FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21783

FusionGeneSummary for MFSD6_PMS1

check button Fusion gene summary
Fusion gene informationFusion gene name: MFSD6_PMS1
Fusion gene ID: 21783
HgeneTgene
Gene symbol

MFSD6

PMS1

Gene ID

54842

5378

Gene namemajor facilitator superfamily domain containing 6PMS1 homolog 1, mismatch repair system component
SynonymsMMR2|hMMR2HNPCC3|MLH2|PMSL1|hPMS1
Cytomap

2q32.2

2q32.2

Type of geneprotein-codingprotein-coding
Descriptionmajor facilitator superfamily domain-containing protein 6macrophage MHC class I receptor 2 homologmacrophage MHC receptor 2PMS1 protein homolog 1DNA mismatch repair protein PMS1PMS1 postmeiotic segregation increased 1human homolog of yeast mutLmismatch repair gene PMSL1rhabdomyosarcoma antigen MU-RMS-40.10Brhabdomyosarcoma antigen MU-RMS-40.10E
Modification date2018032920180523
UniProtAcc

Q6ZSS7

P54277

Ensembl transtripts involved in fusion geneENST00000392328, ENST00000281416, 
ENST00000535751, ENST00000489793, 
ENST00000441310, ENST00000418224, 
ENST00000409823, ENST00000421722, 
ENST00000447232, ENST00000432292, 
ENST00000409985, ENST00000374826, 
Fusion gene scores* DoF score6 X 2 X 4=486 X 4 X 5=120
# samples 66
** MAII scorelog2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MFSD6 [Title/Abstract] AND PMS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-1417-01AMFSD6chr2

191334581

+PMS1chr2

190738222

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000392328ENST00000441310MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000392328ENST00000418224MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000392328ENST00000409823MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000392328ENST00000421722MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000392328ENST00000447232MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000392328ENST00000432292MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000392328ENST00000409985MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000392328ENST00000374826MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000281416ENST00000441310MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000281416ENST00000418224MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000281416ENST00000409823MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000281416ENST00000421722MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000281416ENST00000447232MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000281416ENST00000432292MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000281416ENST00000409985MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000281416ENST00000374826MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000535751ENST00000441310MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000535751ENST00000418224MFSD6chr2

191334581

+PMS1chr2

190738222

+
In-frameENST00000535751ENST00000409823MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000535751ENST00000421722MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000535751ENST00000447232MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000535751ENST00000432292MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000535751ENST00000409985MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000535751ENST00000374826MFSD6chr2

191334581

+PMS1chr2

190738222

+
Frame-shitENST00000489793ENST00000441310MFSD6chr2

191334581

+PMS1chr2

190738222

+
Frame-shitENST00000489793ENST00000418224MFSD6chr2

191334581

+PMS1chr2

190738222

+
Frame-shitENST00000489793ENST00000409823MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000489793ENST00000421722MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000489793ENST00000447232MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000489793ENST00000432292MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000489793ENST00000409985MFSD6chr2

191334581

+PMS1chr2

190738222

+
5CDS-intronENST00000489793ENST00000374826MFSD6chr2

191334581

+PMS1chr2

190738222

+

Top

FusionProtFeatures for MFSD6_PMS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MFSD6

Q6ZSS7

PMS1

P54277

Probably involved in the repair of mismatches in DNA.{ECO:0000269|PubMed:10748105}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26105_125543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26132_152543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26286_306543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26335_355543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26369_389543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26450_470543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26479_499543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26507_527543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+2673_93543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48105_125543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48132_152543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48286_306543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48335_355543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48369_389543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48450_470543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48479_499543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48507_527543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+4873_93543792TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26544_564543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26579_599543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000281416+26605_625543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48544_564543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48579_599543792TransmembraneHelical
HgeneMFSD6chr2:191334581chr2:190738222ENST00000392328+48605_625543792TransmembraneHelical
TgenePMS1chr2:191334581chr2:190738222ENST00000409823+912571_639785894DNA bindingHMG box
TgenePMS1chr2:191334581chr2:190738222ENST00000441310+1013571_639824933DNA bindingHMG box
TgenePMS1chr2:191334581chr2:190738222ENST00000447232+912571_639662771DNA bindingHMG box


Top

FusionGeneSequence for MFSD6_PMS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_652aa
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLP
VYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQYGSV
LFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNE

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_114aa
MEVLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFG

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_114aa
MEVLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFG

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_114aa
MEVLQGVSITENYLEIEGMANCLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_1956nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAA
GTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAA
GAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCA
GTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAA

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_342nt
ATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGAT
TTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGA
GAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGA

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_342nt
ATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGAT
TTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGA
GAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGA

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_342nt
ATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGAT
TTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGA
GAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_2473nt
GTCGCAGCCCCGGAGGAGCGCGCGAGCAGCCCGGGATGGTGCGCGCTGCCCCGACAGCCGCCGCCCCGGCGCCCCGAGCCGCCGCCCCGT
GCTCCGGGGACAGGGCTCCCCGCGCCCCGCGCAGCTGAGCGCTGCCGCCGCCGCAGCAGACAGGATCTCTCTCAGTTACCCAGGCCGGAG
TGCAGTGGCGTGATCCTAGCTCACTGCAGCCTTGAACCCCTGGGCTCAAGTGATTCTCCTGCCTTGGCCTCCTGAATAGCTAGAACTACA
GATCAACAGTACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGAT
GAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCC
TCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAG
GTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAG
AGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAA
ATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAG
ATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCA
CCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGT
GAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCA
GGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAA
GAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTC
ACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTG
GGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTC
ATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAA
GGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCC
TTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGC
TTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCT
GAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCT
CGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTG
GAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAG
GAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCA
AAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCAT
CATTTAACCTATCTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGA
GTCTGGTTTTAAATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTC

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_2471nt
GTCGCAGCCCCGGAGGAGCGCGCGAGCAGCCCGGGATGGTGCGCGCTGCCCCGACAGCCGCCGCCCCGGCGCCCCGAGCCGCCGCCCCGT
GCTCCGGGGACAGGGCTCCCCGCGCCCCGCGCAGCTGAGCGCTGCCGCCGCCGCAGCAGACAGGATCTCTCTCAGTTACCCAGGCCGGAG
TGCAGTGGCGTGATCCTAGCTCACTGCAGCCTTGAACCCCTGGGCTCAAGTGATTCTCCTGCCTTGGCCTCCTGAATAGCTAGAACTACA
GATCAACAGTACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGAT
GAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCC
TCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAG
GTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAG
AGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAA
ATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAG
ATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCA
CCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGT
GAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCA
GGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAA
GAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTC
ACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTG
GGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTC
ATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAA
GGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCC
TTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGC
TTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCT
GAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCT
CGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTG
GAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAG
GAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCA
AAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCAT
CATTTAACCTATCTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGA
GTCTGGTTTTAAATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTC

>In-frame_MFSD6_ENST00000392328_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_2280nt
GTCGCAGCCCCGGAGGAGCGCGCGAGCAGCCCGGGATGGTGCGCGCTGCCCCGACAGCCGCCGCCCCGGCGCCCCGAGCCGCCGCCCCGT
GCTCCGGGGACAGGGCTCCCCGCGCCCCGCGCAGCTGAGCGCTGCCGCCGCCGCAGCAGACAGGATCTCTCTCAGTTACCCAGGCCGGAG
TGCAGTGGCGTGATCCTAGCTCACTGCAGCCTTGAACCCCTGGGCTCAAGTGATTCTCCTGCCTTGGCCTCCTGAATAGCTAGAACTACA
GATCAACAGTACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGAT
GAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCC
TCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAG
GTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAG
AGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAA
ATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAG
ATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCA
CCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGT
GAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCA
GGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAA
GAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTC
ACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTG
GGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTC
ATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAA
GGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCC
TTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGC
TTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCT
GAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCT
CGCTATATTTATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTG
GAAATAGAAGGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAG
GAAGTTTATGAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCA
AAAGAGGACATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCAT

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_2284nt
CTTAATTTCCTGCAAGATGAAGTTCTGTGTTTACATGTTATGATTTTCATTACTAAGCCATCTTTTAAATTTTACTTTACAGATCAACAG
TACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAA
CAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAA
ACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTAT
TTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTA
CTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTC
CTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCA
ACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATG
CGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACT
CTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTA
ACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAA
GCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAG
TATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGG
ATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTC
GGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAG
GTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTT
TGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTC
ACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACA
GCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATT
TATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAA
GGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTAT
GAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGAC
ATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACC
TATCTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGAGTCTGGTTT
TAAATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTCCACGTATTG

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_2282nt
CTTAATTTCCTGCAAGATGAAGTTCTGTGTTTACATGTTATGATTTTCATTACTAAGCCATCTTTTAAATTTTACTTTACAGATCAACAG
TACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAA
CAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAA
ACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTAT
TTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTA
CTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTC
CTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCA
ACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATG
CGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACT
CTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTA
ACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAA
GCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAG
TATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGG
ATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTC
GGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAG
GTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTT
TGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTC
ACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACA
GCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATT
TATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAA
GGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTAT
GAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGAC
ATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACC
TATCTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGAGTCTGGTTT
TAAATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTCCACGTATTG

>In-frame_MFSD6_ENST00000281416_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_2091nt
CTTAATTTCCTGCAAGATGAAGTTCTGTGTTTACATGTTATGATTTTCATTACTAAGCCATCTTTTAAATTTTACTTTACAGATCAACAG
TACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAA
CAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAA
ACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTAT
TTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTA
CTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTC
CTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCA
ACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATG
CGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACT
CTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTA
ACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAA
GCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAG
TATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGG
ATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTC
GGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAG
GTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTT
TGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTC
ACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACA
GCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATT
TATATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAA
GGAATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTAT
GAATGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGAC
ATCCAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACC

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000441310_chr2_190738222_+_751nt
GAAAAGGCTGAGGGCAGATATGTTAGAAGCCATCTTCTTATTCCTAAATTCATGCTTAAATGTAATTGTCCTTCAGTTTTCCCACTCCTG
AGTTTGGAGTCTGCTGGATGATGGGTGGTTTGGGGAAGGAAAAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTAT
ATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGA
ATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAA
TGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATC
CAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACCTAT
CTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGAGTCTGGTTTTAA
ATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTCCACGTATTGTAG

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000418224_chr2_190738222_+_749nt
GAAAAGGCTGAGGGCAGATATGTTAGAAGCCATCTTCTTATTCCTAAATTCATGCTTAAATGTAATTGTCCTTCAGTTTTCCCACTCCTG
AGTTTGGAGTCTGCTGGATGATGGGTGGTTTGGGGAAGGAAAAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTAT
ATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGA
ATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAA
TGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATC
CAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACCTAT
CTTCCAGAAACTACATGATTAAATATGTTTAAGAAGATTAGTTACCATTGAAATTGGTTCTGTCATAAAACAGCATGAGTCTGGTTTTAA
ATTATCTTTGTATTATGTGTCACATGGTTATTTTTTAAATGAGGATTCACTGACTTGTTTTTATATTGAAAAAAGTTCCACGTATTGTAG

>In-frame_MFSD6_ENST00000535751_chr2_191334581_+_PMS1_ENST00000409823_chr2_190738222_+_558nt
GAAAAGGCTGAGGGCAGATATGTTAGAAGCCATCTTCTTATTCCTAAATTCATGCTTAAATGTAATTGTCCTTCAGTTTTCCCACTCCTG
AGTTTGGAGTCTGCTGGATGATGGGTGGTTTGGGGAAGGAAAAGGGTTCTGTACATTGGCCTGGCCTGCAATACGGCTCGCTATATTTAT
ATTTCCTACCTGGAGAATGCCTGGACTGTTCTCCCCATGGAAGTTCTTCAAGGAGTTTCAATTACTGAAAATTACTTGGAAATAGAAGGA
ATGGCTAATTGTCTCCCATTCTATGGAGTAGCAGATTTAAAAGAAATTCTTAATGCTATATTAAACAGAAATGCAAAGGAAGTTTATGAA
TGTAGACCTCGCAAAGTGATAAGTTATTTAGAGGGAGAAGCAGTGCGTCTATCCAGACAATTACCCATGTACTTATCAAAAGAGGACATC
CAAGACATTATCTACAGAATGAAGCACCAGTTTGGAAATGAAATTAAAGAGTGTGTTCATGGTCGCCCATTTTTTCATCATTTAACCTAT


Top

FusionGenePPI for MFSD6_PMS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MFSD6PMS1MLH1, BRCA2, PSD2, UBC, EXO1, RFC2, PMS1, RFC4, RFC1, POLR1C, ATR, NONO, PGK1, TOP1, MCM6, SMC3, REV3L, IPO5, IPO9, RANBP9, RANGAP1, MMS19, USP5, USP13, UBAP2L, HERC2, CUL3, CUL1, USP9Y, RNF20, HELB, MOV10, BRIP1, KPNA2, SBF2, SBF1, CCNT1, CDK9, PIK3C2A, CDC5L, AKAP9, PPP2R1A, UBR5, CYLD, PSMC1, RNF123, FAN1, MSH6, MSH2, PSMC3, NTRK1, DYNLT1, PTTG1, CEP170P1, HIST1H1D, SNX21, BBS7, PAG1, AHNAK, VAMP3, HRAS, GNG5, PYGB, MCM9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MFSD6_PMS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MFSD6_PMS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource