FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21870

FusionGeneSummary for MIB1_SNRPD1

check button Fusion gene summary
Fusion gene informationFusion gene name: MIB1_SNRPD1
Fusion gene ID: 21870
HgeneTgene
Gene symbol

MIB1

SNRPD1

Gene ID

57534

6633

Gene namemindbomb E3 ubiquitin protein ligase 1small nuclear ribonucleoprotein D2 polypeptide
SynonymsDIP-1|DIP1|LVNC7|MIB|ZZANK2|ZZZ6SMD2|SNRPD1|Sm-D2
Cytomap

18q11.2

19q13.32

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase MIB1DAPK-interacting protein 1RING-type E3 ubiquitin transferase MIB1ubiquitin ligase mind bombzinc finger ZZ type with ankyrin repeat domain protein 2small nuclear ribonucleoprotein Sm D2small nuclear ribonucleoprotein D2 polypeptide 16.5kDasnRNP core protein D2
Modification date2018052320180523
UniProtAcc

Q86YT6

P62314

Ensembl transtripts involved in fusion geneENST00000578646, ENST00000261537, 
ENST00000300413, ENST00000579618, 
ENST00000582475, 
Fusion gene scores* DoF score8 X 8 X 7=4484 X 3 X 4=48
# samples 104
** MAII scorelog2(10/448*10)=-2.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MIB1 [Title/Abstract] AND SNRPD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSNRPD1

GO:0000387

spliceosomal snRNP assembly

18984161


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-44-4112-01AMIB1chr18

19359646

+SNRPD1chr18

19202686

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000578646ENST00000300413MIB1chr18

19359646

+SNRPD1chr18

19202686

+
3UTR-3CDSENST00000578646ENST00000579618MIB1chr18

19359646

+SNRPD1chr18

19202686

+
3UTR-intronENST00000578646ENST00000582475MIB1chr18

19359646

+SNRPD1chr18

19202686

+
In-frameENST00000261537ENST00000300413MIB1chr18

19359646

+SNRPD1chr18

19202686

+
In-frameENST00000261537ENST00000579618MIB1chr18

19359646

+SNRPD1chr18

19202686

+
5CDS-intronENST00000261537ENST00000582475MIB1chr18

19359646

+SNRPD1chr18

19202686

+

Top

FusionProtFeatures for MIB1_SNRPD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MIB1

Q86YT6

SNRPD1

P62314

Core component of the spliceosomal U1, U2, U4 and U5small nuclear ribonucleoproteins (snRNPs), the building blocks ofthe spliceosome. Thereby, plays an important role in the splicingof cellular pre-mRNAs. Most spliceosomal snRNPs contain a commonset of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF andSNRPG that assemble in a heptameric protein ring on the Sm site ofthe small nuclear RNA to form the core snRNP. May act as a chargedprotein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts withRNA. {ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:23333303}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MIB1_SNRPD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000300413_chr18_19202686_+_418aa
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQ
QPIIGIRWKCAECTNTDLCTVCTHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAATVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGG
WTDGMFETLTTTGTVCGIDEDHDIVVQTPSGNRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRG

>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000579618_chr18_19202686_+_343aa
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQ
QPIIGIRWKCAECTNTDLCTVCTHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAATVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000300413_chr18_19202686_+_1254nt
ATGAGTAACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGAC
GGCGGCGAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTAC
CGCTGCTCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAG
CAACCAATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTA
AGACATCGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGA
ATCTTTGCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAA
ATCCAGGACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAG
GGCATGTCTGATCTGAAATGTGTCCAGGATGCCAAGGGAGGTTCTTTCTACAGAGATCACTGCCCTGTGCTAGGTGAGCAGAATGGCAAC
AGGAATCCTGGTGGATTGCAGATTGGTGACCTGGTAAATATAGATCTCGACCTCGAAATTGTACAGTCTTTGCAGCATGGTCATGGAGGA
TGGACTGATGGAATGTTTGAGACTTTAACTACAACTGGAACTGTTTGTGGCATTGATGAAGATCATGACATTGTAGTACAGTATCCAAGT
GGCAATAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAACGGAACACAGGTCCATGGAACAATCACAGGTGTG
GATGTCAGCATGAATACACATCTTAAAGCTGTGAAAATGACCCTGAAGAACAGAGAACCTGTACAGCTGGAAACGCTGAGTATTCGAGGA
AATAACATTCGGTATTTTATTCTACCAGACAGTTTACCTCTGGATACACTACTTGTGGATGTTGAACCTAAGGTGAAATCTAAGAAAAGG

>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000579618_chr18_19202686_+_1029nt
ATGAGTAACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGAC
GGCGGCGAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTAC
CGCTGCTCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAG
CAACCAATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTA
AGACATCGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGA
ATCTTTGCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAA
ATCCAGGACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAG
GGCATGTCTGATCTGAAATGTGTCCAGGATGCCAAGGGAGGTTCTTTCTACAGAGATCACTGCCCTGTGCTAGGTGAGCAGAATGGCAAC
AGGAATCCTGGTGGATTGCAGATTGGTGACCTGGTAAATATAGATCTCGACCTCGAAATTGTACAGTCTTTGCAGCATGGTCATGGAGGA
TGGACTGATGGAATGTTTGAGACTTTAACTACAACTGGAACTGTTTGTGGCATTGATGAAGATCATGACATTGTAGTACAGTATCCAAGT
GGCAATAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAACGGAACACAGGTCCATGGAACAATCACAGTTTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000300413_chr18_19202686_+_2836nt
TGCCCGCTCTCCGCCGCCGCCTCCGAGCAGCCGCGGGCCGCCCTCCACTCCGAGCGGGGGGCGCGGCGGCGACAGCTGGGCAGCGGCTTT
GGGCTCCGCGGGGACCGCGCCGCCGCCCCCGTGAGTTATTCTCACGTCCCCCGGGGCTCGCTGCCGCCCCCGCCGACGCCTAGAGTCCGG
CCCGGGCCCAACTCCCTCACGGGCCCCCCGGCGGCAGCGGCGGCGGCGGCGGCGGCAGCGGCGGAGCCCACCGCCCGGGCCCCGATGAGT
AACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGACGGCGGC
GAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTACCGCTGC
TCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAGCAACCA
ATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTAAGACAT
CGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGAATCTTT
GCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAAATCCAG
GACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAGGGCATG
TCTGATCTGAAATGTGTCCAGGATGCCAAGGGAGGTTCTTTCTACAGAGATCACTGCCCTGTGCTAGGTGAGCAGAATGGCAACAGGAAT
CCTGGTGGATTGCAGATTGGTGACCTGGTAAATATAGATCTCGACCTCGAAATTGTACAGTCTTTGCAGCATGGTCATGGAGGATGGACT
GATGGAATGTTTGAGACTTTAACTACAACTGGAACTGTTTGTGGCATTGATGAAGATCATGACATTGTAGTACAGTATCCAAGTGGCAAT
AGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAACGGAACACAGGTCCATGGAACAATCACAGGTGTGGATGTC
AGCATGAATACACATCTTAAAGCTGTGAAAATGACCCTGAAGAACAGAGAACCTGTACAGCTGGAAACGCTGAGTATTCGAGGAAATAAC
ATTCGGTATTTTATTCTACCAGACAGTTTACCTCTGGATACACTACTTGTGGATGTTGAACCTAAGGTGAAATCTAAGAAAAGGGAAGCT
GTTGCAGGAAGAGGCAGAGGAAGAGGAAGAGGAAGAGGACGTGGCCGTGGCAGAGGAAGAGGGGGTCCTAGGCGATAATGTCTCTCAAGA
TTTCAAAGTCATATGAGATTTGGGATATTTTTTGTACAGGTTGTGTTTGTTTATGTCAGTTTTTAATAAACATAAATGTGGGACAGAGCT
GTCTATTTAGTATATCAAAGTTTTAGTAGTTTCCTCCACATTCACGAAATTACCACAGTGAGAGCTAAGCATTTCTACTGGGCAGTTTCA
TTTTTAGTTGATCAGGTTTTAAGTTTTTGAACTAAAATTTTTCTTTTTCTTTTTATGATGAATAAGGTTAAAATAAAAGCCTTAGACAAA
TTAAATTTGGCAGAGTTTAATTGAGCAAAGGACAATTCACAAATCAGGTAGCCCCTGAACCATAATAGGCTCAGAGGCTTCAGCCCAGCT
GCATAGTTGAAGATTTATGGACAGAAGGAAAGTGATGTATGGAAAATGGAAGTGAGATACAGCAACAGCCGGATTAGTTACAGTTCAGCG
TTTGCCTTATTTGAATATGGTTTGAACAGTTCGCTGTCTTTGGTTGGCTGAAACTTAGTGATTGCCACAAGAGTAGGGTACCGTCTGTTT
ACACGTCCAGTTAGGCTACAGTTCTATGTACTGAGAAACCTTTAAGCTGAACTTGAGATATGTAAAGAGACTTTAGGCTAAACTTAACAA
TATATATAGGATATATACCCTTCTACTTCACATGCACTGAATATGCATTTTATTGCTTTACTCTTCATTCTGTGGCACCTACCCACAGGG
GAAGTAAGAAGTTTGTTTTGGTATTTCGGAAACTAAAGTCCTTATGGGATGGGGTCTAGAATTGATTCTCCTTTCCTGAGTTTTACTCCA
CGGAGTCTTAGGTACCTGGTAAAAAGTTGTCTTCTAAATTAAGGGTCATTGCTTTGTTGTCTAGCTGCTAATGTCTTACTTTTGTTTCTT
TTGCTTTTTAATCAGTTCTTAATAGGATATAGTTTTATGTTTTCCAAGTTATAACTTGGAGTTAATGGTCACTAGATTATCAGTTATGAG
CAGTGTTAAAATCTCCTATTAATGTGTAATGTACCTGTCAGTGCCTCCTTTATTAAGGGGTTCTTTGAGAATAAAAGAGAAAAGACCTAC
TTTATTTGACAGCAAAACTGTTCTAATTGTTAATAAGGACTTTTAAAAATTGTTTTTGATTTGCTAAGCTCAGAAAAAATGTCTCTCAGT
GCATCAGTTCTTTGTAAAGCTTACTACGAAGTATTTATATGCTAAGGAAAACAACTGAGGATGTGGGTGGCTTAAATCTGTATTTTCATC

>In-frame_MIB1_ENST00000261537_chr18_19359646_+_SNRPD1_ENST00000579618_chr18_19202686_+_1362nt
TGCCCGCTCTCCGCCGCCGCCTCCGAGCAGCCGCGGGCCGCCCTCCACTCCGAGCGGGGGGCGCGGCGGCGACAGCTGGGCAGCGGCTTT
GGGCTCCGCGGGGACCGCGCCGCCGCCCCCGTGAGTTATTCTCACGTCCCCCGGGGCTCGCTGCCGCCCCCGCCGACGCCTAGAGTCCGG
CCCGGGCCCAACTCCCTCACGGGCCCCCCGGCGGCAGCGGCGGCGGCGGCGGCGGCAGCGGCGGAGCCCACCGCCCGGGCCCCGATGAGT
AACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGACGGCGGC
GAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTACCGCTGC
TCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAGCAACCA
ATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTAAGACAT
CGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGAATCTTT
GCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAAATCCAG
GACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAGGGCATG
TCTGATCTGAAATGTGTCCAGGATGCCAAGGGAGGTTCTTTCTACAGAGATCACTGCCCTGTGCTAGGTGAGCAGAATGGCAACAGGAAT
CCTGGTGGATTGCAGATTGGTGACCTGGTAAATATAGATCTCGACCTCGAAATTGTACAGTCTTTGCAGCATGGTCATGGAGGATGGACT
GATGGAATGTTTGAGACTTTAACTACAACTGGAACTGTTTGTGGCATTGATGAAGATCATGACATTGTAGTACAGTATCCAAGTGGCAAT
AGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAACGGAACACAGGTCCATGGAACAATCACAGTTTACCTCTGG
ATACACTACTTGTGGATGTTGAACCTAAGGTGAAATCTAAGAAAAGGGAAGCTGTTGCAGGAAGAGGCAGAGGAAGAGGAAGAGGAAGAG


Top

FusionGenePPI for MIB1_SNRPD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MIB1UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2N, UBE2U, UBE2W, UBC, JAG1, RYK, DLL1, AZI2, TBK1, PCM1, SNX5, DAPK1, CMIP, SMN1, CEP131, BLM, MIB1, USP9X, ZFC3H1, RANGAP1, ZBTB10, GEMIN4, MCM3, TOP3A, DDB1, TOP3B, RBBP4, MCM7, CDC27, CEP250, FSD1, PLK4, NTRK1, CENPJ, MED4, CEP290, CEP162, SSX2IP, CEP128, CNTRL, POC5, PCNT, PRKAR2B, OFD1, DYNLL1, PER3, CEP135, FGFR1OP, MAPRE1, CCDC14, PTPN22, TPTE2, LRRCC1, CHRNA3, FAM171B, ANKRD55, LPXN, EPN3, EPB41L4A, EPB41L5SNRPD1LSM8, RNU11, PRMT5, CLNS1A, WDR77, GEMIN5, SMN1, SNRPD2, SF3A2, DDX20, SMN2, CDC5L, SRRM2, RBM39, SREK1, HDGF, ARRB1, ARRB2, HNRNPA1, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, SNRPB, SF3B3, SNRPE, SF3A1, SNRPA1, SNRPD3, PRPF8, SNRNP70, LSM2, SF3B1, SF3B2, YBX1, HNRNPU, SF3B5, SF3B6, HNRNPK, PRPF6, SNRNP200, HNRNPM, EFTUD2, U2AF2, HNRNPA2B1, PRPF19, TPR, SART1, DDX5, BCAS2, TOP1, EEF1A1, HSPA5, UCHL3, TRIM28, RPS7, SRP14, SUPT16H, HSP90AB1, PTGES3, APEX1, ESR1, MAGOH, EIF4A3, SMURF1, CTNNB1, FN1, VCAM1, U2AF1, LSM3, IFIT1, IFIT2, IFIT3, IL7R, ITGA4, PAN2, CD81, IGSF8, ICAM1, NPM1, EGFR, SRPK2, SRPK3, PRPF4B, FERMT2, PDHB, SCLY, EIF5, WWOX, ASB1, ASB2, OBSL1, EZH2, SUZ12, EED, RNF2, BLK, DDX23, SNRNP40, SNUPN, MCFD2, PRPF31, RCC2, RUVBL1, SF3A3, DHX9, DPY30, LSM7, LUC7L, LUC7L2, PDCD4, SNRPF, TIA1, TMOD3, USP7, YWHAE, YWHAQ, RNU12, GEMIN7, CRBN, PTPN4, SNRPN, SNRPG, CD2BP2, LSM6, GEMIN2, PRPF3, NCL, CYLD, AAR2, EAPP, TSSC4, HEY1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MIB1_SNRPD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MIB1_SNRPD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMIB1C0036572Seizures1CTD_human
HgeneMIB1C3554496LEFT VENTRICULAR NONCOMPACTION 71UNIPROT