FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21518

FusionGeneSummary for MED1_RHBDL3

check button Fusion gene summary
Fusion gene informationFusion gene name: MED1_RHBDL3
Fusion gene ID: 21518
HgeneTgene
Gene symbol

MED1

RHBDL3

Gene ID

8930

162494

Gene namemethyl-CpG binding domain 4, DNA glycosylaserhomboid like 3
SynonymsMED1RHBDL4|VRHO
Cytomap

3q21.3

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionmethyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylaseG/5-fluorouracil mismatch glycosylase with biphasic kineticsG/T mismatch glycosylaseG/U mismatch glycosylasemethyl-CpG binding domain protein 4methyl-CpG-binding endonuclease 1methrhomboid-related protein 3rhomboid, veinlet-like 3rhomboid, veinlet-like 4ventrhoid transmembrane protein
Modification date2018052320180519
UniProtAcc

Q15648

P58872

Ensembl transtripts involved in fusion geneENST00000394287, ENST00000300651, 
ENST00000269051, ENST00000538145, 
ENST00000536287, 
Fusion gene scores* DoF score25 X 11 X 9=24755 X 4 X 4=80
# samples 255
** MAII scorelog2(25/2475*10)=-3.30742852519225
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MED1 [Title/Abstract] AND RHBDL3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E2-A14Y-01AMED1chr17

37604051

-RHBDL3chr17

30615811

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394287ENST00000269051MED1chr17

37604051

-RHBDL3chr17

30615811

+
In-frameENST00000394287ENST00000538145MED1chr17

37604051

-RHBDL3chr17

30615811

+
In-frameENST00000394287ENST00000536287MED1chr17

37604051

-RHBDL3chr17

30615811

+
In-frameENST00000300651ENST00000269051MED1chr17

37604051

-RHBDL3chr17

30615811

+
In-frameENST00000300651ENST00000538145MED1chr17

37604051

-RHBDL3chr17

30615811

+
In-frameENST00000300651ENST00000536287MED1chr17

37604051

-RHBDL3chr17

30615811

+

Top

FusionProtFeatures for MED1_RHBDL3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MED1

Q15648

RHBDL3

P58872

Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors (PubMed:10406464, PubMed:11867769,PubMed:12037571, PubMed:12218053, PubMed:12556447,PubMed:14636573, PubMed:15340084, PubMed:15471764,PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as acoactivator for GATA1-mediated transcriptional activation duringerythroid differentiation of K562 erythroleukemia cells(PubMed:24245781). {ECO:0000269|PubMed:10406464,ECO:0000269|PubMed:11867769, ECO:0000269|PubMed:12037571,ECO:0000269|PubMed:12218053, ECO:0000269|PubMed:12556447,ECO:0000269|PubMed:14636573, ECO:0000269|PubMed:15340084,ECO:0000269|PubMed:15471764, ECO:0000269|PubMed:15989967,ECO:0000269|PubMed:16574658, ECO:0000269|PubMed:24245781,ECO:0000269|PubMed:9653119}. May be involved in regulated intramembrane proteolysisand the subsequent release of functional polypeptides from theirmembrane anchors. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29164_18498405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29218_23898405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29250_27098405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29274_29498405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29303_32598405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29338_35898405TransmembraneHelical
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+29371_39198405TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-2171078_1482441582Compositional biasNote=Ser-rich
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-2171496_1529441582Compositional biasNote=Lys-rich
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-2181078_148244557Compositional biasNote=Ser-rich
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-2181496_152944557Compositional biasNote=Lys-rich
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217604_608441582MotifNote=LXXLL motif 1
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217645_649441582MotifNote=LXXLL motif 2
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218604_60844557MotifNote=LXXLL motif 1
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218645_64944557MotifNote=LXXLL motif 2
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+2934_6998405DomainEF-hand 1
TgeneRHBDL3chr17:37604051chr17:30615811ENST00000269051+2970_10598405DomainEF-hand 2


