FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21923

FusionGeneSummary for MICU3_TGFBR3

check button Fusion gene summary
Fusion gene informationFusion gene name: MICU3_TGFBR3
Fusion gene ID: 21923
HgeneTgene
Gene symbol

MICU3

TGFBR3

Gene ID

286097

7049

Gene namemitochondrial calcium uptake family member 3transforming growth factor beta receptor 3
SynonymsEFHA2BGCAN|betaglycan
Cytomap

8p22

1p22.1

Type of geneprotein-codingprotein-coding
Descriptioncalcium uptake protein 3, mitochondrialEF hand domain family A2EF-hand domain family, member A2EF-hand domain-containing family member A2mitochondrial uptake family, member 3transforming growth factor beta receptor type 3TGF-beta receptor type 3TGF-beta receptor type IIITGFR-3betaglycan proteoglycantransforming growth factor beta receptor III
Modification date2018051920180519
UniProtAcc

Q86XE3

Q03167

Ensembl transtripts involved in fusion geneENST00000318063, ENST00000519866, 
ENST00000212355, ENST00000370399, 
ENST00000525962, ENST00000468996, 
Fusion gene scores* DoF score1 X 1 X 1=16 X 6 X 6=216
# samples 16
** MAII scorelog2(1/1*10)=3.32192809488736log2(6/216*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MICU3 [Title/Abstract] AND TGFBR3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTGFBR3

GO:0001837

epithelial to mesenchymal transition

18184661

TgeneTGFBR3

GO:0007179

transforming growth factor beta receptor signaling pathway

12958365

TgeneTGFBR3

GO:0030509

BMP signaling pathway

18184661

TgeneTGFBR3

GO:0032354

response to follicle-stimulating hormone

14557487

TgeneTGFBR3

GO:0034695

response to prostaglandin E

14557487

TgeneTGFBR3

GO:0034699

response to luteinizing hormone

14557487

TgeneTGFBR3

GO:0051271

negative regulation of cellular component movement

17999987

TgeneTGFBR3

GO:0060317

cardiac epithelial to mesenchymal transition

18184661


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-EE-A29L-06AMICU3chr8

16885169

+TGFBR3chr1

92200516

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000318063ENST00000212355MICU3chr8

16885169

+TGFBR3chr1

92200516

-
In-frameENST00000318063ENST00000370399MICU3chr8

16885169

+TGFBR3chr1

92200516

-
In-frameENST00000318063ENST00000525962MICU3chr8

16885169

+TGFBR3chr1

92200516

-
5CDS-5UTRENST00000318063ENST00000468996MICU3chr8

16885169

+TGFBR3chr1

92200516

-
intron-3CDSENST00000519866ENST00000212355MICU3chr8

16885169

+TGFBR3chr1

92200516

-
intron-3CDSENST00000519866ENST00000370399MICU3chr8

16885169

+TGFBR3chr1

92200516

-
intron-3CDSENST00000519866ENST00000525962MICU3chr8

16885169

+TGFBR3chr1

92200516

-
intron-5UTRENST00000519866ENST00000468996MICU3chr8

16885169

+TGFBR3chr1

92200516

-

Top

FusionProtFeatures for MICU3_TGFBR3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MICU3

Q86XE3

TGFBR3

Q03167

May play a role in mitochondrial calcium uptake.{ECO:0000250}. Binds to TGF-beta. Could be involved in capturing andretaining TGF-beta for presentation to the signaling receptors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+11559_631271175Compositional biasNote=Poly-Arg
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+11570_731271175Compositional biasNote=Poly-Ala
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+11567_831271175TransmembraneHelical
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000212355-317455_730128852DomainZP
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000370399-418455_730128851DomainZP
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000525962-216455_730128852DomainZP
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000212355-317810_851128852Topological domainCytoplasmic
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000370399-418810_851128851Topological domainCytoplasmic
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000525962-216810_851128852Topological domainCytoplasmic
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000212355-317788_809128852TransmembraneHelical
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000370399-418788_809128851TransmembraneHelical
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000525962-216788_809128852TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+115245_2561271175Calcium binding1
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+115483_4941271175Calcium binding2
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+115232_2671271175DomainEF-hand 1
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+115401_4361271175DomainEF-hand 2
HgeneMICU3chr8:16885169chr1:92200516ENST00000318063+115470_5051271175DomainEF-hand 3
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000212355-31721_787128852Topological domainExtracellular
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000370399-41821_787128851Topological domainExtracellular
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000525962-21621_787128852Topological domainExtracellular


