FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21962

FusionGeneSummary for MINK1_ALOX12

check button Fusion gene summary
Fusion gene informationFusion gene name: MINK1_ALOX12
Fusion gene ID: 21962
HgeneTgene
Gene symbol

MINK1

ALOX12

Gene ID

50488

239

Gene namemisshapen like kinase 1arachidonate 12-lipoxygenase, 12S type
SynonymsB55|MAP4K6|MINK|YSK2|ZC312-LOX|12S-LOX|LOG12
Cytomap

17p13.2

17p13.1

Type of geneprotein-codingprotein-coding
Descriptionmisshapen-like kinase 1GCK family kinase MINKMAPK/ERK kinase kinase kinase 6MEK kinase kinase 6MEKKK 6misshapen/NIK-related kinasemitogen-activated protein kinase kinase kinase kinase 6arachidonate 12-lipoxygenase, 12S-type12S-lipoxygenaselipoxin synthase 12-LOplatelet 12-LOXplatelet-type 12-lipoxygenaseplatelet-type lipoxygenase 12
Modification date2018052320180522
UniProtAcc

Q8N4C8

P18054

Ensembl transtripts involved in fusion geneENST00000355280, ENST00000347992, 
ENST00000453408, 
ENST00000251535, 
Fusion gene scores* DoF score8 X 4 X 5=1602 X 2 X 2=8
# samples 92
** MAII scorelog2(9/160*10)=-0.830074998557688
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: MINK1 [Title/Abstract] AND ALOX12 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMINK1

GO:0046777

protein autophosphorylation

15469942

TgeneALOX12

GO:0019369

arachidonic acid metabolic process

1851637|8319693

TgeneALOX12

GO:0019372

lipoxygenase pathway

8319693

TgeneALOX12

GO:0043651

linoleic acid metabolic process

8319693

TgeneALOX12

GO:0043651

linoleic acid metabolic process

1851637

TgeneALOX12

GO:1901751

leukotriene A4 metabolic process

8250832

TgeneALOX12

GO:1901751

leukotriene A4 metabolic process

1851637

TgeneALOX12

GO:2001303

lipoxin A4 biosynthetic process

8250832

TgeneALOX12

GO:2001306

lipoxin B4 biosynthetic process

8250832


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-D6-A6EN-01AMINK1chr17

4736935

+ALOX12chr17

6903655

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355280ENST00000251535MINK1chr17

4736935

+ALOX12chr17

6903655

+
In-frameENST00000347992ENST00000251535MINK1chr17

4736935

+ALOX12chr17

6903655

+
In-frameENST00000453408ENST00000251535MINK1chr17

4736935

+ALOX12chr17

6903655

+

Top

FusionProtFeatures for MINK1_ALOX12


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MINK1

Q8N4C8

ALOX12

P18054

Serine/threonine kinase which acts as a negativeregulator of Ras-related Rap2-mediated signal transduction tocontrol neuronal structure and AMPA receptor trafficking. Requiredfor normal synaptic density, dendrite complexity, as well assurface AMPA receptor expression in hippocampal neurons. Canactivate the JNK and MAPK14/p38 pathways and mediates stimulationof the stress-activated protein kinase MAPK14/p38 MAPK downstreamof the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation byRAP2A, MBP and SMAD1. Has an essential function in negativeselection of thymocytes, perhaps by coupling NCK1 to activation ofJNK1. Isoform 4 can activate the JNK pathway. Involved in theregulation of actin cytoskeleton reorganization, cell-matrixadhesion, cell-cell adhesion and cell migration. Non-heme iron-containing dioxygenase that catalyzes thestereo-specific peroxidation of free and esterifiedpolyunsaturated fatty acids generating a spectrum of bioactivelipid mediators. Mainly converts arachidonic acid to (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE but can alsometabolize linoleic acid. Has a dual activity since it alsoconverts leukotriene A4/LTA4 into both the bioactive lipoxinA4/LXA4 and lipoxin B4/LXB4. Through the production of specificbioactive lipids like (12S)-HPETE it regulates differentbiological processes including platelet activation. It alsoprobably positively regulates angiogenesis through regulation ofthe expression of the vascular endothelial growth factor. Plays arole in apoptotic process, promoting the survival of vascularsmooth muscle cells for instance. May also play a role in thecontrol of cell migration and proliferation.{ECO:0000269|PubMed:16638750, ECO:0000269|PubMed:22237009,ECO:0000269|PubMed:23578768, ECO:0000269|PubMed:8250832,ECO:0000269|PubMed:9751607}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMINK1chr17:4736935chr17:6903655ENST00000347992+132359_495191304Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000347992+132542_729191304Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000355280+132359_495191333Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000355280+132542_729191333Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000453408+132359_495191313Compositional biasNote=Gln-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000453408+132542_729191313Compositional biasNote=Pro-rich
HgeneMINK1chr17:4736935chr17:6903655ENST00000347992+1321019_1306191304DomainCNH
HgeneMINK1chr17:4736935chr17:6903655ENST00000347992+13225_289191304DomainProtein kinase
HgeneMINK1chr17:4736935chr17:6903655ENST00000355280+1321019_1306191333DomainCNH
HgeneMINK1chr17:4736935chr17:6903655ENST00000355280+13225_289191333DomainProtein kinase
HgeneMINK1chr17:4736935chr17:6903655ENST00000453408+1321019_1306191313DomainCNH
HgeneMINK1chr17:4736935chr17:6903655ENST00000453408+13225_289191313DomainProtein kinase
HgeneMINK1chr17:4736935chr17:6903655ENST00000347992+13231_39191304Nucleotide bindingATP
HgeneMINK1chr17:4736935chr17:6903655ENST00000355280+13231_39191333Nucleotide bindingATP
HgeneMINK1chr17:4736935chr17:6903655ENST00000453408+13231_39191313Nucleotide bindingATP
TgeneALOX12chr17:4736935chr17:6903655ENST00000251535+514115_663269664DomainLipoxygenase
TgeneALOX12chr17:4736935chr17:6903655ENST00000251535+5142_114269664DomainPLAT


Top

FusionGeneSequence for MINK1_ALOX12


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_414aa
MGDPAPARSLDDIDLSALRNGSLFEADFILLDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAW
LLAKSWVRNSDFQLHEIQTHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLR
RAAAQLTYCSLCPPDDLADRGLLGLPGALTAHDALRLWEIIARTVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQ
SQSQLCHFLTMCVFTCTAQHAAINQGQLDWTAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHH

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_414aa
MGDPAPARSLDDIDLSALRNGSLFEADFILLDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAW
LLAKSWVRNSDFQLHEIQTHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLR
RAAAQLTYCSLCPPDDLADRGLLGLPGALTAHDALRLWEIIARTVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQ
SQSQLCHFLTMCVFTCTAQHAAINQGQLDWTAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHH

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_414aa
MGDPAPARSLDDIDLSALRNGSLFEADFILLDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAW
LLAKSWVRNSDFQLHEIQTHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLR
RAAAQLTYCSLCPPDDLADRGLLGLPGALTAHDALRLWEIIARTVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQ
SQSQLCHFLTMCVFTCTAQHAAINQGQLDWTAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1242nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGAAGCTGACTTCATCCTT
CTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGGGAAG
CTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGCCTGG
CTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCACCTGGTGGCTGAGGTC
ATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTACACCATGGAAATCAAC
ACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCTCCGT
CGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCTCTAT
GCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGTGAAG
GGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTTCCAG
TCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAGCTGGACTGG
TATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCA
CTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGTGCCTCTGGGGCACCAC
AAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTACAGCC

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1242nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGAAGCTGACTTCATCCTT
CTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGGGAAG
CTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGCCTGG
CTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCACCTGGTGGCTGAGGTC
ATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTACACCATGGAAATCAAC
ACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCTCCGT
CGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCTCTAT
GCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGTGAAG
GGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTTCCAG
TCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAGCTGGACTGG
TATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCA
CTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGTGCCTCTGGGGCACCAC
AAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTACAGCC

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1242nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGAAGCTGACTTCATCCTT
CTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGGGAAG
CTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGCCTGG
CTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCACCTGGTGGCTGAGGTC
ATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTACACCATGGAAATCAAC
ACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCTCCGT
CGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCTCTAT
GCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGTGAAG
GGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTTCCAG
TCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAGCTGGACTGG
TATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCA
CTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGTGCCTCTGGGGCACCAC
AAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTACAGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MINK1_ENST00000355280_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1751nt
GGCTGGCTCCGGGGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTG
GAGTCCGCCCCCGGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCC
GTTCCCCACGGAGGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGA
AGCTGACTTCATCCTTCTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGAT
GGAGCCCAATGGGAAGCTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGA
CCCCCCACTTGCCTGGCTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCA
CCTGGTGGCTGAGGTCATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTA
CACCATGGAAATCAACACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCA
TGTACAGTTGCTCCGTCGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACT
CCCAGGTGCTCTCTATGCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAG
GGATGACATAGTGAAGGGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTT
CCCTGTCTCCTTCCAGTCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCA
GGGCCAGCTGGACTGGTATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGC
CACAGTGATGGGGTCACTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGT
GCCTCTGGGGCACCACAAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGA
AAAGGAGATTACAGCCCGGAATGAGCAACTTGACTGGCCCTATGAATATCTGAAGCCCAGCTGCATAGAGAACAGTGTCACCATCTGAGC
CCTAGAGTGACTCTACCTGCAAGATTTCACATCAGCTTTAGGACTGACATTTCTATCTTGAATTTCATGCTTTCCTAAAGTCTCTGCTGC
TAAGGCTCTATTTCCTCCCCCAGTTAAACCCCCTACATTAGTATCCCACTAGCCCAGGGGAGCAGTAAACTTTCTCTGCAAAGACTAGAT
CCTTTTTTACGCTTTGCAGACCGCATAGTCACTGTCTCAACTACTCAGCTCTCCTGCTGCAGCATGAAGGCAGCCACAGACAACATGGAA

>In-frame_MINK1_ENST00000347992_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1739nt
GGAGATAGCGCCTGTCAGTCGGTGGGTCGGTCCTCGCGCCGGCCCTCCCCCTCCCCGGTCTCCGGGGGAGGCGCGGTGGAGTCCGCCCCC
GGGGTTCTCCGATGGGGGAGAAGCGGCGACGGCGGCAGTGGAGTAACCGAGCCGGAGCGTGAGCGGCCCCGGTGCCCCGTTCCCCACGGA
GGCCATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGAAGCTGACTTCAT
CCTTCTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGG
GAAGCTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGC
CTGGCTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCACCTGGTGGCTGA
GGTCATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTACACCATGGAAAT
CAACACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCT
CCGTCGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCT
CTATGCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGT
GAAGGGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTT
CCAGTCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAGCTGGA
CTGGTATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGG
GTCACTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGTGCCTCTGGGGCA
CCACAAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTAC
AGCCCGGAATGAGCAACTTGACTGGCCCTATGAATATCTGAAGCCCAGCTGCATAGAGAACAGTGTCACCATCTGAGCCCTAGAGTGACT
CTACCTGCAAGATTTCACATCAGCTTTAGGACTGACATTTCTATCTTGAATTTCATGCTTTCCTAAAGTCTCTGCTGCTAAGGCTCTATT
TCCTCCCCCAGTTAAACCCCCTACATTAGTATCCCACTAGCCCAGGGGAGCAGTAAACTTTCTCTGCAAAGACTAGATCCTTTTTTACGC
TTTGCAGACCGCATAGTCACTGTCTCAACTACTCAGCTCTCCTGCTGCAGCATGAAGGCAGCCACAGACAACATGGAAATGAGTGTGACT

>In-frame_MINK1_ENST00000453408_chr17_4736935_+_ALOX12_ENST00000251535_chr17_6903655_+_1555nt
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGAATGGTTCCCTGTTTGAAGCTGACTTCATCCTT
CTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGGGAAG
CTGCAGCCCATGGTCATCCAGATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGCCTGG
CTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCACTTGCTGAACACTCACCTGGTGGCTGAGGTC
ATCGCTGTCGCCACCATGCGGTGCCTCCCAGGACTGCACCCCATCTTCAAGTTCCTGATCCCCCATATCCGCTACACCATGGAAATCAAC
ACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCTCCGT
CGGGCGGCAGCTCAGCTGACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCTCTAT
GCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGTGAAG
GGGGACCCTGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTTCCAG
TCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAGCTGGACTGG
TATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCA
CTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATGGTGCCTCTGGGGCACCAC
AAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTACAGCC
CGGAATGAGCAACTTGACTGGCCCTATGAATATCTGAAGCCCAGCTGCATAGAGAACAGTGTCACCATCTGAGCCCTAGAGTGACTCTAC
CTGCAAGATTTCACATCAGCTTTAGGACTGACATTTCTATCTTGAATTTCATGCTTTCCTAAAGTCTCTGCTGCTAAGGCTCTATTTCCT
CCCCCAGTTAAACCCCCTACATTAGTATCCCACTAGCCCAGGGGAGCAGTAAACTTTCTCTGCAAAGACTAGATCCTTTTTTACGCTTTG
CAGACCGCATAGTCACTGTCTCAACTACTCAGCTCTCCTGCTGCAGCATGAAGGCAGCCACAGACAACATGGAAATGAGTGTGACTATGT


Top

FusionGenePPI for MINK1_ALOX12


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MINK1NCK1, NEDD4L, HSP90AA1, MAP4K4, TEX264, NCK2, NOP2, ATM, CDH1, PTPRK, NANOS2, PPP1R15A, TSEN15, TRIM25ALOX12LMNA, ITGB4, TRIB1, KRT5, ALOX12, ACTA2, PLA2G4A, PLA2G2A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MINK1_ALOX12


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MINK1_ALOX12


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneALOX12C0005586Bipolar Disorder1PSYGENET
TgeneALOX12C0020429Hyperalgesia1CTD_human
TgeneALOX12C0031117Peripheral Neuropathy1CTD_human
TgeneALOX12C0036341Schizophrenia1PSYGENET
TgeneALOX12C0037274Dermatologic disorders1CTD_human
TgeneALOX12C3495559Juvenile arthritis1CTD_human