FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21776

FusionGeneSummary for MFSD2A_SLC5A9

check button Fusion gene summary
Fusion gene informationFusion gene name: MFSD2A_SLC5A9
Fusion gene ID: 21776
HgeneTgene
Gene symbol

MFSD2A

SLC5A9

Gene ID

84879

200010

Gene namemajor facilitator superfamily domain containing 2Asolute carrier family 5 member 9
SynonymsMCPH15|MFSD2|NLS1SGLT4
Cytomap

1p34.2

1p33

Type of geneprotein-codingprotein-coding
Descriptionsodium-dependent lysophosphatidylcholine symporter 1major facilitator superfamily domain-containing protein 2Asodium-dependent LPC symporter 1sodium/glucose cotransporter 4Na(+)/glucose cotransporter 4hSGLT4solute carrier family 5 (sodium/glucose cotransporter), member 9solute carrier family 5 (sodium/sugar cotransporter), member 9
Modification date2018032920180329
UniProtAcc

Q8NA29

Q2M3M2

Ensembl transtripts involved in fusion geneENST00000372811, ENST00000420632, 
ENST00000372809, ENST00000480630, 
ENST00000533824, ENST00000438567, 
ENST00000236495, ENST00000420136, 
ENST00000471020, 
Fusion gene scores* DoF score4 X 4 X 3=481 X 1 X 1=1
# samples 51
** MAII scorelog2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: MFSD2A [Title/Abstract] AND SLC5A9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMFSD2A

GO:0051977

lysophospholipid transport

24828044


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-58-8392-01AMFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000372811ENST00000533824MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
In-frameENST00000372811ENST00000438567MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
In-frameENST00000372811ENST00000236495MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
5CDS-3UTRENST00000372811ENST00000420136MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
5CDS-intronENST00000372811ENST00000471020MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000420632ENST00000533824MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000420632ENST00000438567MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000420632ENST00000236495MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3UTRENST00000420632ENST00000420136MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-intronENST00000420632ENST00000471020MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
In-frameENST00000372809ENST00000533824MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
In-frameENST00000372809ENST00000438567MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
In-frameENST00000372809ENST00000236495MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
5CDS-3UTRENST00000372809ENST00000420136MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
5CDS-intronENST00000372809ENST00000471020MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000480630ENST00000533824MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000480630ENST00000438567MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3CDSENST00000480630ENST00000236495MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-3UTRENST00000480630ENST00000420136MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+
intron-intronENST00000480630ENST00000471020MFSD2Achr1

40424497

+SLC5A9chr1

48703351

+

Top

FusionProtFeatures for MFSD2A_SLC5A9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MFSD2A

Q8NA29

SLC5A9

Q2M3M2

Sodium-dependent lysophosphatidylcholine (LPC)symporter, which plays an essential role for blood-brain barrierformation and function (By similarity). Specifically expressed inendothelium of the blood-brain barrier of micro-vessels andtransports LPC into the brain (By similarity). Transport of LPC isessential because it constitutes the major mechanism by whichdocosahexaenoic acid (DHA), an omega-3 fatty acid that isessential for normal brain growth and cognitive function, entersthe brain (PubMed:26005868). Transports LPC carrying long-chainfatty acids such LPC oleate and LPC palmitate with a minimum acylchain length of 14 carbons (By similarity). Does not transportdocosahexaenoic acid in unesterified fatty acid (By similarity).Specifically required for blood-brain barrier formation andfunction, probably by mediating lipid transport (By similarity).Not required for central nervous system vascular morphogenesis (Bysimilarity). Acts as a transporter for tunicamycin, an inhibitorof asparagine-linked glycosylation (PubMed:21677192). In placenta,acts as a receptor for ERVFRD-1/syncytin-2 and is required fortrophoblast fusion (PubMed:18988732, PubMed:23177091).{ECO:0000250|UniProtKB:Q9DA75, ECO:0000269|PubMed:18988732,ECO:0000269|PubMed:21677192, ECO:0000269|PubMed:23177091,ECO:0000269|PubMed:26005868}. Involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose. {ECO:0000269|PubMed:15607332}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+31435_38130544Compositional biasNote=Poly-Lys
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+31435_38117531Compositional biasNote=Poly-Lys
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314102_128130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+3141_46130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+31468_80130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+3141_46117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+31468_80117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+31447_67130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+31481_101130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+31447_67117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+31481_101117531TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015481_487455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015509_530455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015552_660455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914449_459430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914481_487430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914509_530430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914552_660430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015460_480455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015488_508455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015531_551455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015661_681455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914428_448430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914460_480430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914488_508430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914531_551430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914661_681430682TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314150_160130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314182_256130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314278_310130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314332_344130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314366_370130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314392_393130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314415_437130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314459_480130544Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314502_543130544Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314102_128117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314150_160117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314182_256117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314278_310117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314332_344117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314366_370117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314392_393117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314415_437117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314459_480117531Topological domainExtracellular
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314502_543117531Topological domainCytoplasmic
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314129_149130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314161_181130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314257_277130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314311_331130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314345_365130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314371_391130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314394_414130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314438_458130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372809+314481_501130544TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314129_149117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314161_181117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314257_277117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314311_331117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314345_365117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314371_391117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314394_414117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314438_458117531TransmembraneHelical
HgeneMFSD2Achr1:40424497chr1:48703351ENST00000372811+314481_501117531TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015136_157455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015179_190455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+10151_36455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015212_217455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015239_275455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015297_317455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015339_383455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015407_427455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015449_459455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+101558_75455707Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+101599_114455707Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914136_157430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914179_190430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+9141_36430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914212_217430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914239_275430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914297_317430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914339_383430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914407_427430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+91458_75430682Topological domainCytoplasmic
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+91499_114430682Topological domainExtracellular
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015115_135455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015158_178455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015191_211455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015218_238455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015276_296455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015318_338455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+101537_57455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015384_406455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+1015428_448455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000236495+101576_98455707TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914115_135430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914158_178430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914191_211430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914218_238430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914276_296430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914318_338430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+91437_57430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+914384_406430682TransmembraneHelical
TgeneSLC5A9chr1:40424497chr1:48703351ENST00000438567+91476_98430682TransmembraneHelical


Top

FusionGeneSequence for MFSD2A_SLC5A9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_369aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGR
AWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIFCKRVTEPGAFWGL
VFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHEST
PEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRHVCNINAVLLLAIN

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_369aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGR
AWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIFCKRVTEPGAFWGL
VFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHEST
PEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRHVCNINAVLLLAIN

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_369aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGR
AWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIFCKRVTEPGAFWGL
VFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHEST
PEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRHVCNINAVLLLAIN

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_382aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQKDEEVVFCFSSFQV
GPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNC
PLSELEKEAHESTPEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_382aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQKDEEVVFCFSSFQV
GPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNC
PLSELEKEAHESTPEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_382aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTGCALGFFLQIYLLDVAQKDEEVVFCFSSFQV
GPFSASIILFVGRAWDAITDPLVGLCISKSPWTCLGRLMPXVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNC
PLSELEKEAHESTPEISERPAGECPAGGGAAENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_1107nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGA
GCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTT
GTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTC
ACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTC
GTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCA
GTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACT
CCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACA
CCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCC
CCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCT
GCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAAC

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_1107nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGA
GCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTT
GTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTC
ACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTC
GTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCA
GTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACT
CCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACA
CCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCC
CCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCT
GCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAAC

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_1107nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGA
GCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTT
GTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTC
ACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTC
GTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCA
GTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACT
CCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACA
CCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCC
CCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCT
GCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAAC

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_1146nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTG
GGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCC
CCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGC
TCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTC
TGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATAC
CCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTC
ACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGC
CCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCG
GCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCT
GGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACAT

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_1146nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTG
GGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCC
CCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGC
TCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTC
TGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATAC
CCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTC
ACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGC
CCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCG
GCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCT
GGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACAT

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_1146nt
ATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTG
AAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGC
TGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGGATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTG
GGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCC
CCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGC
TCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTC
TGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATAC
CCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTC
ACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGC
CCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCG
GCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCT
GGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_1328nt
GAGGGGGCGTGCAGCAGAGTGCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCT
TGGGAGGAGCAGCGGCCTGCGGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGG
CGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAA
GAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTT
CCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCAC
AGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGT
CATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCC
ACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGT
GGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCA
CTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACA
GCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAG
GCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGG
AAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCT
GACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAACATCTTCCTCTGGGGCTA

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_2367nt
GAGGGGGCGTGCAGCAGAGTGCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCT
TGGGAGGAGCAGCGGCCTGCGGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGG
CGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAA
GAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTT
CCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCAC
AGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGT
CATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCC
ACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGT
GGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCA
CTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACA
GCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAG
GCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGG
AAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCT
GACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAACATCTTCCTCTGGGGCTA
TTTTGCGTGATTCCACAGACCTGGCTTCAGTGTAGACAGATTAAACAAAGCCCAAGCCTGTCAGCCACAGAAACAGGCTCTCCTCTTACT
TTGCTGTCTAAACTGGAGATCACAGAAGTCAAGACTGCAAGCTCCCCTGAAGAGAATCCAACTCAACCTGCACACTTGACAAGTGGAGAA
ACAGAAGCCCAGAGAGAGCACTGGGTTTGTTCAGGACCACCCAGAAGGTGTCACACGGGGTTTCCCCACTCTTTCTGATATATTGCCTTA
CAGACCTACCTCAAACACACTGTTTCCACCCTCTTCTTGAATGTATTCAGTAGCCTTTACTGAATGTGTGTCTTGAGAGTAGAAAAATGG
AGGATACAAGAAAAGGAGCAGGAAGAAATTTGCAAAAATCCAAGAGCACCTTTGCTCCCCCTTATCCTCCTTCCTCTTCCCCTTTCTAGT
TCCCCTACCTCTCTATCTTTCTATTCTCACCAATAATCTCTTTGTTGCATGAATTTACCCAGGAGAGTCCTATATTTCCATTGGTGGCTC
CACAGTGGTGGCTGTCAGACCCGAAGGGGTGGGGAGCCAAGGGTGGACTTTAAGCATGGTGACAGATGGTATTTTGGGCAGAAAGCTCTT
AGACAATGGACTATCCAAAGCACTATTTAAATTCTGCCTCTTCCTACTCTCTAACCCAAATATGCACAAACTCTCTATGGCCTTGAGAAG
CAGTTGGAGAGACATGACTTGTTAAAACCTCAAGGAATCAAGACATGTTACTCTGTATTTAAGGGTAAGCCCCACAGCGGGCAGCACAAA
CAGCCTGGGAGCCACTGTGCCTGTGCTTCTCTGTCCTTCTCCCTTTGCTTGCCATGAATCCGCATACCTTGGAATACACTGTGACCCCAG
TTAAGTGTCCCTTCGCCAGGAAGCTGCCGCAACGTCCAGACCTGGGTCAAGTTCCCACTCCTGCTCCCATAGCCTTGACCTGCTTCTGTC
ACAGCACTGATCACACTGAGATGGAAGACTCCAGGGGGCAAGGACCAAGGGCCATATCCCAAGTGACTTTGTACCCAGAAAATAACAGCT

>In-frame_MFSD2A_ENST00000372811_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_2371nt
GAGGGGGCGTGCAGCAGAGTGCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCT
TGGGAGGAGCAGCGGCCTGCGGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGG
CGCCGAGAGCGGCTCCGCGGCGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAA
GAAGAAACAACAGTTGTCTGTTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTT
CCTTCAGATCTACCTATTGGATGTGGCTCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCCGAGCCTGGGATGCCATCAC
AGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGTTTGTGGTGTTCCTGGTTGT
CATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTGTCACCAGTTACCTGGCCCC
ACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGT
GGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAGCAGTGCTGAAGGACTTCCA
CTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACA
GCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCACACCGGAGATATCCGAGAG
GCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGG
AAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGGCTGCGCTAGAACAGAAGCT
GACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAACATCTTCCTCTGGGGCTA
TTTTGCGTGATTCCACAGACCTGGCTTCAGTGTAGACAGATTAAACAAAGCCCAAGCCTGTCAGCCACAGAAACAGGCTCTCCTCTTACT
TTGCTGTCTAAACTGGAGATCACAGAAGTCAAGACTGCAAGCTCCCCTGAAGAGAATCCAACTCAACCTGCACACTTGACAAGTGGAGAA
ACAGAAGCCCAGAGAGAGCACTGGGTTTGTTCAGGACCACCCAGAAGGTGTCACACGGGGTTTCCCCACTCTTTCTGATATATTGCCTTA
CAGACCTACCTCAAACACACTGTTTCCACCCTCTTCTTGAATGTATTCAGTAGCCTTTACTGAATGTGTGTCTTGAGAGTAGAAAAATGG
AGGATACAAGAAAAGGAGCAGGAAGAAATTTGCAAAAATCCAAGAGCACCTTTGCTCCCCCTTATCCTCCTTCCTCTTCCCCTTTCTAGT
TCCCCTACCTCTCTATCTTTCTATTCTCACCAATAATCTCTTTGTTGCATGAATTTACCCAGGAGAGTCCTATATTTCCATTGGTGGCTC
CACAGTGGTGGCTGTCAGACCCGAAGGGGTGGGGAGCCAAGGGTGGACTTTAAGCATGGTGACAGATGGTATTTTGGGCAGAAAGCTCTT
AGACAATGGACTATCCAAAGCACTATTTAAATTCTGCCTCTTCCTACTCTCTAACCCAAATATGCACAAACTCTCTATGGCCTTGAGAAG
CAGTTGGAGAGACATGACTTGTTAAAACCTCAAGGAATCAAGACATGTTACTCTGTATTTAAGGGTAAGCCCCACAGCGGGCAGCACAAA
CAGCCTGGGAGCCACTGTGCCTGTGCTTCTCTGTCCTTCTCCCTTTGCTTGCCATGAATCCGCATACCTTGGAATACACTGTGACCCCAG
TTAAGTGTCCCTTCGCCAGGAAGCTGCCGCAACGTCCAGACCTGGGTCAAGTTCCCACTCCTGCTCCCATAGCCTTGACCTGCTTCTGTC
ACAGCACTGATCACACTGAGATGGAAGACTCCAGGGGGCAAGGACCAAGGGCCATATCCCAAGTGACTTTGTACCCAGAAAATAACAGCT

