FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21781

FusionGeneSummary for MFSD6_GLS

check button Fusion gene summary
Fusion gene informationFusion gene name: MFSD6_GLS
Fusion gene ID: 21781
HgeneTgene
Gene symbol

MFSD6

GLS

Gene ID

54842

27165

Gene namemajor facilitator superfamily domain containing 6glutaminase 2
SynonymsMMR2|hMMR2GA|GLS|LGA|hLGA
Cytomap

2q32.2

12q13.3

Type of geneprotein-codingprotein-coding
Descriptionmajor facilitator superfamily domain-containing protein 6macrophage MHC class I receptor 2 homologmacrophage MHC receptor 2glutaminase liver isoform, mitochondrialL-glutamine amidohydrolasebreast cell glutaminaseglutaminase 2 (liver, mitochondrial)glutaminase Iphosphate-activated glutaminasephosphate-dependent glutaminase
Modification date2018032920180523
UniProtAcc

Q6ZSS7

O94925

Ensembl transtripts involved in fusion geneENST00000392328, ENST00000281416, 
ENST00000535751, ENST00000489793, 
ENST00000320717, ENST00000338435, 
ENST00000409626, ENST00000409428, 
ENST00000409215, ENST00000471443, 
Fusion gene scores* DoF score6 X 2 X 4=488 X 7 X 3=168
# samples 68
** MAII scorelog2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(8/168*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MFSD6 [Title/Abstract] AND GLS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E9-A228-01AMFSD6chr2

191302287

+GLSchr2

191759878

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000392328ENST00000320717MFSD6chr2

191302287

+GLSchr2

191759878

+
In-frameENST00000392328ENST00000338435MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000392328ENST00000409626MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000392328ENST00000409428MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000392328ENST00000409215MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000392328ENST00000471443MFSD6chr2

191302287

+GLSchr2

191759878

+
In-frameENST00000281416ENST00000320717MFSD6chr2

191302287

+GLSchr2

191759878

+
In-frameENST00000281416ENST00000338435MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000281416ENST00000409626MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000281416ENST00000409428MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000281416ENST00000409215MFSD6chr2

191302287

+GLSchr2

191759878

+
5CDS-intronENST00000281416ENST00000471443MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-3CDSENST00000535751ENST00000320717MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-3CDSENST00000535751ENST00000338435MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000535751ENST00000409626MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000535751ENST00000409428MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000535751ENST00000409215MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000535751ENST00000471443MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-3CDSENST00000489793ENST00000320717MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-3CDSENST00000489793ENST00000338435MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000489793ENST00000409626MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000489793ENST00000409428MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000489793ENST00000409215MFSD6chr2

191302287

+GLSchr2

191759878

+
intron-intronENST00000489793ENST00000471443MFSD6chr2

191302287

+GLSchr2

191759878

+

Top

FusionProtFeatures for MFSD6_GLS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MFSD6

Q6ZSS7

GLS

O94925

Catalyzes the first reaction in the primary pathway forthe renal catabolism of glutamine. Plays a role in maintainingacid-base homeostasis. Regulates the levels of theneurotransmitter glutamate in the brain. Isoform 2 lacks catalyticactivity.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16105_125510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16132_152510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16286_306510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16335_355510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16369_389510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16450_470510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16479_499510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+1673_93510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38105_125510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38132_152510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38286_306510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38335_355510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38369_389510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38450_470510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38479_499510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+3873_93510792TransmembraneHelical
TgeneGLSchr2:191302287chr2:191759878ENST00000320717+018585_614128670RepeatNote=ANK 1
TgeneGLSchr2:191302287chr2:191759878ENST00000320717+018619_648128670RepeatNote=ANK 2
TgeneGLSchr2:191302287chr2:191759878ENST00000338435+015585_614128599RepeatNote=ANK 1
TgeneGLSchr2:191302287chr2:191759878ENST00000338435+015619_648128599RepeatNote=ANK 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16507_527510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16544_564510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16579_599510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000281416+16605_625510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38507_527510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38544_564510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38579_599510792TransmembraneHelical
HgeneMFSD6chr2:191302287chr2:191759878ENST00000392328+38605_625510792TransmembraneHelical


Top

FusionGeneSequence for MFSD6_GLS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_1052aa
MADDKVAILTDDEEEQKRKTVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFTFFFYSATGSLTPLLP
VTYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVTDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQTLGKHRDRTGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQTGSV
LFVAWFMGFGTGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTATFFSHKLIELIGHISKIKQGLLPSLEDLLFTTIAEGQEKIPVHK
FITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELTESAKKQSGGKVAD
TIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKTAIAVNDLGTETVHRTVGKEPSGLRFNKLFLNEDDKPHNPMVNAGA
IVVTSLIKQGVNNAEKFDTVMQFLNKMAGNETVGFSNATFQSERESGDRNFAIGTYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESAS
VMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMTDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFC
HDLVSLCNFHNTDNLRHFAKKLDPRREGGDQRVKSVINLLFAATTGDVSALRRFALSAMDMEQRDTDSRTALHVAAAEGHVEVVKFLLEA

>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_981aa
MADDKVAILTDDEEEQKRKTVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFTFFFYSATGSLTPLLP
VTYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVTDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQTLGKHRDRTGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQTGSV
LFVAWFMGFGTGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTATFFSHKLIELIGHISKIKQGLLPSLEDLLFTTIAEGQEKIPVHK
FITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELTESAKKQSGGKVAD
TIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKTAIAVNDLGTETVHRTVGKEPSGLRFNKLFLNEDDKPHNPMVNAGA
IVVTSLIKQGVNNAEKFDTVMQFLNKMAGNETVGFSNATFQSERESGDRNFAIGTYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESAS
VMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMTDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFC

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_1052aa
MADDKVAILTDDEEEQKRKTVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFTFFFYSATGSLTPLLP
VTYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVTDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQTLGKHRDRTGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQTGSV
LFVAWFMGFGTGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTATFFSHKLIELIGHISKIKQGLLPSLEDLLFTTIAEGQEKIPVHK
FITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELTESAKKQSGGKVAD
TIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKTAIAVNDLGTETVHRTVGKEPSGLRFNKLFLNEDDKPHNPMVNAGA
IVVTSLIKQGVNNAEKFDTVMQFLNKMAGNETVGFSNATFQSERESGDRNFAIGTYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESAS
VMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMTDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFC
HDLVSLCNFHNTDNLRHFAKKLDPRREGGDQRVKSVINLLFAATTGDVSALRRFALSAMDMEQRDTDSRTALHVAAAEGHVEVVKFLLEA

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_981aa
MADDKVAILTDDEEEQKRKTVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFTFFFYSATGSLTPLLP
VTYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSL
PSDQVMLVTDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQTLGKHRDRTGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTSHSQAFNFWDLIKLLCSVQTGSV
LFVAWFMGFGTGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTATFFSHKLIELIGHISKIKQGLLPSLEDLLFTTIAEGQEKIPVHK
FITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELTESAKKQSGGKVAD
TIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKTAIAVNDLGTETVHRTVGKEPSGLRFNKLFLNEDDKPHNPMVNAGA
IVVTSLIKQGVNNAEKFDTVMQFLNKMAGNETVGFSNATFQSERESGDRNFAIGTYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESAS
VMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMTDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_3156nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAA
TTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACA
ACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAG
TTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGAT
TATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACC
AAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATAT
GTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCA
ATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAAT
GAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAG
AAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGT
GTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGT
TTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATT
CTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGT
CACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGAT
CAAAGGGTAAAGTCAGTGATAAATCTTTTGTTTGCTGCATATACTGGAGATGTGTCTGCACTTCGAAGATTTGCTTTGTCAGCTATGGAC
ATGGAACAGCGGGACTATGATTCTAGAACAGCACTCCATGTAGCTGCTGCAGAGGGTCATGTTGAAGTTGTTAAATTTTTGCTGGAAGCC
TGCAAAGTAAACCCTTTCCCCAAGGACAGGTGGAATAACACTCCCATGGATGAAGCACTGCACTTTGGACACCATGATGTATTTAAAATT
CTCCAAGAATACCAAGTCCAGTACACACCTCAAGGAGATTCTGACAACGGGAAGGAAAATCAAACCGTCCATAAGAATCTTGATGGATTG

>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_2943nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAA
TTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACA
ACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAG
TTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGAT
TATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACC
AAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATAT
GTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCA
ATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAAT
GAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAG
AAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGT
GTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGT
TTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATT
CTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGT
CACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGAT
CAAAGGCATTCCTTTGGACCATTGGACTATGAAAGTCTCCAACAAGAACTTGCTTTAAAAGAGACAGTATGGAAAAAAGTGTCACCTGAG

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_3156nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAA
TTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACA
ACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAG
TTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGAT
TATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACC
AAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATAT
GTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCA
ATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAAT
GAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAG
AAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGT
GTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGT
TTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATT
CTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGT
CACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGAT
CAAAGGGTAAAGTCAGTGATAAATCTTTTGTTTGCTGCATATACTGGAGATGTGTCTGCACTTCGAAGATTTGCTTTGTCAGCTATGGAC
ATGGAACAGCGGGACTATGATTCTAGAACAGCACTCCATGTAGCTGCTGCAGAGGGTCATGTTGAAGTTGTTAAATTTTTGCTGGAAGCC
TGCAAAGTAAACCCTTTCCCCAAGGACAGGTGGAATAACACTCCCATGGATGAAGCACTGCACTTTGGACACCATGATGTATTTAAAATT
CTCCAAGAATACCAAGTCCAGTACACACCTCAAGGAGATTCTGACAACGGGAAGGAAAATCAAACCGTCCATAAGAATCTTGATGGATTG

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_2943nt
ATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCC
AGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACAT
TGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCT
GTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTT
TGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGA
TTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCA
ACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGAC
ACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTG
ACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTA
CCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTT
TTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGG
GGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGT
AAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGG
TTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCT
GAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTG
CTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACC
CTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATC
AGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAA
TTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACA
ACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAG
TTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGAT
TATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACC
AAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATAT
GTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCA
ATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAAT
GAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAG
AAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGT
GTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGT
TTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATT
CTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGT
CACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGAT
CAAAGGCATTCCTTTGGACCATTGGACTATGAAAGTCTCCAACAAGAACTTGCTTTAAAAGAGACAGTATGGAAAAAAGTGTCACCTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_6046nt
GTCGCAGCCCCGGAGGAGCGCGCGAGCAGCCCGGGATGGTGCGCGCTGCCCCGACAGCCGCCGCCCCGGCGCCCCGAGCCGCCGCCCCGT
GCTCCGGGGACAGGGCTCCCCGCGCCCCGCGCAGCTGAGCGCTGCCGCCGCCGCAGCAGACAGGATCTCTCTCAGTTACCCAGGCCGGAG
TGCAGTGGCGTGATCCTAGCTCACTGCAGCCTTGAACCCCTGGGCTCAAGTGATTCTCCTGCCTTGGCCTCCTGAATAGCTAGAACTACA
GATCAACAGTACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGAT
GAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCC
TCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAG
GTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAG
AGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAA
ATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAG
ATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCA
CCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGT
GAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCA
GGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAA
GAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTC
ACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTG
GGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTC
ATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAA
GGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCC
TTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGC
TTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCT
GAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAA
GATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAATTTATTACAGCACTCAAATCTACAGGATTGCGAACG
TCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACAACATCAGATGGTGTCATGCTAGACAAAGATCTTTTT
AAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAGTTTGTGATTCCTGACTTTATGTCTTTTACCTCACAC
ATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGATTATATTCCTCAACTGGCCAAATTCAGTCCCGATTTG
TGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACCAAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCT
TTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATATGTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAA
CTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCAATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAAT
AATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAATGAATATGTTGGATTCAGTAATGCAACGTTTCAGTCT
GAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAGAAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATA
TTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGTGTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGC
CCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGTTTGATGCATTCCTGTGGCATGTATGACTTCTCAGGG
CAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATTCTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGC
TGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGTCACGATCTTGTTTCTCTGTGTAATTTCCATAACTAT
GATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGATCAAAGGGTAAAGTCAGTGATAAATCTTTTGTTTGCT
GCATATACTGGAGATGTGTCTGCACTTCGAAGATTTGCTTTGTCAGCTATGGACATGGAACAGCGGGACTATGATTCTAGAACAGCACTC
CATGTAGCTGCTGCAGAGGGTCATGTTGAAGTTGTTAAATTTTTGCTGGAAGCCTGCAAAGTAAACCCTTTCCCCAAGGACAGGTGGAAT
AACACTCCCATGGATGAAGCACTGCACTTTGGACACCATGATGTATTTAAAATTCTCCAAGAATACCAAGTCCAGTACACACCTCAAGGA
GATTCTGACAACGGGAAGGAAAATCAAACCGTCCATAAGAATCTTGATGGATTGTTGTAATGGTCTCAAATCCCAAGATTTAAATCACTT
ACCTATTTAATTGTGGAAAATGATTATGAAGAACATGTGTATTTCTATCTGGTAGTGATGTATATTTTACATTTGTCATTTCAGTGTTAC
TGGAGTTTTCTTCATTGTGCACACAGGACAAATCTGATCTCTTTGGGAAAAAATAGAAATAAAACAATCTCCCTCCATAATGTGAGCAAT
ATTACCTCGTGCATTGTATAATTTGATGTAAAAGAAATAGTTACCAATGCTAGCTTGTGTGGTCTTCCATGATTTATTTGTGTTTTGTGA
ATTTTCAATTTATGGTGATGATCTGCTGATATGCATTTATAAAGTAAGCTCTGTTGTACAGTCTGTCCAAATGGGTCAAGGTTGCCTTTA
GAAGCAAATAGTGTGATTTTCAAGACTTCAAATACAAATTTAGTTTAAGTGTTTGAACAACTATATGCACTTACGGTTGTGTGTTTAAAA
TGTCTCTCTCACCCCCTAGCTTCATGATGTGACTCTTAAAAAACTATAATAGTTAACAACTGTTAGTAAGATAGACCAATTCTGATTAGA
CTTTATCAGGGAATCTGTTTAAGATATGTTTGGTGACCAAAACGTATGTGTGAATGTAGTTATAATGCTTTTGAAAAATTTTCCTTTTTC
TATATCCCCTTAGTCCAGCCTCTCTTCTCAGACATTTAGCTATCTGCCTCTTTCCTTTAGCTGGGAAAGTGAGAGCTGGCATACTATGCA
GTTTTTATGTTTTCCATAGTAAGTCAGAAAATGCCTCCTATTTCTGGCATCAGAACTTTGCCATTTGTCTACAGAAGACGAACCAGAGAC
AAAATTACTAAGTATAAATTAGTCAAGTTTATCAGTCTAAAAAACGAAGGGATGTGCAACTGCAGCTCTTTAAGAAGTTTTTTTTTTTTA
GCTTCTAGGGTAAAGATAAATTCAGAAATGCTCTAAGCTACCAAAGTTATTCTGAAAGTATGGGAACTGCTACAACTAACAAACATTTGT
TTCCAAGCCTGTCATTAAGAGTCTGCATCAAGAGATTTGTCCTCCTTGGGGGACCACTGGATCATTCCAGATTTCTTGTGATTTTTCTAT
TGTGTAATTCTTGGTGGGCTCTGTAGTTTAATAATAAGAAAAAGGCCATTTCATTTTAAATTGTGACCTATAATTCTTTGTCTTGGGTTG
GTAATTCAGGATTCATTTGGAAAGTGGGTAAAAGGGGCTTCAAAAAACGGATAGAACAGGATTTTCTAGGAGTTACACATACATTTTATC
CTGTCATACCTCGAGATAAAGTGGCATGTTAGTGAGGAGTTCTGATATTAAGCACACACACACATGCACACAAATGGACTTCTCTGAAGC
TGTGTTTAGTGAAATGAGCTCAAGTACATGAATGTTAGTTGTTATCACATACAGCAAATTCCTTTTTTTTTCTTTTTCTATGAGCACACT
CTGCTGCTTCTAAACTTTACATGCCTGATGGCACCTTACTCCAGCAGCCTCCAGGTGCTTTCATTTTCACTTCCAGTCTAAGCCAGTGGC
TCCTGCCACTGCCCTCCCATTACCTAGATGGCACCTCCTTTGGTGAAACCACGGCCAATGTTCCTTAGCTGCACCAGGCCCGAAGCTGTT
CCCATGCTTGAGCTTCCATGGGGAGGATGCTGAGTGAGCAGTTTCCTACCCCGTGGATCTAGCAAGCCATGGAGACAGGTAGCATTTGTA
AGATGCTGCACAGGAGCAGCATTATCCCCAAAGATATTACAGGGTAGACACGTTTTAACTGAAATCAATCAAGATAACTTTATTCAAAGA
GCAGCCCGCTTTGTGTGACTAAAATGAAACAAGACAGTTGAATTGTGTGACTTGAAGATTACCAATGATTTTGAGGCTTTTCTATAATAA
AAAGAGGTTCTAACCATTATTTGGGAACAAAGAGAGTTTTCATCTTTTTTCAGATCAAAACCATTCTGTAAAATCTTTGTTGTTTAATTA
AATGTGCCGTTATTTACCCCTGATGTTATTTATGACTATGTGCCGATTCCTGCTCGGGCTGTTTGCTGTTGGCTGGTAATAATATATTTG
ATTTAAATGCTGTTGACTGTGCTATTAACTGCTGCCGTCAGTAAACTCCAAAGATCTTTTTGTTTTGGCTTTAGTATCATATGTGCTTTT
TCTGTATCCTGAGCGCTCTATATGATCATGTTAATTTAAAGCTTTATACACATTGTTGTTTTTGCTGGTCTCATCTTTGGTAATATGCTA
TACCCCACTGCTGCCCGACACTGCCCTTTAGCTGCAGAGCTGGATTAGCTGTTGACCATTTGATGCTGTTGTCTGTCTGGCAGGGACTGA
ATGACCTGATGTCAGATTTAGATTCTTCCTGGGGATTACACAGCTATGAATGTATTTGCTTCTAAAACCTCCCAAAGTGAATCTAATCTT
AAAACTACAAGTTGTAAGTATTCTGAAATTGGGAAACATTTATTTTAAATGCAATCAGGTAGTGTTGCTTTTTACAGCATAATAAATATA

