FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21721

FusionGeneSummary for METTL5_MERTK

check button Fusion gene summary
Fusion gene informationFusion gene name: METTL5_MERTK
Fusion gene ID: 21721
HgeneTgene
Gene symbol

METTL5

MERTK

Gene ID

29081

10461

Gene namemethyltransferase like 5MER proto-oncogene, tyrosine kinase
SynonymsHSPC133MER|RP38|Tyro12|c-Eyk|c-mer
Cytomap

2q31.1

2q13

Type of geneprotein-codingprotein-coding
Descriptionmethyltransferase-like protein 5tyrosine-protein kinase MerMER receptor tyrosine kinaseSTK kinasec-mer proto-oncogene tyrosine kinaseproto-oncogene c-Merreceptor tyrosine kinase MerTK
Modification date2018051920180523
UniProtAcc

Q9NRN9

Q12866

Ensembl transtripts involved in fusion geneENST00000409837, ENST00000409340, 
ENST00000260953, ENST00000409965, 
ENST00000392640, ENST00000308099, 
ENST00000410097, 
ENST00000295408, 
ENST00000421804, ENST00000409780, 
Fusion gene scores* DoF score2 X 2 X 2=85 X 7 X 10=350
# samples 213
** MAII scorelog2(2/8*10)=1.32192809488736log2(13/350*10)=-1.42884329880387
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: METTL5 [Title/Abstract] AND MERTK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMERTK

GO:0050766

positive regulation of phagocytosis

18395422


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A3EV-06AMETTL5chr2

170676071

-MERTKchr2

112785928

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000409837ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000409837ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000409837ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000409340ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000409340ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000409340ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000260953ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000260953ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000260953ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000409965ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000409965ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000409965ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000392640ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000392640ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000392640ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
intron-3CDSENST00000308099ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
intron-3CDSENST00000308099ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
intron-3CDSENST00000308099ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000410097ENST00000295408METTL5chr2

170676071

-MERTKchr2

112785928

+
In-frameENST00000410097ENST00000421804METTL5chr2

170676071

-MERTKchr2

112785928

+
Frame-shiftENST00000410097ENST00000409780METTL5chr2

170676071

-MERTKchr2

112785928

+

Top

FusionProtFeatures for METTL5_MERTK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
METTL5

Q9NRN9

MERTK

Q12866

Probable methyltransferase. {ECO:0000250}. Receptor tyrosine kinase that transduces signals fromthe extracellular matrix into the cytoplasm by binding to severalligands including LGALS3, TUB, TULP1 or GAS6. Regulates manyphysiological processes including cell survival, migration,differentiation, and phagocytosis of apoptotic cells(efferocytosis). Ligand binding at the cell surface inducesautophosphorylation of MERTK on its intracellular domain thatprovides docking sites for downstream signaling molecules.Following activation by ligand, interacts with GRB2 or PLCG2 andinduces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTKsignaling plays a role in various processes such as macrophageclearance of apoptotic cells, platelet aggregation, cytoskeletonreorganization and engulfment. Functions in the retinal pigmentepithelium (RPE) as a regulator of rod outer segments fragmentsphagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response byactivating STAT1, which selectively induces production ofsuppressors of cytokine signaling SOCS1 and SOCS3.{ECO:0000269|PubMed:17005688}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for METTL5_MERTK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_METTL5_ENST00000409837_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_334aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIF
NRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPH
LFSIEAAARKTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQX

>In-frame_METTL5_ENST00000409340_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_235aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPHLFSIEAAAR
KTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQXGMGRSDFCP

>In-frame_METTL5_ENST00000260953_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_334aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIF
NRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPH
LFSIEAAARKTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQX

>In-frame_METTL5_ENST00000409965_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_334aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIF
NRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPH
LFSIEAAARKTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQX

>In-frame_METTL5_ENST00000392640_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_334aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIF
NRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPH
LFSIEAAARKTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQX

>In-frame_METTL5_ENST00000410097_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_334aa
MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIF
NRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREVXNNVLLLENRSLRPPH
LFSIEAAARKTLRKFAXRSEPSRRYLRQYTVAGELXGPGPGLHPCSTGLEHRPXLYNCLLHSPRCHQCGHSRSSXQQTSXRTVHPEWGQX


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_METTL5_ENST00000409837_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_1003nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGT
GGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTT
AATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTC
GATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGA
ACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCAC
CTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACA
GTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTG
CACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGA
GGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGG
GGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGA

>In-frame_METTL5_ENST00000409340_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_706nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGAACAGCAGTATATTCCTTACACAAATCC
TCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGA
AAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGC
CCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGT
CACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGAGGAATGGGAAGATCTGACTTCTGCCCC
CTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGGGGTCTCCTGGTCCCATTCGAGCATGCT

>In-frame_METTL5_ENST00000260953_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1003nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGT
GGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTT
AATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTC
GATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGA
ACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCAC
CTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACA
GTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTG
CACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGA
GGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGG
GGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGA

>In-frame_METTL5_ENST00000409965_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1003nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGT
GGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTT
AATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTC
GATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGA
ACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCAC
CTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACA
GTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTG
CACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGA
GGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGG
GGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGA

>In-frame_METTL5_ENST00000392640_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_1003nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGT
GGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTT
AATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTC
GATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGA
ACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCAC
CTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACA
GTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTG
CACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGA
GGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGG
GGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGA

>In-frame_METTL5_ENST00000410097_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1003nt
ATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCT
ACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGT
GGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTT
AATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTC
GATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGA
ACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCAC
CTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACA
GTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTG
CACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGA
GGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGG
GGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_METTL5_ENST00000409837_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_1587nt
GCTTCCGGCACCGGCCGAGGTGCGGGTCGCCTCCAGAGATCCTGTGCCTTCAAACCCTACGAGTCCATACTTTAAAACAAAATGAAGAAA
GTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCTACCAGGCCG
CACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGTGGTTGTGGA
GTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTTAATAGGAAT
GCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTCGATACAGTA
ATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGAACAGCAGTA
TATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCACCTTTTCAGT
ATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACAGTTGCTGGA
GAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTGCACTCCCCG
CGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGAGGAATGGGA
AGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGGGGTCTCCTG
GTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGAAGTCCTGAT
GTGAGGAGAGGTGCGGGGAGACATTCCAAAAATCAAGCCAATTCTTCTGCTGTAGGAGAATCCAATTGTACCTGATGTTTTTGGTATTTG
TCTTCCTTACCAAGTGAACTCCATGGCCCCAAAGCACCAGATGAATGTTGTTAAGTAAGCTGTCATTAAAAATACATAATATATATTTAT
TTAAAGAGAAAAAATATGTGTATATCATGGAAAAAGACAAGGATATTTTAATAAAACATTACTTATTTCATTTCACTTATCTTGCATATC
TTAAAATTAAGCTTCAGCTGCTCCTTGATATTAACATTTGTACAGAGTTGAAGTTGTTTTTTCAAGTTCTTTTCTTTTTCATGACTATTA
AATGTAAAAATATTTGTAAAATGAAATGCCATATTTGACTTGGCTTCTGGTCTTGATGTATTTGATAAGAATGATTCATTCAATGTTTAA

>In-frame_METTL5_ENST00000409340_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1254nt
CCGTCTCCTGGGGCGGCTTGGGTTAGCCGGGAGATCCTGTGCCTTCAAACCCTACGAGTCCATACTTTAAAACAAAATGAAGAAAGTAAG
GCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCTACCAGGCCGCACAT
TGCAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGAACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGT
ATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAA
GTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCC
TTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTC
ATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGAGGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCA
CAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGGGGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCT
CATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGAAGTCCTGATGTGAGGAGAGGTGCGGGGAGACATTCCAAAAA
TCAAGCCAATTCTTCTGCTGTAGGAGAATCCAATTGTACCTGATGTTTTTGGTATTTGTCTTCCTTACCAAGTGAACTCCATGGCCCCAA
AGCACCAGATGAATGTTGTTAAGTAAGCTGTCATTAAAAATACATAATATATATTTATTTAAAGAGAAAAAATATGTGTATATCATGGAA
AAAGACAAGGATATTTTAATAAAACATTACTTATTTCATTTCACTTATCTTGCATATCTTAAAATTAAGCTTCAGCTGCTCCTTGATATT
AACATTTGTACAGAGTTGAAGTTGTTTTTTCAAGTTCTTTTCTTTTTCATGACTATTAAATGTAAAAATATTTGTAAAATGAAATGCCAT

>In-frame_METTL5_ENST00000260953_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1792nt
CGGCCTGGCGCTTCCGGCACCGGCCGAGGTGCGGGTCGCCTCCAGAGGTGCGTGGTCGTGGCGCGAGGGATCCTGAGGCTGCTCCAGCAG
TGCGCCGCCGCCGTCTCCTGGGGCGGCTTGGGTTAGCCGGGAGGTGGGTCAGAGGCTCGCCCCGTGCCCTGCGTCCGGGCGTCTCCTTAG
GGCGCGTCTTCGGGTCCGGCCAGCGGTGCTGAAAAAGGGAGAAGGTTGGGGGTAGGGAGGAAACAAGATCCCAGTTCAATAGATTTCTCC
GCAGATCCTGTGCCTTCAAACCCTACGAGTCCATACTTTAAAACAAAATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAAC
AAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCTACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATA
ACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGTGGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAG
GGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTTAATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGG
TTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTCGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATA
AAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGAACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTAT
GAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGT
TTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTT
GCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCAT
GACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGAGGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACA
GCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGGGGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCA
TTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGAAGTCCTGATGTGAGGAGAGGTGCGGGGAGACATTCCAAAAATC
AAGCCAATTCTTCTGCTGTAGGAGAATCCAATTGTACCTGATGTTTTTGGTATTTGTCTTCCTTACCAAGTGAACTCCATGGCCCCAAAG
CACCAGATGAATGTTGTTAAGTAAGCTGTCATTAAAAATACATAATATATATTTATTTAAAGAGAAAAAATATGTGTATATCATGGAAAA
AGACAAGGATATTTTAATAAAACATTACTTATTTCATTTCACTTATCTTGCATATCTTAAAATTAAGCTTCAGCTGCTCCTTGATATTAA
CATTTGTACAGAGTTGAAGTTGTTTTTTCAAGTTCTTTTCTTTTTCATGACTATTAAATGTAAAAATATTTGTAAAATGAAATGCCATAT

>In-frame_METTL5_ENST00000409965_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1662nt
GTGCGCGCGTGCGGCCTGGCGCTTCCGGCACCGGCCGAGGTGCGGGTCGCCTCCAGAGGTGCGTGGTCGTGGCGCGAGGGATCCTGAGGC
TGCTCCAGCAGTGCGCCGCCGCCGTCTCCTGGGGCGGCTTGGGTTAGCCGGGAGATCCTGTGCCTTCAAACCCTACGAGTCCATACTTTA
AAACAAAATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACA
GTATCCTACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCT
AGGATGTGGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGA
AATATTTAATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAA
GTCATTCGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAAT
GGCAAGAACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACC
GCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCA
ATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGACTCTATAATTG
CCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGG
GCAGTGAGGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTA
GGAATGGGGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAG
GCTCAGAAGTCCTGATGTGAGGAGAGGTGCGGGGAGACATTCCAAAAATCAAGCCAATTCTTCTGCTGTAGGAGAATCCAATTGTACCTG
ATGTTTTTGGTATTTGTCTTCCTTACCAAGTGAACTCCATGGCCCCAAAGCACCAGATGAATGTTGTTAAGTAAGCTGTCATTAAAAATA
CATAATATATATTTATTTAAAGAGAAAAAATATGTGTATATCATGGAAAAAGACAAGGATATTTTAATAAAACATTACTTATTTCATTTC
ACTTATCTTGCATATCTTAAAATTAAGCTTCAGCTGCTCCTTGATATTAACATTTGTACAGAGTTGAAGTTGTTTTTTCAAGTTCTTTTC
TTTTTCATGACTATTAAATGTAAAAATATTTGTAAAATGAAATGCCATATTTGACTTGGCTTCTGGTCTTGATGTATTTGATAAGAATGA

>In-frame_METTL5_ENST00000392640_chr2_170676071_-_MERTK_ENST00000409780_chr2_112785928_+_1613nt
GAACGCGTGCGCGCGTGCGGCCTGGCGCTTCCGGCACCGGCCGAGGTGCGGGTCGCCTCCAGAGATCCTGTGCCTTCAAACCCTACGAGT
CCATACTTTAAAACAAAATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACAAGTGGATGGATTTGAAAAGCCCAAGCTAC
TTCTGGAACAGTATCCTACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAACACTTATGATGACATTGAAAATAAAGTCG
TTGCAGATCTAGGATGTGGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGGGTTGTGTGTTGGATTTGACATAGATGAAG
ACGCATTGGAAATATTTAATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGTTCAATGTGATGTGTGCTTATTATCTAACA
GAATGTCCAAGTCATTCGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAGGGACAGATATGGCTTTTCTAAAGACTG
CTTTGGAAATGGCAAGAACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATGAAATAATGTACTCTTGCTGGAGAACCGAT
CCCTTAGACCGCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTTTGCCTGACGTTCGGAACCAAGCAGACGTT
ATTTACGTCAATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTGCTCCACTGGACTTGAACATCGACCCTGAC
TCTATAATTGCCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATGACAGCAAACCTCATGAAGGACGGTACATC
CTGAATGGGGGCAGTGAGGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAGCTGAAAAGAACAGTGTTTTACCGGGGGAG
AGACTTGTTAGGAATGGGGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCATTGCCCGATGAACTTTTGTTTGCTGACGAC
TCCTCAGAAGGCTCAGAAGTCCTGATGTGAGGAGAGGTGCGGGGAGACATTCCAAAAATCAAGCCAATTCTTCTGCTGTAGGAGAATCCA
ATTGTACCTGATGTTTTTGGTATTTGTCTTCCTTACCAAGTGAACTCCATGGCCCCAAAGCACCAGATGAATGTTGTTAAGTAAGCTGTC
ATTAAAAATACATAATATATATTTATTTAAAGAGAAAAAATATGTGTATATCATGGAAAAAGACAAGGATATTTTAATAAAACATTACTT
ATTTCATTTCACTTATCTTGCATATCTTAAAATTAAGCTTCAGCTGCTCCTTGATATTAACATTTGTACAGAGTTGAAGTTGTTTTTTCA
AGTTCTTTTCTTTTTCATGACTATTAAATGTAAAAATATTTGTAAAATGAAATGCCATATTTGACTTGGCTTCTGGTCTTGATGTATTTG

>In-frame_METTL5_ENST00000410097_chr2_170676071_-_MERTK_ENST00000421804_chr2_112785928_+_1611nt
TCCAGAGGTGCGTGGTCGTGGCGCGAGGGATCCTGAGGCTGCTCCAGCAGTGCGCCGCCGCCGTCTCCTGGGGCGGCTTGGGTTAGCCGG
GAGATCCTGTGCCTTCAAACCCTACGAGTCCATACTTTAAAACAAAATGAAGAAAGTAAGGCTTAAGGAACTAGAGAGTCGCCTGCAACA
AGTGGATGGATTTGAAAAGCCCAAGCTACTTCTGGAACAGTATCCTACCAGGCCGCACATTGCAGCATGTATGCTCTATACAATCCATAA
CACTTATGATGACATTGAAAATAAAGTCGTTGCAGATCTAGGATGTGGTTGTGGAGTACTTAGCATCGGAACTGCAATGTTAGGAGCAGG
GTTGTGTGTTGGATTTGACATAGATGAAGACGCATTGGAAATATTTAATAGGAATGCAGAAGAGTTTGAGTTAACAAATATTGACATGGT
TCAATGTGATGTGTGCTTATTATCTAACAGAATGTCCAAGTCATTCGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAA
AGGGACAGATATGGCTTTTCTAAAGACTGCTTTGGAAATGGCAAGAACAGCAGTATATTCCTTACACAAATCCTCAACTAGAGAAGTATG
AAATAATGTACTCTTGCTGGAGAACCGATCCCTTAGACCGCCCCACCTTTTCAGTATTGAGGCTGCAGCTAGAAAAACTCTTAGAAAGTT
TGCCTGACGTTCGGAACCAAGCAGACGTTATTTACGTCAATACACAGTTGCTGGAGAGCTCTGAGGGCCTGGCCCAGGGCTCCACCCTTG
CTCCACTGGACTTGAACATCGACCCTGACTCTATAATTGCCTCCTGCACTCCCCGCGCTGCCATCAGTGTGGTCACAGCAGAAGTTCATG
ACAGCAAACCTCATGAAGGACGGTACATCCTGAATGGGGGCAGTGAGGAATGGGAAGATCTGACTTCTGCCCCCTCTGCTGCAGTCACAG
CTGAAAAGAACAGTGTTTTACCGGGGGAGAGACTTGTTAGGAATGGGGTCTCCTGGTCCCATTCGAGCATGCTGCCCTTGGGAAGCTCAT
TGCCCGATGAACTTTTGTTTGCTGACGACTCCTCAGAAGGCTCAGAAGTCCTGATGTGAGGAGAGGTGCGGGGAGACATTCCAAAAATCA
AGCCAATTCTTCTGCTGTAGGAGAATCCAATTGTACCTGATGTTTTTGGTATTTGTCTTCCTTACCAAGTGAACTCCATGGCCCCAAAGC
ACCAGATGAATGTTGTTAAGTAAGCTGTCATTAAAAATACATAATATATATTTATTTAAAGAGAAAAAATATGTGTATATCATGGAAAAA
GACAAGGATATTTTAATAAAACATTACTTATTTCATTTCACTTATCTTGCATATCTTAAAATTAAGCTTCAGCTGCTCCTTGATATTAAC
ATTTGTACAGAGTTGAAGTTGTTTTTTCAAGTTCTTTTCTTTTTCATGACTATTAAATGTAAAAATATTTGTAAAATGAAATGCCATATT


Top

FusionGenePPI for METTL5_MERTK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
METTL5THUMPD3MERTKGAS6, IKBKG, NEDD4L, ITGB5, MERTK, TNK2, HSP90AA1, SKI


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for METTL5_MERTK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for METTL5_MERTK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMERTKC0017661IGA Glomerulonephritis1CTD_human
TgeneMERTKC0034065Pulmonary Embolism1CTD_human
TgeneMERTKC0035334Retinitis Pigmentosa1CTD_human;HPO;ORPHANET
TgeneMERTKC0040038Thromboembolism1CTD_human
TgeneMERTKC0040053Thrombosis1CTD_human
TgeneMERTKC3151228RETINITIS PIGMENTOSA 38 (disorder)1UNIPROT