

+
In-frameENST00000453408ENST00000538159MINK1chr17

4736935

+USO1chr4

76720775

+
In-frameENST00000453408ENST00000514213MINK1chr17

4736935

+USO1chr4

76720775

+
intron-3CDSENST00000355280ENST00000538159MINK1chr17

4762623

+USO1chr4

76720775

+
intron-3CDSENST00000355280ENST00000514213MINK1chr17

4762623

+USO1chr4

76720775

+
intron-3CDSENST00000347992ENST00000538159MINK1chr17

4762623

+USO1chr4

76720775

+
intron-3CDSENST00000347992ENST00000514213MINK1chr17

4762623

+USO1chr4

76720775

+
intron-3CDSENST00000453408ENST00000538159MINK1chr17

4762623

+USO1chr4

76720775

+
intron-3CDSENST00000453408ENST00000514213MINK1chr17

4762623

+USO1chr4

76720775

+

Top

FusionProtFeatures for MINK1_USO1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MINK1

Q8N4C8

USO1

O60763

Serine/threonine kinase which acts as a negativeregulator of Ras-related Rap2-mediated signal transduction tocontrol neuronal structure and AMPA receptor trafficking. Requiredfor normal synaptic density, dendrite complexity, as well assurface AMPA receptor expression in hippocampal neurons. Canactivate the JNK and MAPK14/p38 pathways and mediates stimulationof the stress-activated protein kinase MAPK14/p38 MAPK downstreamof the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation byRAP2A, MBP and SMAD1. Has an essential function in negativeselection of thymocytes, perhaps by coupling NCK1 to activation ofJNK1. Isoform 4 can activate the JNK pathway. Involved in theregulation of actin cytoskeleton reorganization, cell-matrixadhesion, cell-cell adhesion and cell migration. General vesicular transport factor required forintercisternal transport in the Golgi stack; it is required fortranscytotic fusion and/or subsequent binding of the vesicles tothe target membrane. May well act as a vesicular anchor byinteracting with the target membrane and holding the vesicular andtarget membranes in proximity. {ECO:0000250|UniProtKB:P41542}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMINK1chr17:4736935chr4:76720775ENST00000347992+132359_495191304Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000347992+132542_729191304Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000355280+132359_495191333Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000355280+132542_729191333Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000453408+132359_495191313Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000453408+132542_729191313Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr4:76720775ENST00000347992+1321019_1306191304DomainCNH
HgeneMINK1chr17:4736935chr4:76720775ENST00000347992+13225_289191304DomainProtein kinase
HgeneMINK1chr17:4736935chr4:76720775ENST00000355280+1321019_1306191333DomainCNH
HgeneMINK1chr17:4736935chr4:76720775ENST00000355280+13225_289191333DomainProtein kinase
HgeneMINK1chr17:4736935chr4:76720775ENST00000453408+1321019_1306191313DomainCNH
HgeneMINK1chr17:4736935chr4:76720775ENST00000453408+13225_289191313DomainProtein kinase
HgeneMINK1chr17:4736935chr4:76720775ENST00000347992+13231_39191304Nucleotide bindingATP
HgeneMINK1chr17:4736935chr4:76720775ENST00000355280+13231_39191333Nucleotide bindingATP
HgeneMINK1chr17:4736935chr4:76720775ENST00000453408+13231_39191313Nucleotide bindingATP


Top

FusionGeneSequence for MINK1_USO1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD

>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_498aa
MGDPAPARSLDDIDLSALRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNS
LESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTL
EQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRL
REEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLAD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1690nt
GGCTGGCTCCGGGGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTG
GAGTCCGCCCCCGGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCC
GTTCCCCACGGAGGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAAC
AAGAGTTGGATTATTAATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCC
ATTTCTTACAGGACAAATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTA
TTTCAATGATAACTCACTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAA
ACTAGGATTTATTAGCAAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGA
TCATGAGTTTACGAAGCTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGA
GGTGAAAAAAACATTAGAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAG
GCAGCAGGTTTCTACATTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCA
GTATAATCTTCTTAAAATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGA
AGAAATTGGTAGATTGCGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGAT
TGAAAATATGAAATCTTCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATT
AAAACAGGAACTGGCAACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACA
GAAAACAGAAGCGTTTGCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACT
GTCAGCATTATTACAAGAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTC
ATCTAATAGTACCATTGCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTT
GGTGCTCTTGGCCGATCAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACT

>In-frame_MINK1_ENST00000355280_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1690nt
GGCTGGCTCCGGGGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTG
GAGTCCGCCCCCGGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCC
GTTCCCCACGGAGGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAAC
AAGAGTTGGATTATTAATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCC
ATTTCTTACAGGACAAATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTA
TTTCAATGATAACTCACTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAA
ACTAGGATTTATTAGCAAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGA
TCATGAGTTTACGAAGCTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGA
GGTGAAAAAAACATTAGAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAG
GCAGCAGGTTTCTACATTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCA
GTATAATCTTCTTAAAATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGA
AGAAATTGGTAGATTGCGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGAT
TGAAAATATGAAATCTTCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATT
AAAACAGGAACTGGCAACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACA
GAAAACAGAAGCGTTTGCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACT
GTCAGCATTATTACAAGAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTC
ATCTAATAGTACCATTGCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTT
GGTGCTCTTGGCCGATCAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACT

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1678nt
GGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTGGAGTCCGCCCCC
GGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCCGTTCCCCACGGA
GGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATT
ATTAATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGG
ACAAATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAA
CTCACTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTAT
TAGCAAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTAC
GAAGCTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAAC
ATTAGAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTC
TACATTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCT
TAAAATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAG
ATTGCGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAA
ATCTTCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACT
GGCAACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGC
GTTTGCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATT
ACAAGAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTAC
CATTGCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGC
CGATCAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGA

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1678nt
GGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTGGAGTCCGCCCCC
GGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCCGTTCCCCACGGA
GGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATT
ATTAATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGG
ACAAATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAA
CTCACTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTAT
TAGCAAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTAC
GAAGCTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAAC
ATTAGAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTC
TACATTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCT
TAAAATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAG
ATTGCGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAA
ATCTTCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACT
GGCAACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGC
GTTTGCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATT
ACAAGAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTAC
CATTGCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGC
CGATCAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGA

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000538159_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_USO1_ENST00000514213_chr4_76720775_+_1494nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGGAAGCAAAATACAAACAAGAGTTGGATTATTA
ATGTTGCTTTGTACCTGGCTAAGCAATTGTCCCATTGCAGTAACGCATTTTCTTCACAATTCAGCCAATGTTCCATTTCTTACAGGACAA
ATTGCAGAAAATCTTGGAGAAGAAGAGCAGTTGGTCCAAGGCTTATGTGCCCTTTTGTTGGGCATTTCGATTTATTTCAATGATAACTCA
CTTGAGAGCTACATGAAAGAGAAGCTAAAACAACTGATTGAGAAGAGGATTGGCAAAGAGAATTTCATAGAGAAACTAGGATTTATTAGC
AAACATGAGTTGTATTCCAGAGCATCTCAGAAACCCCAGCCAAACTTTCCCAGTCCAGAATACATGATATTTGATCATGAGTTTACGAAG
CTGGTAAAAGAACTTGAAGGTGTTATAACTAAGGCTATTTATAAGTCCAGTGAAGAAGATAAAAAAGAAGAAGAGGTGAAAAAAACATTA
GAACAGCATGACAATATTGTGACTCACTACAAAAATATGATTCGAGAGCAGGATCTCCAACTTGAGGAATTAAGGCAGCAGGTTTCTACA
TTAAAATGTCAAAATGAACAGCTCCAGACGGCAGTCACACAGCAAGTATCACAGATCCAGCAGCACAAAGACCAGTATAATCTTCTTAAA
ATACAGCTAGGAAAAGACAATCAGCATCAAGGTTCTTACAGTGAGGGGGCTCAGATGAATGGCATTCAGCCAGAAGAAATTGGTAGATTG
CGAGAAGAGATAGAAGAATTAAAACGTAATCAGGAACTTTTACAAAGCCAGCTGACTGAAAAGGACTCTATGATTGAAAATATGAAATCT
TCCCAAACATCTGGCACAAATGAACAGTCTTCAGCAATAGTTTCAGCTAGAGATTCTGAACAAGTTGCAGAATTAAAACAGGAACTGGCA
ACTTTAAAGTCTCAGTTAAACTCACAATCTGTGGAGATCACCAAACTACAGACAGAAAAGCAGGAACTGTTACAGAAAACAGAAGCGTTT
GCAAAATCAGTTGAGGTACAAGGAGAGACCGAGACTATAATAGCCACCAAAACTACTGATGTAGAAGGAAGACTGTCAGCATTATTACAA
GAGACCAAAGAGTTAAAGAATGAAATTAAAGCTCTGTCTGAGGAAAGAACTGCCATTAAAGAGCAGCTGGATTCATCTAATAGTACCATT
GCCATTTTACAAACTGAGAAAGACAAACTAGAGTTGGAAATTACAGATTCTAAAAAAGAACAAGATGATCTCTTGGTGCTCTTGGCCGAT
CAAGATCAGAAAATACTGTCATTGAAGAATAAACTCAAGGATCTTGGTCATCCAGTTGAAGAAGAGGATGAACTTGAATCTGGAGACCAA


Top

FusionGenePPI for MINK1_USO1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MINK1NCK1, NEDD4L, HSP90AA1, MAP4K4, TEX264, NCK2, NOP2, ATM, CDH1, PTPRK, NANOS2, PPP1R15A, TSEN15, TRIM25USO1GABPB1, C1orf94, GAK, PTP4A3, GOSR1, GOSR2, BET1, YKT6, STX5, SEC22A, SCFD1, GOLGA2, GOLGB1, RAB1A, CASP3, NCOA2, TRAF3, TP53, MAPK3, USO1, VCL, USP28, XIAP, ZNF593, PDE4DIP, SEC16A, PRKACA, CCDC168, TRIP11, PRKAR2B, CEP68, FAM184A, HUWE1, AKAP9, DUSP12, XPO7, PHYKPL, MDM2, RNF114, EFNB2, SETD9, TXNDC11, ACTL6A, SCN2B, CYP1A1, POLE3, CTTN, DNAJA1, HSP90B1, KHDRBS1, NTRK1, CEP290, TMEM17, CLTC, GTSE1, FOXQ1, CDC5L, CDH1, SLCO1B1, DDX20, ZNF488, SNRNP27, SEMA4F, CPNE5, FGB, TSNAXIP1, PDHA1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MINK1_USO1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MINK1_USO1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneUSO1C0033578Prostatic Neoplasms1CTD_human
TgeneUSO1C0037274Dermatologic disorders1CTD_human
TgeneUSO1C0311375Arsenic Poisoning1CTD_human