Top

FusionGeneSequence for MICU3_TGFBR3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000212355_chr1_92200516_-_851aa
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQLYGDPR
AGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKETGAVTSFTELKIAR
NITIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLIL
ILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGTSPITSYTMAPVANRFHLRLENNAEE
MGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIA
LSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYTNSIVIQVPALGDSSGWPDGTE
DLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVTVEVSVTKAEQE
LGFAIQTCFISPTSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLP
KCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYITSH

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000370399_chr1_92200516_-_850aa
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQLYGDPR
AGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKETGAVTSFTELKIAR
NITIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLIL
ILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGTSPITSYTMAPVANRFHLRLENNEEM
GDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIAL
SVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYTNSIVIQVPALGDSSGWPDGTED
LESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVTVEVSVTKAEQEL
GFAIQTCFISPTSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPK
CVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYITSHT

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000525962_chr1_92200516_-_851aa
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQLYGDPR
AGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKETGAVTSFTELKIAR
NITIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLIL
ILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGTSPITSYTMAPVANRFHLRLENNAEE
MGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIA
LSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYTNSIVIQVPALGDSSGWPDGTE
DLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVTVEVSVTKAEQE
LGFAIQTCFISPTSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLP
KCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYITSH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000212355_chr1_92200516_-_2553nt
ATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCTCCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGG
CCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGAGAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGG
CGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGGCTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGG
GCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAGCCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCA
GTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTTTCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGG
AACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAGTATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGA
AACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGCAACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAG
TACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCCCAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAAC
TCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGACCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTG
ATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGATGTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGC
TTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCT
TTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAG
ATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATC
CGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTC
CCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCC
CTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACC
CTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGG
TCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAA
GATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAAT
TGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGAC
CTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAA
CTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCT
AAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTC
TTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCT
AAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCC
CTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGT
CTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCAC
ACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAG

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000370399_chr1_92200516_-_2550nt
ATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCTCCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGG
CCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGAGAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGG
CGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGGCTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGG
GCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAGCCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCA
GTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTTTCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGG
AACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAGTATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGA
AACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGCAACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAG
TACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCCCAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAAC
TCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGACCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTG
ATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGATGTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGC
TTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCT
TTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGAGGAGATG
GGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGG
GGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCT
CGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTG
TCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTG
TTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCA
GCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGAT
CTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGC
AGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTC
TTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTG
GGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAA
GATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTC
AAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAG
TGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTT
GCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTG
GACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACA
GGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGC

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000525962_chr1_92200516_-_2553nt
ATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCTCCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGG
CCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGAGAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGG
CGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGGCTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGG
GCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAGCCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCA
GTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTTTCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGG
AACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAGTATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGA
AACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGCAACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAG
TACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCCCAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAAC
TCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGACCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTG
ATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGATGTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGC
TTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCT
TTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAG
ATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATC
CGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTC
CCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCC
CTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACC
CTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGG
TCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAA
GATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAAT
TGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGAC
CTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAA
CTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCT
AAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTC
TTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCT
AAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCC
CTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGT
CTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCAC
ACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000212355_chr1_92200516_-_5989nt
GTTCTCTGCCCCCTCCCAGCTCTGGTGTGGGCGGCCTCCGCTATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCT
CCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGGCCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGA
GAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGGCGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGG
CTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGGGCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAG
CCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCAGTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTT
TCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGGAACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAG
TATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGAAACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGC
AACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAGTACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCC
CAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAACTCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGA
CCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTGATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGAT
GTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGA
GATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTG
GCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTG
CTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGAT
ATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGT
CTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAA
GATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTT
TTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTT
CCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGA
GATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCC
CACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGA
CACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCT
GATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCT
ATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTG
ACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATA
ATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGC
ATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATC
GGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCC
TCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAA
CCCGGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTG
GATTTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGA
CCCTGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCA
ATGTGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGG
AGTTGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGA
AATGCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGG
GTCTGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAA
ACCAATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTT
ACAGGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAAT
TTGAGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCAC
CTGGCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGT
GAGTGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAAT
CCTGTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCC
TTACTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCA
CTTTGCAGCTAAAATAAGCTCAGTGATACCTCCTTGTTAAAAAAAAAAAAAAAAAAAAAGAATGCCAGGGGGGAATTATCATGCTAAATT
ATTTTACTGCTGAAGATAGCTTCATTGCAAATTATTCTTTTTCCAGAATTTCCCCCAAACAACTTAGAATTCCATAAGTAGAACAAGATA
GATTCTACCCCCAAAATATTCATAAGCAAATCCCACTGCCCTTAAAATAAGGAAGTTATGCCTGGTTGTCTGTGAATGGAACCTCAGTAG
GTAATCCTGATGAAGCTTAAAACCTTAGGGCAGTGTCTACATGGGAAACAAGTATGTGGAAATTGACAATCATTTTTACCAAATCGTTGA
GTAATAATATGACTTACCTGATAGATATACACATTCAATAAGGAACATTTTTTTTTTTCAATAAGGAACATTTTAACTAAAACATTACTT
TAGGGCTGAGATTTCCAGGCTATCTACATTGATCTACTGAAAAATTTCTAGATTTCCATATACAAACGAAGAAGACATGAGTTTAGAGAA
TTTTTTTCCTTTAATTTTTTTTTAACAGAAGGGTATCAGAGTGGAGGACCTAGATTACGCTACCTGTGTTTGAAAATATTGCGCTTTGCC
TAACCTTCGGTGGAATGTATTGTTTCAGCATATTCTATGTATAAAAAAGTTTAAAGATGTCTTCAAAGAAGACTAGAGTCTTTAAGTCAC
TTATAGCTATATTTTACTACAAAATTTGTGTATAAAGATATATTTAAGTGTTTTAGATAAATTTAAGTTACTCCATATGAAATGTTTAAT
TTCAGCTACTGTGAATTCTTTCGATCAGTCCTTTGCTTTTTTAAAAAATCTTTTCCATCGTGTTAAAAAGAAAATTAGCTATTAGGAGAT
ATTAAAAGATTGATGTCTTAGAAGGACAGGGTTAAAACCTTCTGTAATATATTTAAATATATATTTTTAAGAGAGATGCTACATTGCCAA
TGATTTTATAAATAATTTAAAATTAATTTACAAATTTATAGATGCAAACCAAAAGATCTTTTTAAAAGAGAGAGAGAGGAAAAAAATCAC
CTTTTATTTGTTTGGGTCTCATTGTCAGAATTATTATTCAGATCAAGAAATCTGTGTCGATAAAACCTAATCTCATATTGGAGAGTGAAT
GTCGTTAAGTATTTCTGAAATGTTTCTAAAAAATGAACATGAAAAAAATAAGGTATTTTCTCCCTAGCTTCTCATTACAGTATTTCTAAT
TGCTTCACACTTTACAGTTTTAATACAAAGTACAAGCTCTACTTTTATAACGTGTACTACAAGTTTCTTTAAAAGTATTGTTGTATTTCA
GCTGAACTCTTGTATCTGCAGTCTTTTGTTATTTCTGCAGGCTACACCCTTAATTTGCAGAGGCCATTTTGTTGTTTGTTTGATGCTGAA
GCTGTTGTTAAAATGCCCCAAACTCCAAGGCAGATTGTCTGTATAATACGCTATAGCTTTTCACCATGTGGTGTTTACCAGCTGTTACTC
TGTATTTTAAAAAGCCAGAGATTTCTTCTGTCTAAACTGTTTCTATAGCATTTTCTAAACAAAAAAAATGGTTTTTTTCTTTGCCTTGTA
ATAAGATTGTAAATCCATTTCCTGCTTGTGTTCTTAGTGGGCATGATTGTGAGTGTGTGTGGGGTGCTCACACGCGTGCCAGTCTTTTTG
TACTGTAACTACCTCATGGTTTGAATGATGATTGTACTGCTGGTTGTGTTAACAGAGCACATTTTGTTGGGTGAGTCCTATGTGATTTTT
TTCATGTTTGTTTTATCTGGGGGTTGTTCATGAAACTGACAGATGTTTTTCTAAAAAGGACTATTATCAGTTTCCAAATACAATACTTCT
CTCTTCTGGTTTTTCCTGAATGAGCCTGATTTTGTTGCTGGTTTTCATCATCTATGAGGGTAAAACGAGTACCCTTAAAATCCCTGTGGC
CAGTTTGAACACCCCTGTTGTATTCTTTTCTCTGTTCAGTGTGTCAGCTATTTTGTGAAGATGCTTAGATGTATAGTTTTGATAACCACA