>In-frame_MFSD6_ENST00000392328_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_5694nt
GTCGCAGCCCCGGAGGAGCGCGCGAGCAGCCCGGGATGGTGCGCGCTGCCCCGACAGCCGCCGCCCCGGCGCCCCGAGCCGCCGCCCCGT
GCTCCGGGGACAGGGCTCCCCGCGCCCCGCGCAGCTGAGCGCTGCCGCCGCCGCAGCAGACAGGATCTCTCTCAGTTACCCAGGCCGGAG
TGCAGTGGCGTGATCCTAGCTCACTGCAGCCTTGAACCCCTGGGCTCAAGTGATTCTCCTGCCTTGGCCTCCTGAATAGCTAGAACTACA
GATCAACAGTACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGAT
GAAGAGGAACAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCC
TCCACAGAAACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAG
GTCTTTTATTTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAG
AGTGGACTACTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAA
ATTGTCCTCCTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAG
ATTCGCCCAACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCA
CCAAAAATGCGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGT
GAACCCACTCTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCA
GGAAGCGTAACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAA
GAAGTTGAAGCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTC
ACACTCCAGTATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTG
GGCATCGGGATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTC
ATCGTCTTCGGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAA
GGGAAAGAGGTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCC
TTCAACTTTTGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGC
TTCGTGTTCACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCT
GAGCTGACAGCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAA
GATTTGCTGTTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAATTTATTACAGCACTCAAATCTACAGGATTGCGAACG
TCTGATCCCAGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACAACATCAGATGGTGTCATGCTAGACAAAGATCTTTTT
AAAAAATGTGTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAGTTTGTGATTCCTGACTTTATGTCTTTTACCTCACAC
ATTGATGAGTTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGATTATATTCCTCAACTGGCCAAATTCAGTCCCGATTTG
TGGGGTGTGTCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACCAAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCT
TTGAAATATGCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATATGTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAA
CTATTTTTGAATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCAATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAAT
AATGCTGAAAAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAATGAATATGTTGGATTCAGTAATGCAACGTTTCAGTCT
GAAAGAGAAAGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAGAAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATA
TTAGACTTCTACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGTGTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGC
CCAATTACTGGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGTTTGATGCATTCCTGTGGCATGTATGACTTCTCAGGG
CAGTTTGCTTTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATTCTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGC
TGGTCTCCTCCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGTCACGATCTTGTTTCTCTGTGTAATTTCCATAACTAT
GATAATTTGAGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGATCAAAGGCATTCCTTTGGACCATTGGACTATGAAAGT
CTCCAACAAGAACTTGCTTTAAAAGAGACAGTATGGAAAAAAGTGTCACCTGAGTCAAATGAGGACATCTCTACAACTGTAGTATATAGA
ATGGAAAGTCTGGGAGAGAAAAGCTAAAGAAATGGGTTCTAGTTTCAGAATGTTTCTTCATTTAATCTTTCAAACATCTTTAGCTTTTTT
TTGCAAGTTATAAATATTTATTTGAGGTATTTTTTGTTCTCAATCTTGGGTGCTGGAGCCATAAAGCTTTTTTTTCCTTTTAATCTTTGT
ATAAAGGCAGTAGATTAAGAAGTGCATTTGTTGGTCTTTAAAAAGTATTTACAAGTACATAAATTTGCTTTATTTTTAAAAATACAAAAA
GGAAAAATTTAAATTTTTTTTGATGTAATTAAAATGTTAACTATGTGGTCAGATAATCCCATTTTACAATAGTAACAGAAAATTGTAATT
CTTAGTTCTAAAATTCACAAATTAAACTCATAAGTTTTGTTGCATTTTGTTTTTTCTTTTCCATTTTTAAAACTAATGTGATGTCTTTAG
TGGCAATAGAAGGTACTTCTATGCTAAATACAAAACTAAAAAGGCAAAATAATGAACCCCAAATTATTTTATTTAAAATAGCAGTGGATT
ATAAAATTAGCTTGTGTTTACATTTATGCCATTTTTGGTGATAGATTGGCTTTACATTTTAAAAAATTTATTTAAAAATTTATCAAATGC
TTTAAAATATGACTCCTACTTTTTTTATTTTGCAACTCCTCTGTTCTGTCAGAGTTGTTATATACAGGAGTGTCTTATGTTACTAAAACA
TTCCAGCCAAAGAATTTCAGATGTGAGATAATGATGTTTCATCAATAAAAAGCTATAATGGTTAGTTACTCAGAAGGAGAAACAGTGAGT
GTCTTCAAGTGAATTGTTCACCTAAACAATTTTATTTTCATATTATCCACATAACTTTTTCTATGTTATATTTAAATATGAATGGCAAAT
TTTGGTTTTTAGCTTTTACATTTTATTATCTTAATTTTATAAATGCTAATATTTCTTTTGTGATAAGTTATAGCATCTCATAAAGTTTGT
TCTATTTGAAGTTTTTTAGAGTACTTGAGAAATGAATTTAGTCTGCAGGTAGTAAGTATGCTACTAAAATACGTTAGATCTAAATCCTTT
TATTTGGTATAAAAATGCAATATTGAGAATCAAAACTTGTTTTTAAGAGAACTATAGATTCTACACAACCTGATTTCAAGTAATTATTCA
TAGTATTTATAGTTGTCTTGGCAAAGTGATTGTAAAATTCTGTAGGACCTATTCACACTTCTTCCTTCTTCCATATACTTCTCTGGTTTT
CCCCATAGTTCCCCTATAATTTCAAGTTTGTTGAAACCTGTTAATTTTAGTGGGGGATTAGAAGAAAAACTTGGTGGTTTCTTAGCATGA
TGGTGTATGTATGTGGTAATGGAAAGTCTGTAAAAGTAAATATAGTGTAGCAAAAAAGATTTCACTGAGTATTTTAGATACTAGTGCAAA
TAAAGATAGAAAATCTTGATCATAATGTCTTAAGTTTGGGAACTGTGATATTAAGAAAAGAAATTCCCTTCTAGAGGTGCTGGCCAAAAA
GCCTTTTGGGCTAACTTAAGTATTAAATTTATATATTTAAATAATTATATTTTAAGTTGTAGAGGATTTTCCCAAGGATTTTATGCTTAC
TTGAATGTTCTTTGAATGTTCAGATGCATATCCTAACTGGATGCTTCTCAAGGCCTTACTGCATATTTGTGTTGCATATTTATGTTAGTT
GCACCAGGGCCATTTGTAGTTTGGGCAACCGAATGCCTTAATTGGAAAAAAGGCATTGTGGTTTCCCCTATGATCTAAATTGTTACATTT
TACCATTTCATTCCGAAGTTGGTTTTACTTTATTAAATGAAGATTTAGTTTTCATATCGTATACATAGCTGTATAGATTTCAAAATTAGG
TTGTTAATTTGTGTCACTTACTATTTTTGTGTTGGTAATGCTTTAAATGCATACTTAAAAATGAAGTACTGTTATCTAAGCTACTGTGTT
TAGAAAATGTTAAGAATGAGCAGAAATTTTTATAGAAAAGTATAAACGGAAGAAGAGATAAGATACTGCGAATAGGCCCTCAAACTTAAA
AAAGAAAAAACTTTGCCAGTTTTAAGGACATATTTTGATTCTTTCAGTATTCTTAACACCTTTTTAAACAAAGTTCTTGATAGTACCCAC
TATTATTGGGTTTGTTTTATGCCATTATTGATTCTTGATATTCAAGCATTTACAATGTAGCATATTTGATTTTCTTTTTTCTTTCTTTTT
TTGGCATCATTAACATTTCATTTGAAATGCATATTGTTCTTGAAGTACTTTGTTTTTAGCATAAATGTTGTGCATTTTATCTTAGTGTTT
GGATGAAAACATTTGTGTTGTTTAGCTTTCATTTGCTTTGTATATTTAATAATGTACCTTTATTTTCCAGTATGCCTACATTTTGTATTG

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000320717_chr2_191759878_+_5857nt
CTTAATTTCCTGCAAGATGAAGTTCTGTGTTTACATGTTATGATTTTCATTACTAAGCCATCTTTTAAATTTTACTTTACAGATCAACAG
TACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAA
CAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAA
ACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTAT
TTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTA
CTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTC
CTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCA
ACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATG
CGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACT
CTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTA
ACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAA
GCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAG
TATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGG
ATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTC
GGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAG
GTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTT
TGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTC
ACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACA
GCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTG
TTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAATTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCC
AGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACAACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGT
GTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAGTTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAG
TTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGATTATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTG
TCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACCAAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATAT
GCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATATGTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTG
AATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCAATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAA
AAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAATGAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAA
AGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAGAAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTC
TACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGTGTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACT
GGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGTTTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCT
TTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATTCTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCT
CCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGTCACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTG
AGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGATCAAAGGGTAAAGTCAGTGATAAATCTTTTGTTTGCTGCATATACT
GGAGATGTGTCTGCACTTCGAAGATTTGCTTTGTCAGCTATGGACATGGAACAGCGGGACTATGATTCTAGAACAGCACTCCATGTAGCT
GCTGCAGAGGGTCATGTTGAAGTTGTTAAATTTTTGCTGGAAGCCTGCAAAGTAAACCCTTTCCCCAAGGACAGGTGGAATAACACTCCC
ATGGATGAAGCACTGCACTTTGGACACCATGATGTATTTAAAATTCTCCAAGAATACCAAGTCCAGTACACACCTCAAGGAGATTCTGAC
AACGGGAAGGAAAATCAAACCGTCCATAAGAATCTTGATGGATTGTTGTAATGGTCTCAAATCCCAAGATTTAAATCACTTACCTATTTA
ATTGTGGAAAATGATTATGAAGAACATGTGTATTTCTATCTGGTAGTGATGTATATTTTACATTTGTCATTTCAGTGTTACTGGAGTTTT
CTTCATTGTGCACACAGGACAAATCTGATCTCTTTGGGAAAAAATAGAAATAAAACAATCTCCCTCCATAATGTGAGCAATATTACCTCG
TGCATTGTATAATTTGATGTAAAAGAAATAGTTACCAATGCTAGCTTGTGTGGTCTTCCATGATTTATTTGTGTTTTGTGAATTTTCAAT
TTATGGTGATGATCTGCTGATATGCATTTATAAAGTAAGCTCTGTTGTACAGTCTGTCCAAATGGGTCAAGGTTGCCTTTAGAAGCAAAT
AGTGTGATTTTCAAGACTTCAAATACAAATTTAGTTTAAGTGTTTGAACAACTATATGCACTTACGGTTGTGTGTTTAAAATGTCTCTCT
CACCCCCTAGCTTCATGATGTGACTCTTAAAAAACTATAATAGTTAACAACTGTTAGTAAGATAGACCAATTCTGATTAGACTTTATCAG
GGAATCTGTTTAAGATATGTTTGGTGACCAAAACGTATGTGTGAATGTAGTTATAATGCTTTTGAAAAATTTTCCTTTTTCTATATCCCC
TTAGTCCAGCCTCTCTTCTCAGACATTTAGCTATCTGCCTCTTTCCTTTAGCTGGGAAAGTGAGAGCTGGCATACTATGCAGTTTTTATG
TTTTCCATAGTAAGTCAGAAAATGCCTCCTATTTCTGGCATCAGAACTTTGCCATTTGTCTACAGAAGACGAACCAGAGACAAAATTACT
AAGTATAAATTAGTCAAGTTTATCAGTCTAAAAAACGAAGGGATGTGCAACTGCAGCTCTTTAAGAAGTTTTTTTTTTTTAGCTTCTAGG
GTAAAGATAAATTCAGAAATGCTCTAAGCTACCAAAGTTATTCTGAAAGTATGGGAACTGCTACAACTAACAAACATTTGTTTCCAAGCC
TGTCATTAAGAGTCTGCATCAAGAGATTTGTCCTCCTTGGGGGACCACTGGATCATTCCAGATTTCTTGTGATTTTTCTATTGTGTAATT
CTTGGTGGGCTCTGTAGTTTAATAATAAGAAAAAGGCCATTTCATTTTAAATTGTGACCTATAATTCTTTGTCTTGGGTTGGTAATTCAG
GATTCATTTGGAAAGTGGGTAAAAGGGGCTTCAAAAAACGGATAGAACAGGATTTTCTAGGAGTTACACATACATTTTATCCTGTCATAC
CTCGAGATAAAGTGGCATGTTAGTGAGGAGTTCTGATATTAAGCACACACACACATGCACACAAATGGACTTCTCTGAAGCTGTGTTTAG
TGAAATGAGCTCAAGTACATGAATGTTAGTTGTTATCACATACAGCAAATTCCTTTTTTTTTCTTTTTCTATGAGCACACTCTGCTGCTT
CTAAACTTTACATGCCTGATGGCACCTTACTCCAGCAGCCTCCAGGTGCTTTCATTTTCACTTCCAGTCTAAGCCAGTGGCTCCTGCCAC
TGCCCTCCCATTACCTAGATGGCACCTCCTTTGGTGAAACCACGGCCAATGTTCCTTAGCTGCACCAGGCCCGAAGCTGTTCCCATGCTT
GAGCTTCCATGGGGAGGATGCTGAGTGAGCAGTTTCCTACCCCGTGGATCTAGCAAGCCATGGAGACAGGTAGCATTTGTAAGATGCTGC
ACAGGAGCAGCATTATCCCCAAAGATATTACAGGGTAGACACGTTTTAACTGAAATCAATCAAGATAACTTTATTCAAAGAGCAGCCCGC
TTTGTGTGACTAAAATGAAACAAGACAGTTGAATTGTGTGACTTGAAGATTACCAATGATTTTGAGGCTTTTCTATAATAAAAAGAGGTT
CTAACCATTATTTGGGAACAAAGAGAGTTTTCATCTTTTTTCAGATCAAAACCATTCTGTAAAATCTTTGTTGTTTAATTAAATGTGCCG
TTATTTACCCCTGATGTTATTTATGACTATGTGCCGATTCCTGCTCGGGCTGTTTGCTGTTGGCTGGTAATAATATATTTGATTTAAATG
CTGTTGACTGTGCTATTAACTGCTGCCGTCAGTAAACTCCAAAGATCTTTTTGTTTTGGCTTTAGTATCATATGTGCTTTTTCTGTATCC
TGAGCGCTCTATATGATCATGTTAATTTAAAGCTTTATACACATTGTTGTTTTTGCTGGTCTCATCTTTGGTAATATGCTATACCCCACT
GCTGCCCGACACTGCCCTTTAGCTGCAGAGCTGGATTAGCTGTTGACCATTTGATGCTGTTGTCTGTCTGGCAGGGACTGAATGACCTGA
TGTCAGATTTAGATTCTTCCTGGGGATTACACAGCTATGAATGTATTTGCTTCTAAAACCTCCCAAAGTGAATCTAATCTTAAAACTACA
AGTTGTAAGTATTCTGAAATTGGGAAACATTTATTTTAAATGCAATCAGGTAGTGTTGCTTTTTACAGCATAATAAATATATGTATCAAA

>In-frame_MFSD6_ENST00000281416_chr2_191302287_+_GLS_ENST00000338435_chr2_191759878_+_5505nt
CTTAATTTCCTGCAAGATGAAGTTCTGTGTTTACATGTTATGATTTTCATTACTAAGCCATCTTTTAAATTTTACTTTACAGATCAACAG
TACAAATTCTGAAGTTTGTAAACTTGCTGATGGTGGTGGTAAGCCATGGCAGATGATAAAGTTGCTATCTTAACGGATGATGAAGAGGAA
CAGAAGAGAAAGTATGTGCTTGCAGATCCCTTTAATGGTATTTCCAGGGAACCAGAACCACCTTCGAATGAAACACCTTCCTCCACAGAA
ACATCTGCTATTCCTGAGGAGGAAATAGACTGGATAGAGAAACATTGTGTTAAGATAAACAACGATCTTCTAATTTCCAAGGTCTTTTAT
TTTTTCTTTTACTCTGCCTATGGCTCTCTCTATCCCCTTTTGCCTGTGTATTACAAACAGCTGGGAATGTCTCCAAGCCAGAGTGGACTA
CTAGTAGGTATTCGTTACTTCATTGAATTCTGCAGTGCCCCCTTTTGGGGTGTAGTTGCAGACCGCTTTAAAAAAGGCAAAATTGTCCTC
CTCTTTTCTCTTTTGTGTTGGGTTTTATTCAACCTGGGCATTGGATTTGTCAAACCTGCTACCTTGAGATGTGTACCAAAGATTCGCCCA
ACAACTCACCCCACCAATGCAAGTCACCAGTTAACTATCCTGCCAACAAATTCTTCCTTTACCTCTTTCCTCACCATATCACCAAAAATG
CGTGAGAAAAGAAACCTTTTGGAAACAAGGCTCAATGTCTCAGACACCGTTACTTTGCCAACAGCTCCAAACATGAACAGTGAACCCACT
CTGCAGCCCCAGACAGGTGAAATTACTAACCGTATGATGGACTTGACTTTGAACTCAAGCACAGCAACCCCTGTCTCCCCAGGAAGCGTA
ACCAAGGAGACAACCACTGTTATTGTTACCACCACCAAATCTTTACCTTCTGACCAAGTCATGCTTGTTTATGATCAACAAGAAGTTGAA
GCTATATTCTTGGTGATCTTGGTAGTTGTCATAATAGGAGAATTTTTCAGTGCCTCTTCTGTCACAATCGTAGACACGGTCACACTCCAG
TATCTGGGAAAACACAGAGATCGCTATGGGTTGCAGCGCATGTGGGGCTCCCTGGGCTGGGGCCTGGCGATGCTGTCTGTGGGCATCGGG
ATCGACTACACCCACATCGAAGTGCTCATCGATGGAAAGGGGTGTAAGCCCCCCGAGTACAGGAATTACCAGATCGTCTTCATCGTCTTC
GGCGTTCTCATGACCATGGCCTTGATCGTTGCCACTCAGTTCCGGTTCCGCTACAACCATTTCAAAAACGATGATTCTAAAGGGAAAGAG
GTGGAGATCCCGCAGGTGGAAAGGAACAACTCTACAGAGTCCTCTGAGGAGACACCAACCACCACAAGCCACTCGCAGGCCTTCAACTTT
TGGGACTTAATCAAGCTGCTCTGCAGCGTGCAGTATGGCTCAGTGCTGTTTGTGGCTTGGTTCATGGGTTTTGGATATGGCTTCGTGTTC
ACCTTTCTCTACTGGCATTTGGAAGACCTCAATGGAACTACAACCCTCTTTGGGGTCTGTTCAGTCCTGAGTCATGTGTCTGAGCTGACA
GCATATTTTTTTAGTCACAAGCTTATTGAATTGATCGGCCACATCAGTAAAATAAAACAGGGTCTGTTACCTAGCTTGGAAGATTTGCTG
TTCTATACAATTGCTGAAGGACAAGAGAAAATACCTGTTCATAAATTTATTACAGCACTCAAATCTACAGGATTGCGAACGTCTGATCCC
AGGTTGAAAGAGTGTATGGATATGTTAAGATTAACTCTTCAAACAACATCAGATGGTGTCATGCTAGACAAAGATCTTTTTAAAAAATGT
GTTCAGAGCAACATTGTTTTGTTGACACAAGCATTTAGAAGAAAGTTTGTGATTCCTGACTTTATGTCTTTTACCTCACACATTGATGAG
TTATATGAAAGTGCTAAAAAGCAGTCTGGAGGAAAGGTTGCAGATTATATTCCTCAACTGGCCAAATTCAGTCCCGATTTGTGGGGTGTG
TCTGTTTGTACAGTAGATGGACAGAGGCATTCTACTGGAGATACCAAAGTTCCCTTCTGTCTTCAGTCCTGTGTAAAACCTTTGAAATAT
GCCATTGCTGTTAATGATCTTGGAACTGAATATGTGCATCGATATGTTGGAAAAGAGCCGAGTGGACTAAGATTCAACAAACTATTTTTG
AATGAAGATGATAAACCACATAATCCTATGGTAAATGCTGGAGCAATTGTTGTGACTTCACTAATAAAGCAAGGAGTAAATAATGCTGAA
AAATTTGACTATGTCATGCAGTTTTTGAATAAGATGGCTGGTAATGAATATGTTGGATTCAGTAATGCAACGTTTCAGTCTGAAAGAGAA
AGTGGAGATCGAAATTTTGCAATAGGATATTACTTAAAAGAAAAGAAGTGTTTTCCAGAAGGCACAGACATGGTTGGTATATTAGACTTC
TACTTCCAGCTGTGCTCCATTGAAGTGACTTGTGAATCAGCCAGTGTGATGGCTGCGACACTGGCTAATGGTGGTTTCTGCCCAATTACT
GGTGAAAGAGTACTGAGCCCTGAAGCAGTTCGAAATACATTGAGTTTGATGCATTCCTGTGGCATGTATGACTTCTCAGGGCAGTTTGCT
TTCCATGTTGGTCTTCCTGCAAAATCTGGAGTTGCTGGGGGCATTCTTTTAGTTGTCCCCAATGTTATGGGTATGATGTGCTGGTCTCCT
CCTCTGGATAAGATGGGCAACAGTGTTAAGGGAATTCACTTTTGTCACGATCTTGTTTCTCTGTGTAATTTCCATAACTATGATAATTTG
AGACACTTTGCAAAAAAACTTGATCCTCGAAGAGAAGGTGGTGATCAAAGGCATTCCTTTGGACCATTGGACTATGAAAGTCTCCAACAA
GAACTTGCTTTAAAAGAGACAGTATGGAAAAAAGTGTCACCTGAGTCAAATGAGGACATCTCTACAACTGTAGTATATAGAATGGAAAGT
CTGGGAGAGAAAAGCTAAAGAAATGGGTTCTAGTTTCAGAATGTTTCTTCATTTAATCTTTCAAACATCTTTAGCTTTTTTTTGCAAGTT
ATAAATATTTATTTGAGGTATTTTTTGTTCTCAATCTTGGGTGCTGGAGCCATAAAGCTTTTTTTTCCTTTTAATCTTTGTATAAAGGCA
GTAGATTAAGAAGTGCATTTGTTGGTCTTTAAAAAGTATTTACAAGTACATAAATTTGCTTTATTTTTAAAAATACAAAAAGGAAAAATT
TAAATTTTTTTTGATGTAATTAAAATGTTAACTATGTGGTCAGATAATCCCATTTTACAATAGTAACAGAAAATTGTAATTCTTAGTTCT
AAAATTCACAAATTAAACTCATAAGTTTTGTTGCATTTTGTTTTTTCTTTTCCATTTTTAAAACTAATGTGATGTCTTTAGTGGCAATAG
AAGGTACTTCTATGCTAAATACAAAACTAAAAAGGCAAAATAATGAACCCCAAATTATTTTATTTAAAATAGCAGTGGATTATAAAATTA
GCTTGTGTTTACATTTATGCCATTTTTGGTGATAGATTGGCTTTACATTTTAAAAAATTTATTTAAAAATTTATCAAATGCTTTAAAATA
TGACTCCTACTTTTTTTATTTTGCAACTCCTCTGTTCTGTCAGAGTTGTTATATACAGGAGTGTCTTATGTTACTAAAACATTCCAGCCA
AAGAATTTCAGATGTGAGATAATGATGTTTCATCAATAAAAAGCTATAATGGTTAGTTACTCAGAAGGAGAAACAGTGAGTGTCTTCAAG
TGAATTGTTCACCTAAACAATTTTATTTTCATATTATCCACATAACTTTTTCTATGTTATATTTAAATATGAATGGCAAATTTTGGTTTT
TAGCTTTTACATTTTATTATCTTAATTTTATAAATGCTAATATTTCTTTTGTGATAAGTTATAGCATCTCATAAAGTTTGTTCTATTTGA
AGTTTTTTAGAGTACTTGAGAAATGAATTTAGTCTGCAGGTAGTAAGTATGCTACTAAAATACGTTAGATCTAAATCCTTTTATTTGGTA
TAAAAATGCAATATTGAGAATCAAAACTTGTTTTTAAGAGAACTATAGATTCTACACAACCTGATTTCAAGTAATTATTCATAGTATTTA
TAGTTGTCTTGGCAAAGTGATTGTAAAATTCTGTAGGACCTATTCACACTTCTTCCTTCTTCCATATACTTCTCTGGTTTTCCCCATAGT
TCCCCTATAATTTCAAGTTTGTTGAAACCTGTTAATTTTAGTGGGGGATTAGAAGAAAAACTTGGTGGTTTCTTAGCATGATGGTGTATG
TATGTGGTAATGGAAAGTCTGTAAAAGTAAATATAGTGTAGCAAAAAAGATTTCACTGAGTATTTTAGATACTAGTGCAAATAAAGATAG
AAAATCTTGATCATAATGTCTTAAGTTTGGGAACTGTGATATTAAGAAAAGAAATTCCCTTCTAGAGGTGCTGGCCAAAAAGCCTTTTGG
GCTAACTTAAGTATTAAATTTATATATTTAAATAATTATATTTTAAGTTGTAGAGGATTTTCCCAAGGATTTTATGCTTACTTGAATGTT
CTTTGAATGTTCAGATGCATATCCTAACTGGATGCTTCTCAAGGCCTTACTGCATATTTGTGTTGCATATTTATGTTAGTTGCACCAGGG
CCATTTGTAGTTTGGGCAACCGAATGCCTTAATTGGAAAAAAGGCATTGTGGTTTCCCCTATGATCTAAATTGTTACATTTTACCATTTC
ATTCCGAAGTTGGTTTTACTTTATTAAATGAAGATTTAGTTTTCATATCGTATACATAGCTGTATAGATTTCAAAATTAGGTTGTTAATT
TGTGTCACTTACTATTTTTGTGTTGGTAATGCTTTAAATGCATACTTAAAAATGAAGTACTGTTATCTAAGCTACTGTGTTTAGAAAATG
TTAAGAATGAGCAGAAATTTTTATAGAAAAGTATAAACGGAAGAAGAGATAAGATACTGCGAATAGGCCCTCAAACTTAAAAAAGAAAAA
ACTTTGCCAGTTTTAAGGACATATTTTGATTCTTTCAGTATTCTTAACACCTTTTTAAACAAAGTTCTTGATAGTACCCACTATTATTGG
GTTTGTTTTATGCCATTATTGATTCTTGATATTCAAGCATTTACAATGTAGCATATTTGATTTTCTTTTTTCTTTCTTTTTTTGGCATCA
TTAACATTTCATTTGAAATGCATATTGTTCTTGAAGTACTTTGTTTTTAGCATAAATGTTGTGCATTTTATCTTAGTGTTTGGATGAAAA
CATTTGTGTTGTTTAGCTTTCATTTGCTTTGTATATTTAATAATGTACCTTTATTTTCCAGTATGCCTACATTTTGTATTGCACAATAAA


Top

FusionGenePPI for MFSD6_GLS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MFSD6GLSSNTA1, CUL5, ATXN10, ATF2, CAPN1, EIF5A, GDA, GNS, MVD, MYL12A, PEPD, MRPL43, METTL20, C21orf33, NUFIP1, MRPL4, PPA2, ATF6B, HMGCL, ETFA, MRM1, RARS2, TNF, OXLD1, UNK, SIRT5, MCM2, SPATA20, COQ9, PTPMT1, CISD3, CCL22, NDUFS7, SNRNP27, CFAP45, TRMT61B, YBEY, OTC, ACAD9, FGB, LAMP3, ATCAY


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MFSD6_GLS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneGLSO94925DB00142Glutamic AcidGlutaminase kidney isoform, mitochondrialsmall moleculeapproved|nutraceutical

Top

RelatedDiseases for MFSD6_GLS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGLSC0000786Spontaneous abortion1CTD_human
TgeneGLSC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneGLSC0029408Degenerative polyarthritis1CTD_human
TgeneGLSC0036341Schizophrenia1PSYGENET