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000533824_chr1_48703351_+_1347nt
GCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCTTGGGAGGAGCAGCGGCCTGC
GGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGG
CGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTG
TTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGG
ATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCC
GAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGT
TTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTG
TCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCC
TCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAG
CAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAA
CTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCA
CACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAG
CCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGG
CTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCA

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000438567_chr1_48703351_+_2386nt
GCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCTTGGGAGGAGCAGCGGCCTGC
GGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGG
CGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTG
TTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGG
ATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCC
GAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGT
TTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTG
TCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCC
TCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAG
CAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAA
CTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCA
CACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAG
CCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGG
CTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCA
ACATCTTCCTCTGGGGCTATTTTGCGTGATTCCACAGACCTGGCTTCAGTGTAGACAGATTAAACAAAGCCCAAGCCTGTCAGCCACAGA
AACAGGCTCTCCTCTTACTTTGCTGTCTAAACTGGAGATCACAGAAGTCAAGACTGCAAGCTCCCCTGAAGAGAATCCAACTCAACCTGC
ACACTTGACAAGTGGAGAAACAGAAGCCCAGAGAGAGCACTGGGTTTGTTCAGGACCACCCAGAAGGTGTCACACGGGGTTTCCCCACTC
TTTCTGATATATTGCCTTACAGACCTACCTCAAACACACTGTTTCCACCCTCTTCTTGAATGTATTCAGTAGCCTTTACTGAATGTGTGT
CTTGAGAGTAGAAAAATGGAGGATACAAGAAAAGGAGCAGGAAGAAATTTGCAAAAATCCAAGAGCACCTTTGCTCCCCCTTATCCTCCT
TCCTCTTCCCCTTTCTAGTTCCCCTACCTCTCTATCTTTCTATTCTCACCAATAATCTCTTTGTTGCATGAATTTACCCAGGAGAGTCCT
ATATTTCCATTGGTGGCTCCACAGTGGTGGCTGTCAGACCCGAAGGGGTGGGGAGCCAAGGGTGGACTTTAAGCATGGTGACAGATGGTA
TTTTGGGCAGAAAGCTCTTAGACAATGGACTATCCAAAGCACTATTTAAATTCTGCCTCTTCCTACTCTCTAACCCAAATATGCACAAAC
TCTCTATGGCCTTGAGAAGCAGTTGGAGAGACATGACTTGTTAAAACCTCAAGGAATCAAGACATGTTACTCTGTATTTAAGGGTAAGCC
CCACAGCGGGCAGCACAAACAGCCTGGGAGCCACTGTGCCTGTGCTTCTCTGTCCTTCTCCCTTTGCTTGCCATGAATCCGCATACCTTG
GAATACACTGTGACCCCAGTTAAGTGTCCCTTCGCCAGGAAGCTGCCGCAACGTCCAGACCTGGGTCAAGTTCCCACTCCTGCTCCCATA
GCCTTGACCTGCTTCTGTCACAGCACTGATCACACTGAGATGGAAGACTCCAGGGGGCAAGGACCAAGGGCCATATCCCAAGTGACTTTG