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000370399_chr1_92200516_-_3905nt
GTTCTCTGCCCCCTCCCAGCTCTGGTGTGGGCGGCCTCCGCTATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCT
CCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGGCCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGA
GAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGGCGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGG
CTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGGGCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAG
CCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCAGTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTT
TCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGGAACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAG
TATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGAAACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGC
AACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAGTACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCC
CAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAACTCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGA
CCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTGATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGAT
GTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGA
GATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTG
GCTAATAGATTTCATCTTCGGCTTGAAAATAATGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTG
GACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATT
TCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTC
AGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGAT
TCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTG
GAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCA
GCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGAT
GCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCAC
GGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACAC
GTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGAT
AGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATC
CCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACG
CTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATC
TGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATG
AAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGA
GCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCG
GAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCC
GGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGAT
TTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCC
TGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATG
TGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGT
TGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAAT
GCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTC
TGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACC
AATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACA
GGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTG
AGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTG
GCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAG
TGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCT
GTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTA
CTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTT

>In-frame_MICU3_ENST00000318063_chr8_16885169_+_TGFBR3_ENST00000525962_chr1_92200516_-_3904nt
GTTCTCTGCCCCCTCCCAGCTCTGGTGTGGGCGGCCTCCGCTATGGCTGCGCTGCGAAGGCTCTTGTGGCCGCCACCCCGGGTGTCTCCT
CCACTCTGCGCTCACCAGCCCCTCCTTGGGCCGTGGGGGCGGCCTGCGGTGACCACCCTGGGCCTTCCTGGCCGGCCCTTCTCCTCCCGA
GAGGATGAGGAGAGGGCTGTGGCGGAGGCGGCATGGAGGCGGCGGCGGCGCTGGGGGGAGCTGAGCGTGGCGGCGGCGGCCGGCGGGGGG
CTGGTCGGCCTGGTATGCTACCAGCTGTACGGGGACCCCAGGGCCGGCTCGCCGGCGACCGGGCGACCCTCAAAGAGCGCGGCCACGGAG
CCCGAGGACCCGCCCCGCGGCCGGGGGATGCTGCCCATCCCAGTGGCGGCTGCCAAGGAGACGGTGTCTGAGGGTTCTGTGGTCCAGTTT
TCATCAGCAAACTTCTCCTTGACAGCAGAAACAGAAGAAAGGAACTTCCCCCATGGAAATGAACATCTGTTAAATTGGGCCCGAAAAGAG
TATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGAAACATTTATATTAAAGTGGGGGAAGATCAAGTGTTCCCTCCAAAGTGC
AACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCTGAGTACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCC
CAGAATGAGGAAGTACACATCATCGAGCTAATCACCCCCAACTCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAGA
CCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTGATCTTGAAGTGCAAAAAGTCTGTCAACTGGGTGATCAAATCTTTTGAT
GTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGA
GATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTG
GCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTG
CTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGAT
ATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGT
CTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAA
GATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTT
TTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTT
CCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGA
GATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCC
CACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGA
CACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCT
GATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCT
ATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTG
ACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATA
ATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGC
ATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATC
GGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCC
TCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAA
CCCGGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTG
GATTTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGA
CCCTGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCA
ATGTGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGG
AGTTGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGA
AATGCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGG
GTCTGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAA
ACCAATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTT
ACAGGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAAT
TTGAGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCAC
CTGGCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGT
GAGTGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAAT
CCTGTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCC
TTACTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCA


Top

FusionGenePPI for MICU3_TGFBR3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MICU3CLK1, THUMPD3, MICU1, CYLDTGFBR3TGFBR2, TGFB1, ELAVL1, NRP1, KLK11, ITM2B, ATP1B3, FGF1, GPR183, ATP1B4, PTCH1, SIAE, PIP5K1A, CAMKV, DEFA5, ST8SIA4, FAM19A4, DKKL1, CANT1, DEFA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000212355-317737_751128852TGF-beta ligand
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000370399-418737_751128851TGF-beta ligand
TgeneTGFBR3chr8:16885169chr1:92200516ENST00000525962-216737_751128852TGF-beta ligand


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MICU3_TGFBR3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MICU3_TGFBR3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource