FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21866

FusionGeneSummary for MIB1_HLTF

check button Fusion gene summary
Fusion gene informationFusion gene name: MIB1_HLTF
Fusion gene ID: 21866
HgeneTgene
Gene symbol

MIB1

HLTF

Gene ID

57534

6596

Gene namemindbomb E3 ubiquitin protein ligase 1helicase like transcription factor
SynonymsDIP-1|DIP1|LVNC7|MIB|ZZANK2|ZZZ6HIP116|HIP116A|HLTF1|RNF80|SMARCA3|SNF2L3|ZBU1
Cytomap

18q11.2

3q24

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase MIB1DAPK-interacting protein 1RING-type E3 ubiquitin transferase MIB1ubiquitin ligase mind bombzinc finger ZZ type with ankyrin repeat domain protein 2helicase-like transcription factorDNA-binding protein/plasminogen activator inhibitor-1 regulatorRING finger protein 80RING-type E3 ubiquitin transferase HLTFSNF2-like 3SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfa
Modification date2018052320180519
UniProtAcc

Q86YT6

Q14527

Ensembl transtripts involved in fusion geneENST00000578646, ENST00000261537, 
ENST00000465259, ENST00000310053, 
ENST00000392912, ENST00000494055, 
ENST00000481663, 
Fusion gene scores* DoF score8 X 8 X 7=4483 X 3 X 3=27
# samples 103
** MAII scorelog2(10/448*10)=-2.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MIB1 [Title/Abstract] AND HLTF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-SI-A71Q-01AMIB1chr18

19353689

+HLTFchr3

148802676

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
3UTR-3CDSENST00000578646ENST00000465259MIB1chr18

19353689

+HLTFchr3

148802676

-
3UTR-3CDSENST00000578646ENST00000310053MIB1chr18

19353689

+HLTFchr3

148802676

-
3UTR-3CDSENST00000578646ENST00000392912MIB1chr18

19353689

+HLTFchr3

148802676

-
3UTR-3CDSENST00000578646ENST00000494055MIB1chr18

19353689

+HLTFchr3

148802676

-
3UTR-5UTRENST00000578646ENST00000481663MIB1chr18

19353689

+HLTFchr3

148802676

-
Frame-shitENST00000261537ENST00000465259MIB1chr18

19353689

+HLTFchr3

148802676

-
Frame-shitENST00000261537ENST00000310053MIB1chr18

19353689

+HLTFchr3

148802676

-
In-frameENST00000261537ENST00000392912MIB1chr18

19353689

+HLTFchr3

148802676

-
In-frameENST00000261537ENST00000494055MIB1chr18

19353689

+HLTFchr3

148802676

-
5CDS-5UTRENST00000261537ENST00000481663MIB1chr18

19353689

+HLTFchr3

148802676

-

Top

FusionProtFeatures for MIB1_HLTF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MIB1

Q86YT6

HLTF

Q14527

Has both helicase and E3 ubiquitin ligase activities.Possesses intrinsic ATP-dependent nucleosome-remodeling activity;This activity may be required for transcriptional activation orrepression of specific target promoters (By similarity). These mayinclude the SERPINE1 and HIV-1 promoters and the SV40 enhancer, towhich this protein can bind directly. Plays a role in error-freepostreplication repair (PRR) of damaged DNA and maintains genomicstability through acting as a ubiquitin ligase for 'Lys-63'-linkedpolyubiquitination of chromatin-bound PCNA. {ECO:0000250,ECO:0000269|PubMed:10391891, ECO:0000269|PubMed:18316726,ECO:0000269|PubMed:18719106, ECO:0000269|PubMed:7876228,ECO:0000269|PubMed:8672239, ECO:0000269|PubMed:9126292}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MIB1_HLTF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000392912_chr3_148802676_-_212aa
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQ
QPIIGIRWKCAECTNTDLCTVCTHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE

>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000494055_chr3_148802676_-_212aa
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQ
QPIIGIRWKCAECTNTDLCTVCTHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000392912_chr3_148802676_-_636nt
ATGAGTAACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGAC
GGCGGCGAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTAC
CGCTGCTCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAG
CAACCAATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTA
AGACATCGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGA
ATCTTTGCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAA
ATCCAGGACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAG

>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000494055_chr3_148802676_-_636nt
ATGAGTAACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGAC
GGCGGCGAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTAC
CGCTGCTCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAG
CAACCAATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTA
AGACATCGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGA
ATCTTTGCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAA
ATCCAGGACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000392912_chr3_148802676_-_4608nt
TGCCCGCTCTCCGCCGCCGCCTCCGAGCAGCCGCGGGCCGCCCTCCACTCCGAGCGGGGGGCGCGGCGGCGACAGCTGGGCAGCGGCTTT
GGGCTCCGCGGGGACCGCGCCGCCGCCCCCGTGAGTTATTCTCACGTCCCCCGGGGCTCGCTGCCGCCCCCGCCGACGCCTAGAGTCCGG
CCCGGGCCCAACTCCCTCACGGGCCCCCCGGCGGCAGCGGCGGCGGCGGCGGCGGCAGCGGCGGAGCCCACCGCCCGGGCCCCGATGAGT
AACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGACGGCGGC
GAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTACCGCTGC
TCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAGCAACCA
ATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTAAGACAT
CGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGAATCTTT
GCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAAATCCAG
GACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAGGGCATG
GGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTT
TGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGT
GGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGATAAGAATGC
AATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGACAACAAATT
GGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAG
AAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGG
CTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTTGACAAATT
GTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGC
TCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAA
TTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCCATTGCAGT
AATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTTAACGATGA
CTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTC
AGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAG
CAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAAGGCAGGGC
GAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAA
AAAGGGAGCTTGTGCAGTGGAGGGGTCAAAGAAAACTGATGTTGAGGAGAGACCAAGAACAACACTGATCATCTGTCCGCTTTCTGTGTT
AAGCAACTGGATTGACCAGTTTGGACAACATATAAAATCAGATGTACACTTGAATTTTTATGTTTATTATGGTCCTGATCGTATTAGAGA
ACCGGCCTTACTTTCAAAACAGGATATTGTTTTGACTACGTATAATATTTTAACTCATGACTATGGAACTAAAGGAGATAGTCCATTACA
TAGCATAAGGTGGCTAAGAGTGATCCTGGATGAAGGACATGCCATACGAAATCCAAATGCTCAGCAGACAAAAGCTGTACTTGACTTAGA
ATCAGAAAGAAGATGGGTTTTGACAGGTACTCCAATCCAGAATTCTTTAAAGGACTTGTGGTCTCTTCTTTCCTTTTTAAAACTTAAACC
ATTTATTGATAGAGAATGGTGGCATAGAACAATACAGCGTCCTGTCACAATGGGAGATGAAGGAGGACTTAGGCGTTTACAGTCCCTAAT
TAAAAATATTACACTTAGAAGAACAAAGACAAGCAAAATTAAAGGAAAACCTGTTTTGGAGTTACCAGAACGTAAAGTATTTATTCAGCA
CATTACACTTTCAGATGAAGAGAGAAAGATTTATCAGTCTGTGAAAAATGAAGGCAGAGCCACTATTGGAAGGTATTTTAATGAAGGGAC
TGTCCTGGCACATTATGCAGATGTCCTGGGTCTTTTGCTTAGACTGCGGCAAATTTGTTGCCATACTTACCTTCTTACAAATGCAGTGTC
TTCCAATGGCCCCTCAGGAAATGATACACCTGAAGAACTGAGAAAGAAGTTAATAAGGAAGATGAAGTTAATTCTGAGCTCAGGTTCAGA
TGAGGAATGTGCAATTTGCCTGGATTCTTTAACAGTTCCTGTGATAACACATTGTGCACATGTATTTTGTAAACCCTGTATTTGCCAAGT
CATTCAGAATGAGCAGCCACATGCTAAATGCCCTTTATGCAGAAATGATATACATGAAGATAATTTATTAGAATGTCCTCCAGAAGAATT
AGCACGTGACAGTGAGAAAAAGTCTGATATGGAATGGACATCCAGTTCAAAGATTAATGCGCTAATGCACGCATTGACTGACTTAAGAAA
GAAGAATCCCAACATAAAAAGTTTGGTTGTTTCTCAGTTTACAACATTCCTGTCTTTAATAGAAATACCACTTAAAGCCTCTGGATTTGT
GTTTACTCGTTTGGATGGTTCCATGGCCCAAAAGAAAAGAGTTGAATCAATTCAGTGTTTTCAAAACACTGAAGCAGGATCTCCAACTAT
AATGCTTCTGTCCTTAAAAGCAGGTGGAGTTGGTTTGAATCTGTCTGCAGCTTCTCGAGTGTTTTTAATGGATCCAGCCTGGAATCCTGC
TGCTGAAGATCAGTGCTTTGACAGATGCCATAGACTTGGTCAGAAGCAAGAAGTTATCATCACAAAATTCATTGTAAAGGACTCTGTTGA
AGAAAATATGCTGAAAATACAAAACAAAAAGAGAGAACTTGCAGCAGGAGCCTTTGGAACTAAAAAACCAAATGCTGACGAAATGAAACA
AGCCAAAATTAATGAAATCAGAACATTAATTGACTTATAATTTGTGGGATTTTAGTAAGAAGACTACTATATGTGAGAGGCGTGATATCT
GGATGGAAGTTGGGCTGGATGATCTCCAAAGTCGTTTCAACTCTTAAAGACATCTTAATCCTGAATGTAAACAATTGTTATGTGTTTAGA
ATCAGAATTTGATTTTGAACTTGAGTAATTCATCCTTACAGCTATCTGTAGAATTAGTCATCTTTTTTCTTTTCTTTTTTTTTTACTTTT
TTGTTAATAAGCAAACTTATTTGCTGCAGAATTTGGGTTGACTCCTGAGCATATTTAAAACAAAGAAGCTAGAAATTTAGCAGTCAGATT
AGGTAGGTGGTTTTATTTCAAAGGGAAACTTTAATCCAAAGAAAGATTAATTACTCTAACAAACAAGAGAAGCTTCATGTTTGATGATAC
AGATTTAAGAATACCTGAGACTTAAGAGTGTTGGAAGTCATTTGATAGAAAGATGAGATCGGAGACAATGTTGTGTTATAGGGCACACAT
TGAAGGTATATGCCAAATCTCTCACCAGATAAGTCCTTTTCTCCCTGTGCCGTTTTCTTGCTCAAAGGGAACAGTGAATTAGCCAGCTAG
AATCTTCCTGGTCCCTTTTTGAGGCAGTAGCAGGTAAGGAAAGGGCTGATTTTCATCAAAACCAAGACCTTTCTGCAGGGATGATAGTGG

>In-frame_MIB1_ENST00000261537_chr18_19353689_+_HLTF_ENST00000494055_chr3_148802676_-_4295nt
TGCCCGCTCTCCGCCGCCGCCTCCGAGCAGCCGCGGGCCGCCCTCCACTCCGAGCGGGGGGCGCGGCGGCGACAGCTGGGCAGCGGCTTT
GGGCTCCGCGGGGACCGCGCCGCCGCCCCCGTGAGTTATTCTCACGTCCCCCGGGGCTCGCTGCCGCCCCCGCCGACGCCTAGAGTCCGG
CCCGGGCCCAACTCCCTCACGGGCCCCCCGGCGGCAGCGGCGGCGGCGGCGGCGGCAGCGGCGGAGCCCACCGCCCGGGCCCCGATGAGT
AACTCCCGGAATAACCGGGTGATGGTGGAAGGGGTTGGCGCTCGGGTAGTGCGCGGCCCGGACTGGAAGTGGGGGAAGCAGGACGGCGGC
GAGGGCCATGTGGGCACCGTCCGGAGCTTCGAGAGCCCCGAGGAGGTGGTGGTAGTGTGGGACAACGGCACAGCTGCCAACTACCGCTGC
TCCGGGGCTTACGACCTCCGCATCCTGGACAGCGCGCCCACCGGCATCAAGCATGATGGAACCATGTGTGATACCTGCCGCCAGCAACCA
ATCATTGGCATTCGATGGAAGTGTGCAGAGTGTACAAATTATGATTTGTGCACAGTGTGTTATCATGGAGATAAACATCATTTAAGACAT
CGCTTTTACCGAATTACTACACCGGGAAGTGAGAGGGTTCTGTTAGAGTCTCGTAGGAAATCTAAGAAGATTACAGCCAGAGGAATCTTT
GCAGGTGCCAGAGTGGTGCGAGGAGTGGACTGGCAGTGGGAAGATCAAGATGGAGGAAATGGACGTAGGGGAAAGGTAACAGAAATCCAG
GACTGGAGTGCATCAAGCCCACATAGCGCAGCATATGTCCTCTGGGATAATGGTGCTAAGAACCTTTACAGAGTTGGCTTTGAGGGCATG
GGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAAATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTT
TGAATTCCAAGATGTTATCCCTCCAGATGACTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGT
GGTTGGACTACGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATGATAAGAATGC
AATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGGTGCTTTGGCCTATATCATGGACAACAAATT
GGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAATGCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAG
AAAAGCGGTTTCAGATCAGTTGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGG
CTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTTAAAACAGAATTTGACAAATT
GTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTGAGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGC
TCTAGCTTGGATGGTGTCACGGGAAAATAGCAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAA
TTTTTCTGAGAAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACGGCCATTGCAGT
AATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCTACTGAAGAAGGAATATAATGTTAACGATGA
CTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCAGATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTC
AGATATCAAGGAGAAGAGTAAGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAG
CAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAGTCTGAAACTAAAGGCAGGGC
GAAAGCAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAACTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAA
AAAGGGAGCTTGTGCAGTGGAGGGGTCAAAGAAAACTGATGTTGAGGAGAGACCAAGAACAACACTGATCATCTGTCCGCTTTCTGTGTT
AAGCAACTGGATTGACCAGTTTGGACAACATATAAAATCAGATGTACACTTGAATTTTTATGTTTATTATGGTCCTGATCGTATTAGAGA
ACCGGCCTTACTTTCAAAACAGGATATTGTTTTGACTACGTATAATATTTTAACTCATGACTATGGAACTAAAGGAGATAGTCCATTACA
TAGCATAAGGTGGCTAAGAGTGATCCTGGATGAAGGACATGCCATACGAAATCCAAATGCTCAGCAGACAAAAGCTGTACTTGACTTAGA
ATCAGAAAGAAGATGGGTTTTGACAGGTACTCCAATCCAGAATTCTTTAAAGGACTTGTGGTCTCTTCTTTCCTTTTTAAAACTTAAACC
ATTTATTGATAGAGAATGGTGGCATAGAACAATACAGCGTCCTGTCACAATGGGAGATGAAGGAGGACTTAGGCGTTTACAGTCCCTAAT
TAAAAATATTACACTTAGAAGAACAAAGACAAGCAAAATTAAAGGAAAACCTGTTTTGGAGTTACCAGAACGTAAAGTATTTATTCAGCA
CATTACACTTTCAGATGAAGAGAGAAAGATTTATCAGTCTGTGAAAAATGAAGGCAGAGCCACTATTGGAAGGTATTTTAATGAAGGGAC
TGTCCTGGCACATTATGCAGATGTCCTGGGTCTTTTGCTTAGACTGCGGCAAATTTGTTGCCATACTTACCTTCTTACAAATGCAGTGTC
TTCCAATGGCCCCTCAGGAAATGATACACCTGAAGAACTGAGAAAGAAGTTAATAAGGAAGATGAAGTTAATTCTGAGCTCAGGTTCAGA
TGAGGAATGTGCAATTTGCCTGGATTCTTTAACAGTTCCTGTGATAACACATTGTGCACATGTATTTTGTAAACCCTGTATTTGCCAAGT
CATTCAGAATGAGCAGCCACATGCTAAATGCCCTTTATGCAGAAATGATATACATGAAGATAATTTATTAGAATGTCCTCCAGAAGAATT
AGCACGTGACAGTGAGAAAAAGTCTGATATGGAATGGACATCCAGTTCAAAGATTAATGCGCTAATGCACGCATTGACTGACTTAAGAAA
GAAGAATCCCAACATAAAAAGTTTGGTTGTTTCTCAGTTTACAACATTCCTGTCTTTAATAGAAATACCACTTAAAGCCTCTGGATTTGT
GTTTACTCGTTTGGATGGTTCCATGGCCCAAAAGAAAAGAGTTGAATCAATTCAGTGTTTTCAAAACACTGAAGCAGGATCTCCAACTAT
AATGCTTCTGTCCTTAAAAGCAGGTGGAGTTGGTTTGAATCTGTCTGCAGCTTCTCGAGTGTTTTTAATGGATCCAGCCTGGAATCCTGC
TGCTGAAGATCAGTGCTTTGACAGATGCCATAGACTTGGTCAGAAGCAAGAAGTTATCATCACAAAATTCATTGTAAAGGACTCTGTTGA
AGAAAATATGCTGAAAATACAAAACAAAAAGAGAGAACTTGCAGCAGGAGCCTTTGGAACTAAAAAACCAAATGCTGACGAAATGAAACA
AGCCAAAATTAATGAAATCAGAACATTAATTGACTTATAATTTGTGGGATTTTAGTAAGACTACTATATGTGAGAGGCGTGATATCTGGA
TGGAAGTTGGGCTGGATGATCTCCAAAGTCGTTTCAACTCTTAAAGACATCTTAATCCTGAATGTAAACAATTGTTATGTGTTTAGAATC
AGAATTTGATTTTGAACTTGAGTAATTCATCCTTACAGCTATCTGTAGAATTAGTCATCTTTTTTCTTTTCTTTTTTTTTTACTTTTTTG
TTAATAAGCAAACTTATTTGCTGCAGAATTTGGGTTGACTCCTGAGCATATTTAAAACAAAGAAGCTAGAAATTTAGCAGTCAGATTAGG


Top

FusionGenePPI for MIB1_HLTF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MIB1UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2N, UBE2U, UBE2W, UBC, JAG1, RYK, DLL1, AZI2, TBK1, PCM1, SNX5, DAPK1, CMIP, SMN1, CEP131, BLM, MIB1, USP9X, ZFC3H1, RANGAP1, ZBTB10, GEMIN4, MCM3, TOP3A, DDB1, TOP3B, RBBP4, MCM7, CDC27, CEP250, FSD1, PLK4, NTRK1, CENPJ, MED4, CEP290, CEP162, SSX2IP, CEP128, CNTRL, POC5, PCNT, PRKAR2B, OFD1, DYNLL1, PER3, CEP135, FGFR1OP, MAPRE1, CCDC14, PTPN22, TPTE2, LRRCC1, CHRNA3, FAM171B, ANKRD55, LPXN, EPN3, EPB41L4A, EPB41L5HLTFPCNA, UBE2N, UBE2V2, RAD18, USP7, RPAP1, UBE2Z, EWSR1, CHFR, SHPRH, RNF146, ELAVL1, SPRTN, SP1, SP3, NOTCH1, DTL, BRCA1, CDK9, HSPA8, SULT1C2, WBP4, RPA3, RPA2, RPA1, UBC, UBE2A, HLTF, DLD, RNF166, APLF, HIST1H2BA, S100A10, FBXW11, NTRK1, PDK3, SMC1A, EMC2, AP4S1, SYNPO, CERK, TCEAL4, SNW1, CDC5L, NANOG, POU5F1, NFATC1, NFATC2, PMPCA, CHD1L, FEN1, VPRBP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MIB1_HLTF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MIB1_HLTF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMIB1C0036572Seizures1CTD_human
HgeneMIB1C3554496LEFT VENTRICULAR NONCOMPACTION 71UNIPROT
TgeneHLTFC0022665Kidney Neoplasm1CTD_human