>In-frame_MFSD2A_ENST00000372809_chr1_40424497_+_SLC5A9_ENST00000236495_chr1_48703351_+_2390nt
GCGTTCCTCGTCTGCCAGCCGGCTTGGCTAGCGCGCGGCGGCCGTGGCTAAGGCTGCTACGAAGCGAGCTTGGGAGGAGCAGCGGCCTGC
GGGGCAGAGGAGCATCCCGTCTACCAGGTCCCAAGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGGCGCCGAGAGCGGCTCCGCGG
CGGGGCTGCTACCCACCAGCATCCTCCAAAGCACTGAACGCCCGGCCCAGGTGAAGAAAGAACCGAAAAAGAAGAAACAACAGTTGTCTG
TTTGCAACAAGCTTTGCTATGCACTTGGGGGAGCCCCCTACCAGGTGACGGGCTGTGCCCTGGGTTTCTTCCTTCAGATCTACCTATTGG
ATGTGGCTCAGAAGGATGAGGAAGTTGTCTTTTGCTTCTCCTCATTCCAGGTGGGCCCTTTCTCTGCCTCCATCATCCTGTTTGTGGGCC
GAGCCTGGGATGCCATCACAGACCCCCTGGTGGGCCTCTGCATCAGCAAATCCCCCTGGACCTGCCTGGGTCGCCTTATGCCCTGAGTGT
TTGTGGTGTTCCTGGTTGTCATCAGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATCCAGGCTG
TCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTCTGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCC
TCGTGTTTGGCCTGGGAGTGGGGCTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGGAGGCCAG
CAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTCACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAA
CTCCCATCCCTGAGGAACAGCTCACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCACGAGAGCA
CACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCGGCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAG
CCCCAAGCAGGTCCTGGGGAAAGTTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCAGAGAAGG
CTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACATGTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCA
ACATCTTCCTCTGGGGCTATTTTGCGTGATTCCACAGACCTGGCTTCAGTGTAGACAGATTAAACAAAGCCCAAGCCTGTCAGCCACAGA
AACAGGCTCTCCTCTTACTTTGCTGTCTAAACTGGAGATCACAGAAGTCAAGACTGCAAGCTCCCCTGAAGAGAATCCAACTCAACCTGC
ACACTTGACAAGTGGAGAAACAGAAGCCCAGAGAGAGCACTGGGTTTGTTCAGGACCACCCAGAAGGTGTCACACGGGGTTTCCCCACTC
TTTCTGATATATTGCCTTACAGACCTACCTCAAACACACTGTTTCCACCCTCTTCTTGAATGTATTCAGTAGCCTTTACTGAATGTGTGT
CTTGAGAGTAGAAAAATGGAGGATACAAGAAAAGGAGCAGGAAGAAATTTGCAAAAATCCAAGAGCACCTTTGCTCCCCCTTATCCTCCT
TCCTCTTCCCCTTTCTAGTTCCCCTACCTCTCTATCTTTCTATTCTCACCAATAATCTCTTTGTTGCATGAATTTACCCAGGAGAGTCCT
ATATTTCCATTGGTGGCTCCACAGTGGTGGCTGTCAGACCCGAAGGGGTGGGGAGCCAAGGGTGGACTTTAAGCATGGTGACAGATGGTA
TTTTGGGCAGAAAGCTCTTAGACAATGGACTATCCAAAGCACTATTTAAATTCTGCCTCTTCCTACTCTCTAACCCAAATATGCACAAAC
TCTCTATGGCCTTGAGAAGCAGTTGGAGAGACATGACTTGTTAAAACCTCAAGGAATCAAGACATGTTACTCTGTATTTAAGGGTAAGCC
CCACAGCGGGCAGCACAAACAGCCTGGGAGCCACTGTGCCTGTGCTTCTCTGTCCTTCTCCCTTTGCTTGCCATGAATCCGCATACCTTG
GAATACACTGTGACCCCAGTTAAGTGTCCCTTCGCCAGGAAGCTGCCGCAACGTCCAGACCTGGGTCAAGTTCCCACTCCTGCTCCCATA
GCCTTGACCTGCTTCTGTCACAGCACTGATCACACTGAGATGGAAGACTCCAGGGGGCAAGGACCAAGGGCCATATCCCAAGTGACTTTG


Top

FusionGenePPI for MFSD2A_SLC5A9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MFSD2ASLC5A9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MFSD2A_SLC5A9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MFSD2A_SLC5A9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMFSD2AC0025958Microcephaly2CTD_human
HgeneMFSD2AC4225310MICROCEPHALY 15, PRIMARY, AUTOSOMAL RECESSIVE2UNIPROT
HgeneMFSD2AC0037822Speech Disorders1CTD_human
HgeneMFSD2AC3714756Intellectual Disability1CTD_human