Top

FusionGeneSequence for MED1_RHBDL3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_351aa
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETL
PREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQ
LLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_1053nt
ATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAAT
AGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGC
AACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTG
CCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTT
GCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCAC
CCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAG
CTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCA
GTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATG
AACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGG
CTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGC
GTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_4691nt
TTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGATTGATCCTTCCCGGGAA
GAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAGGGCTTATCCTTTTGTGGC
GGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAAC
GGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACA
GCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTA
TCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCA
TGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTT
ACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAAC
ACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGG
CCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCT
CTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGA
GCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTG
GCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGG
CCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGCTGCCGCCTCCCCCCTGAG
GGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTCATCACCAGCTCAGCTAGG
CCGGGCAGACAAGGACAGAAGACTCTGGGCCACTGTAATGTTTGTGTTTAGATTTGGACACACAGTGGAGACCCTTTTCTGAAAGGCATC
TGGCGGAGGAGTTGATGTGGCTGCTGTCGTTTTTCTCGGCTGCTCTGATGACATCGGGCCAGGGTGAAGGTCTGGGGTGGGGTGTGAGAG
TGGCCCTCCCTCACCTGGGCTGGGCTTCTTCCATGGGGCCAGGGGGTGCCCCCTCACTGCTGCGGATTGAGCAGCAGCTTCTTCCTCCTC
CTCTACCCTCAGAGACCCTAAGAGACATGGGAAGGCTCGAAGGTTGTTGCGTCCAGGCATGGCCCCTCTCTAGCTCAGAAATAATTGCAG
GCCATGTGGTGTCTCCTTGACACCTGCTGTGTCTGGGGCTCCAGTAAGAAGAGGGCCTACTGGACATGTCAGCTGTGACCTGGCTGAAAC
CAGGGTGCCCTCCTGGGCTGGTTGGTGTGCACCGGGGCATGATCTGTTGTGCCTGGGTTGGGCAGAGCAGGGAGCCTGTAGGCTCTAGGA
CCCCTCTTGTGCTGGGGGTACCCAGTGAGAGGGACCCATGCAGGGGGAATAAACTTCATTCCAAGTTCCACCCTGGAGAAGACAGACCCA
GGACCAGCTTCAGACTTCTCCCTCCCTTTCTTCCAGGATATTGGCATCTCACACGGGTGCCCCAGCCTCCATGCCCAGCCTTGTTTTAGG
GTCTTTTTCTTTCCTTTTGCTGCCCTGACACTACTTTGTGCCTCTCTTTGGTTATGGAGACAGTGTTTTGAAACATTCATGCGTGTGTGT
GTGTGTGTGCGTATATGTGTGTATGTGATGGGAAAGGTAACTGAGGCACGACAGCGCCTGCAGAGAAGGCATGGAGGATGCAGGGGGCCC
ATGTGGGCATCCGTGAGAGGTGGCAGACCGTGGTGTGCTGTGGTTGCTGAATGTCCTTGCTTTGACAAAGCCTGCCCCCTTCCTTCCCAT
CTCCTGTCCCTTCCACACCTGCCCCTGAGCATCACTGACCGGTGGCAGAATGGCCCTGCTGGAGGGAGAGCTCAAGCCCTCCAAGGATCC
CTGGATGCTGAGGTTTGCCAGGTTCAGCTCTTGTTTCCGTCTGAGATGGCCTTCATATCCAAAAAGGTTCCATCCTATCTCCCTTAGGAG
AGAAAGAGCTTTGGGGGCGCAAGAGAGGCTGGGGTAGGAATGTTGAGGCCATGTGTCCATTTAAGTTAGGGGGACAGGAGGCTACAGGAA
GAGGAATTCCAGTTTAGTTGGAAAACTTTGCCTCAGGAGAATTGTTGGGTGCATGGATGAACCTCAGAGGGAGGGCAGCCAGTAGCCTCG
GAGGCTTGGATGCGGGAGAGAACATGGTGGTTATCAAATCCACCCCACCCCATTACACAGGTGAGAAAACAAGATGGAGGGAATGACCCT
CCTAACAGGAGCTGGTGCAGGCCCCGAATGGAGGGCATGAGGATGACCTTTGACAAAAGATGACACTCCCTTTATCGTGCTCTTGGAATT
CTCAACCACTGACAGCCCAGAAGAACAAAGAACGCCAGGCCTGGGAGGAGGCAGGGGGGCTGGGCGTGTCCAGAAACAGGGGCAGGAGTG
TGGGAACGGTCTTCCTCCAGCCTGGTGCCCATCCTGGCCCTTGAGTGTAGCAGGGTCCAGGGTCAGTCAGGCCAGGCATTTGGGGTCTTG
GGCCACAGTGGCTTCCCATCCTGGTGACTACATGTAAATGGGCTCACTCACTCACTGGCAGGCGAGGCCCAGCCATACCGCATCTTGGCC
CACTGCTAAATAGATTGCCCTGGCCTCATCCACATATGTAGTTCCCTAGGTCCTGCTCCCCTGCACCAGTGCCATGCTGAGGGCCGCAGC
CTGTGGCACTGTGGGCCCACGCCTTTGGCGGTGTTGCGTCAGCCTGGGGCGTCTTGTGTGTGCCCTGCCCACCGTTCTCTGCCCTAGTGA
TAGAAAGATGTAGATGGAAGTCAGTGCCTCAGAGGAGGAGGCTCTGAGGCTGTGGAGCTGGGCTCAGGGAAGACCAGGGGAGGATGCAGA
AGGAGTCAGGACATTGCTGCCTCTGCCTGGGCTGCAGCCGCACTAAGCTGAGCGATGAGGTCCTTTCCTGGAGGGATGGAGAATCCCCTC
CAGATTCCTGTCCTGGCCCCTGGGGATTCTGTGGTGTGGGTGGAATGAGCAGAGTGCCACCTCTGTCTGGTATGACCTGGAGAGGGGGCT
TCCTCTCTTAGGGGTGAGAAAGCATTGAACTAGAAGATTCTAGAAATCCCTCATAGAAGCACTCAGCTCCCTCGGGGACTCCCAGGGAAG
CTTGTTACTGAGAAGGACAGTGGAGGCGGAATCGTGTCTCCCACCATGTTAAGTGTGTCCTCTGCTGCCAAGGACCCTCGTCTACACCTT
AGACCACCAGCCCCAGCTGTTCTCTGTCAGCACACCCACCTCCATCCCCTCTCCCAACCATGACTTCCAAGCGGGGCCACAGGGTGGGGT
CATAGGGTCACTTCACCTGACCCAGGCCTCTCCCCAGGTCAGGAGGCAGCTGTCTGGTCAGAGGGGTTCTCTTTGTGGCATCTGGCTTTC
TCCTCAGCAGGTCCCACCACCCTCTCAGCAGCACTTCCCCATGGCCAAGGCTGGCCGTGTCCTCTGTGCCTCTTTCCTTGTCTGAGGTGG
CTGCCAGCCCAGGGGGTGGTGTGTAAATCTTCAGGCTGGTGGAGGTAGGTTGGCCTTTTATCCACAGGATACAGAAACTGAAAGCTGGGG
AATCCCCAAACAGCAGCCATAGACTCACTGGCTCTCATTAAACGGGAGAGGAATCACAGAAACTGGGGAAGGGAAAACAAACCTTCAAAG
GAGAAATTTCGCTTTAATGACACCATTCATCATTCGTTTTTTAATTAGGAAAAGCTCCCTAATGAGGCTCTTTTGCCAGCTAATAGGACT
CTCGATTTCCATGAGAACCATTCTTGCCCAGAGGATTAGGGGAGCTGTTGCTCACCACACCAGGATCTTCCCCCAGCGTCCAATTTAATT
TGCAAATACGTAATGCAGATTCCCTGGGTGCCGTGAAAGCCTTTCCTGGCATCATTCATGTTGCTCCCCGTGCTGGCTGGAAAGCACGGT
TCTCCTCTGCCTTAAAAACAGTGCCCAACAGTGAACTGCCCCTCCGAGGACTTGAGTAAGTGGAAAAAACAAAACACAGACTGCAATGTT
TGTTTCTAAGTATTTTTGTATTGTGTACATTCTGTATATTTTTGTTGTAACATATTATTTGAGCACAGATTCCATTAAATATTTTTTTTC

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_1393nt
TTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGATTGATCCTTCCCGGGAA
GAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAGGGCTTATCCTTTTGTGGC
GGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAAC
GGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACA
GCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTA
TCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCA
TGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTT
ACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAAC
ACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGG
CCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCT
CTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGA
GCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTG
GCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGG
CCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGCTGCCGCCTCCCCCCTGAG
GGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTCATCACCAGCTCAGCTAGG

>In-frame_MED1_ENST00000394287_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_4686nt
TTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGATTGATCCTTCCCGGGAA
GAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAGGGCTTATCCTTTTGTGGC
GGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGATGAGTTCTCTCCTGGAAC
GGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGAGCAACAAGCGTTCCAACA
GCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGAGCCTCTCGCAGCGACTTA
TCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCTGCCCCCCACCCTGGTTCA
TGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGCAGGTAACTCATCCACGTT
ACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCATGCATGCAGGGATAGAAC
ACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAATTGGGCTTGTCTACGTGG
CCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAGGGGTGTATGCTCTCGTCT
CTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTGTGGCCCTTATCTGTATGA
GCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCTTTGTGGCGCACTTGGGTG
GCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCACTGTGGTGGATTTTTGTGG
CCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGCTGCCGCCTCCCCCCTGAG
GGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTCATCACCAGCTCAGCTAGG
CCGGGCAGACAAGGACAGAAGACTCTGGGCCACTGTAATGTTTGTGTTTAGATTTGGACACACAGTGGAGACCCTTTTCTGAAAGGCATC
TGGCGGAGGAGTTGATGTGGCTGCTGTCGTTTTTCTCGGCTGCTCTGATGACATCGGGCCAGGGTGAAGGTCTGGGGTGGGGTGTGAGAG
TGGCCCTCCCTCACCTGGGCTGGGCTTCTTCCATGGGGCCAGGGGGTGCCCCCTCACTGCTGCGGATTGAGCAGCAGCTTCTTCCTCCTC
CTCTACCCTCAGAGACCCTAAGAGACATGGGAAGGCTCGAAGGTTGTTGCGTCCAGGCATGGCCCCTCTCTAGCTCAGAAATAATTGCAG
GCCATGTGGTGTCTCCTTGACACCTGCTGTGTCTGGGGCTCCAGTAAGAAGAGGGCCTACTGGACATGTCAGCTGTGACCTGGCTGAAAC
CAGGGTGCCCTCCTGGGCTGGTTGGTGTGCACCGGGGCATGATCTGTTGTGCCTGGGTTGGGCAGAGCAGGGAGCCTGTAGGCTCTAGGA
CCCCTCTTGTGCTGGGGGTACCCAGTGAGAGGGACCCATGCAGGGGGAATAAACTTCATTCCAAGTTCCACCCTGGAGAAGACAGACCCA
GGACCAGCTTCAGACTTCTCCCTCCCTTTCTTCCAGGATATTGGCATCTCACACGGGTGCCCCAGCCTCCATGCCCAGCCTTGTTTTAGG
GTCTTTTTCTTTCCTTTTGCTGCCCTGACACTACTTTGTGCCTCTCTTTGGTTATGGAGACAGTGTTTTGAAACATTCATGCGTGTGTGT
GTGTGTGTGCGTATATGTGTGTATGTGATGGGAAAGGTAACTGAGGCACGACAGCGCCTGCAGAGAAGGCATGGAGGATGCAGGGGGCCC
ATGTGGGCATCCGTGAGAGGTGGCAGACCGTGGTGTGCTGTGGTTGCTGAATGTCCTTGCTTTGACAAAGCCTGCCCCCTTCCTTCCCAT
CTCCTGTCCCTTCCACACCTGCCCCTGAGCATCACTGACCGGTGGCAGAATGGCCCTGCTGGAGGGAGAGCTCAAGCCCTCCAAGGATCC
CTGGATGCTGAGGTTTGCCAGGTTCAGCTCTTGTTTCCGTCTGAGATGGCCTTCATATCCAAAAAGGTTCCATCCTATCTCCCTTAGGAG
AGAAAGAGCTTTGGGGGCGCAAGAGAGGCTGGGGTAGGAATGTTGAGGCCATGTGTCCATTTAAGTTAGGGGGACAGGAGGCTACAGGAA
GAGGAATTCCAGTTTAGTTGGAAAACTTTGCCTCAGGAGAATTGTTGGGTGCATGGATGAACCTCAGAGGGAGGGCAGCCAGTAGCCTCG
GAGGCTTGGATGCGGGAGAGAACATGGTGGTTATCAAATCCACCCCACCCCATTACACAGGTGAGAAAACAAGATGGAGGGAATGACCCT
CCTAACAGGAGCTGGTGCAGGCCCCGAATGGAGGGCATGAGGATGACCTTTGACAAAAGATGACACTCCCTTTATCGTGCTCTTGGAATT
CTCAACCACTGACAGCCCAGAAGAACAAAGAACGCCAGGCCTGGGAGGAGGCAGGGGGGCTGGGCGTGTCCAGAAACAGGGGCAGGAGTG
TGGGAACGGTCTTCCTCCAGCCTGGTGCCCATCCTGGCCCTTGAGTGTAGCAGGGTCCAGGGTCAGTCAGGCCAGGCATTTGGGGTCTTG
GGCCACAGTGGCTTCCCATCCTGGTGACTACATGTAAATGGGCTCACTCACTCACTGGCAGGCGAGGCCCAGCCATACCGCATCTTGGCC
CACTGCTAAATAGATTGCCCTGGCCTCATCCACATATGTAGTTCCCTAGGTCCTGCTCCCCTGCACCAGTGCCATGCTGAGGGCCGCAGC
CTGTGGCACTGTGGGCCCACGCCTTTGGCGGTGTTGCGTCAGCCTGGGGCGTCTTGTGTGTGCCCTGCCCACCGTTCTCTGCCCTAGTGA
TAGAAAGATGTAGATGGAAGTCAGTGCCTCAGAGGAGGAGGCTCTGAGGCTGTGGAGCTGGGCTCAGGGAAGACCAGGGGAGGATGCAGA
AGGAGTCAGGACATTGCTGCCTCTGCCTGGGCTGCAGCCGCACTAAGCTGAGCGATGAGGTCCTTTCCTGGAGGGATGGAGAATCCCCTC
CAGATTCCTGTCCTGGCCCCTGGGGATTCTGTGGTGTGGGTGGAATGAGCAGAGTGCCACCTCTGTCTGGTATGACCTGGAGAGGGGGCT
TCCTCTCTTAGGGGTGAGAAAGCATTGAACTAGAAGATTCTAGAAATCCCTCATAGAAGCACTCAGCTCCCTCGGGGACTCCCAGGGAAG
CTTGTTACTGAGAAGGACAGTGGAGGCGGAATCGTGTCTCCCACCATGTTAAGTGTGTCCTCTGCTGCCAAGGACCCTCGTCTACACCTT
AGACCACCAGCCCCAGCTGTTCTCTGTCAGCACACCCACCTCCATCCCCTCTCCCAACCATGACTTCCAAGCGGGGCCACAGGGTGGGGT
CATAGGGTCACTTCACCTGACCCAGGCCTCTCCCCAGGTCAGGAGGCAGCTGTCTGGTCAGAGGGGTTCTCTTTGTGGCATCTGGCTTTC
TCCTCAGCAGGTCCCACCACCCTCTCAGCAGCACTTCCCCATGGCCAAGGCTGGCCGTGTCCTCTGTGCCTCTTTCCTTGTCTGAGGTGG
CTGCCAGCCCAGGGGGTGGTGTGTAAATCTTCAGGCTGGTGGAGGTAGGTTGGCCTTTTATCCACAGGATACAGAAACTGAAAGCTGGGG
AATCCCCAAACAGCAGCCATAGACTCACTGGCTCTCATTAAACGGGAGAGGAATCACAGAAACTGGGGAAGGGAAAACAAACCTTCAAAG
GAGAAATTTCGCTTTAATGACACCATTCATCATTCGTTTTTTAATTAGGAAAAGCTCCCTAATGAGGCTCTTTTGCCAGCTAATAGGACT
CTCGATTTCCATGAGAACCATTCTTGCCCAGAGGATTAGGGGAGCTGTTGCTCACCACACCAGGATCTTCCCCCAGCGTCCAATTTAATT
TGCAAATACGTAATGCAGATTCCCTGGGTGCCGTGAAAGCCTTTCCTGGCATCATTCATGTTGCTCCCCGTGCTGGCTGGAAAGCACGGT
TCTCCTCTGCCTTAAAAACAGTGCCCAACAGTGAACTGCCCCTCCGAGGACTTGAGTAAGTGGAAAAAACAAAACACAGACTGCAATGTT
TGTTTCTAAGTATTTTTGTATTGTGTACATTCTGTATATTTTTGTTGTAACATATTATTTGAGCACAGATTCCATTAAATATTTTTTTTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000269051_chr17_30615811_+_4709nt
ACGGTTTATCTCGCGAATTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAG
ATTGATCCTTCCCGGGAAGAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAG
GGCTTATCCTTTTGTGGCGGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGA
TGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGA
GCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGA
GCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCT
GCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGC
AGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCA
TGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAA
TTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAG
GGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTG
TGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCT
TTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCAC
TGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGC
TGCCGCCTCCCCCCTGAGGGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTC
ATCACCAGCTCAGCTAGGCCGGGCAGACAAGGACAGAAGACTCTGGGCCACTGTAATGTTTGTGTTTAGATTTGGACACACAGTGGAGAC
CCTTTTCTGAAAGGCATCTGGCGGAGGAGTTGATGTGGCTGCTGTCGTTTTTCTCGGCTGCTCTGATGACATCGGGCCAGGGTGAAGGTC
TGGGGTGGGGTGTGAGAGTGGCCCTCCCTCACCTGGGCTGGGCTTCTTCCATGGGGCCAGGGGGTGCCCCCTCACTGCTGCGGATTGAGC
AGCAGCTTCTTCCTCCTCCTCTACCCTCAGAGACCCTAAGAGACATGGGAAGGCTCGAAGGTTGTTGCGTCCAGGCATGGCCCCTCTCTA
GCTCAGAAATAATTGCAGGCCATGTGGTGTCTCCTTGACACCTGCTGTGTCTGGGGCTCCAGTAAGAAGAGGGCCTACTGGACATGTCAG
CTGTGACCTGGCTGAAACCAGGGTGCCCTCCTGGGCTGGTTGGTGTGCACCGGGGCATGATCTGTTGTGCCTGGGTTGGGCAGAGCAGGG
AGCCTGTAGGCTCTAGGACCCCTCTTGTGCTGGGGGTACCCAGTGAGAGGGACCCATGCAGGGGGAATAAACTTCATTCCAAGTTCCACC
CTGGAGAAGACAGACCCAGGACCAGCTTCAGACTTCTCCCTCCCTTTCTTCCAGGATATTGGCATCTCACACGGGTGCCCCAGCCTCCAT
GCCCAGCCTTGTTTTAGGGTCTTTTTCTTTCCTTTTGCTGCCCTGACACTACTTTGTGCCTCTCTTTGGTTATGGAGACAGTGTTTTGAA
ACATTCATGCGTGTGTGTGTGTGTGTGCGTATATGTGTGTATGTGATGGGAAAGGTAACTGAGGCACGACAGCGCCTGCAGAGAAGGCAT
GGAGGATGCAGGGGGCCCATGTGGGCATCCGTGAGAGGTGGCAGACCGTGGTGTGCTGTGGTTGCTGAATGTCCTTGCTTTGACAAAGCC
TGCCCCCTTCCTTCCCATCTCCTGTCCCTTCCACACCTGCCCCTGAGCATCACTGACCGGTGGCAGAATGGCCCTGCTGGAGGGAGAGCT
CAAGCCCTCCAAGGATCCCTGGATGCTGAGGTTTGCCAGGTTCAGCTCTTGTTTCCGTCTGAGATGGCCTTCATATCCAAAAAGGTTCCA
TCCTATCTCCCTTAGGAGAGAAAGAGCTTTGGGGGCGCAAGAGAGGCTGGGGTAGGAATGTTGAGGCCATGTGTCCATTTAAGTTAGGGG
GACAGGAGGCTACAGGAAGAGGAATTCCAGTTTAGTTGGAAAACTTTGCCTCAGGAGAATTGTTGGGTGCATGGATGAACCTCAGAGGGA
GGGCAGCCAGTAGCCTCGGAGGCTTGGATGCGGGAGAGAACATGGTGGTTATCAAATCCACCCCACCCCATTACACAGGTGAGAAAACAA
GATGGAGGGAATGACCCTCCTAACAGGAGCTGGTGCAGGCCCCGAATGGAGGGCATGAGGATGACCTTTGACAAAAGATGACACTCCCTT
TATCGTGCTCTTGGAATTCTCAACCACTGACAGCCCAGAAGAACAAAGAACGCCAGGCCTGGGAGGAGGCAGGGGGGCTGGGCGTGTCCA
GAAACAGGGGCAGGAGTGTGGGAACGGTCTTCCTCCAGCCTGGTGCCCATCCTGGCCCTTGAGTGTAGCAGGGTCCAGGGTCAGTCAGGC
CAGGCATTTGGGGTCTTGGGCCACAGTGGCTTCCCATCCTGGTGACTACATGTAAATGGGCTCACTCACTCACTGGCAGGCGAGGCCCAG
CCATACCGCATCTTGGCCCACTGCTAAATAGATTGCCCTGGCCTCATCCACATATGTAGTTCCCTAGGTCCTGCTCCCCTGCACCAGTGC
CATGCTGAGGGCCGCAGCCTGTGGCACTGTGGGCCCACGCCTTTGGCGGTGTTGCGTCAGCCTGGGGCGTCTTGTGTGTGCCCTGCCCAC
CGTTCTCTGCCCTAGTGATAGAAAGATGTAGATGGAAGTCAGTGCCTCAGAGGAGGAGGCTCTGAGGCTGTGGAGCTGGGCTCAGGGAAG
ACCAGGGGAGGATGCAGAAGGAGTCAGGACATTGCTGCCTCTGCCTGGGCTGCAGCCGCACTAAGCTGAGCGATGAGGTCCTTTCCTGGA
GGGATGGAGAATCCCCTCCAGATTCCTGTCCTGGCCCCTGGGGATTCTGTGGTGTGGGTGGAATGAGCAGAGTGCCACCTCTGTCTGGTA
TGACCTGGAGAGGGGGCTTCCTCTCTTAGGGGTGAGAAAGCATTGAACTAGAAGATTCTAGAAATCCCTCATAGAAGCACTCAGCTCCCT
CGGGGACTCCCAGGGAAGCTTGTTACTGAGAAGGACAGTGGAGGCGGAATCGTGTCTCCCACCATGTTAAGTGTGTCCTCTGCTGCCAAG
GACCCTCGTCTACACCTTAGACCACCAGCCCCAGCTGTTCTCTGTCAGCACACCCACCTCCATCCCCTCTCCCAACCATGACTTCCAAGC
GGGGCCACAGGGTGGGGTCATAGGGTCACTTCACCTGACCCAGGCCTCTCCCCAGGTCAGGAGGCAGCTGTCTGGTCAGAGGGGTTCTCT
TTGTGGCATCTGGCTTTCTCCTCAGCAGGTCCCACCACCCTCTCAGCAGCACTTCCCCATGGCCAAGGCTGGCCGTGTCCTCTGTGCCTC
TTTCCTTGTCTGAGGTGGCTGCCAGCCCAGGGGGTGGTGTGTAAATCTTCAGGCTGGTGGAGGTAGGTTGGCCTTTTATCCACAGGATAC
AGAAACTGAAAGCTGGGGAATCCCCAAACAGCAGCCATAGACTCACTGGCTCTCATTAAACGGGAGAGGAATCACAGAAACTGGGGAAGG
GAAAACAAACCTTCAAAGGAGAAATTTCGCTTTAATGACACCATTCATCATTCGTTTTTTAATTAGGAAAAGCTCCCTAATGAGGCTCTT
TTGCCAGCTAATAGGACTCTCGATTTCCATGAGAACCATTCTTGCCCAGAGGATTAGGGGAGCTGTTGCTCACCACACCAGGATCTTCCC
CCAGCGTCCAATTTAATTTGCAAATACGTAATGCAGATTCCCTGGGTGCCGTGAAAGCCTTTCCTGGCATCATTCATGTTGCTCCCCGTG
CTGGCTGGAAAGCACGGTTCTCCTCTGCCTTAAAAACAGTGCCCAACAGTGAACTGCCCCTCCGAGGACTTGAGTAAGTGGAAAAAACAA
AACACAGACTGCAATGTTTGTTTCTAAGTATTTTTGTATTGTGTACATTCTGTATATTTTTGTTGTAACATATTATTTGAGCACAGATTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000538145_chr17_30615811_+_1411nt
ACGGTTTATCTCGCGAATTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAG
ATTGATCCTTCCCGGGAAGAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAG
GGCTTATCCTTTTGTGGCGGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGA
TGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGA
GCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGA
GCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCT
GCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGC
AGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCA
TGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAA
TTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAG
GGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTG
TGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCT
TTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCAC
TGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGC
TGCCGCCTCCCCCCTGAGGGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTC

>In-frame_MED1_ENST00000300651_chr17_37604051_-_RHBDL3_ENST00000536287_chr17_30615811_+_4704nt
ACGGTTTATCTCGCGAATTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAG
ATTGATCCTTCCCGGGAAGAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAG
GGCTTATCCTTTTGTGGCGGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGAGTCAGAAAAGCTGAGTAAGA
TGAGTTCTCTCCTGGAACGGCTCCATGCAAAATTTAACCAAAATAGACCCTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTCATGATGA
GCAACAAGCGTTCCAACAGCTTCCGCCAAGCCATCCTGCAGGGCAACCGCAGGCTAAGCAGCAAGGCCCTGCTGGAGGAGAAGGGGCTGA
GCCTCTCGCAGCGACTTATCCGCCATGTGGCCTATGAGACCCTGCCCCGGGAAATTGACCGCAAGTGGTACTATGACAGCTACACCTGCT
GCCCCCCACCCTGGTTCATGATCACAGTCACGCTGCTGGAGGTTGCCTTTTTCCTCTACAATGGGGTGTCACTAGGTCAATTTGTACTGC
AGGTAACTCATCCACGTTACTTGAAGAACTCCCTGGTTTACCACCCACAGCTGCGAGCACAGGTTTGGCGCTACCTGACATACATCTTCA
TGCATGCAGGGATAGAACACCTGGGACTCAATGTGGTGCTGCAGCTGCTGGTGGGGGTGCCCCTGGAGATGGTGCATGGAGCCACCCGAA
TTGGGCTTGTCTACGTGGCCGGTGTTGTGGCAGGGTCCTTGGCAGTGTCTGTGGCTGACATGACCGCTCCAGTCGTGGGCTCTTCTGGAG
GGGTGTATGCTCTCGTCTCTGCCCATCTGGCCAACATTGTCATGAACTGGTCAGGCATGAAGTGCCAGTTCAAGCTGCTGCGGATGGCTG
TGGCCCTTATCTGTATGAGCATGGAGTTTGGGCGGGCCGTGTGGCTCCGCTTCCACCCGTCGGCCTATCCCCCGTGCCCTCACCCAAGCT
TTGTGGCGCACTTGGGTGGCGTGGCCGTGGGCATCACCCTGGGCGTGGTGGTCCTGAGGAACTACGAGCAGAGGCTCCAGGACCAGTCAC
TGTGGTGGATTTTTGTGGCCATGTACACCGTCTTCGTGCTGTTCGCTGTCTTCTGGAACATCTTTGCCTACACCCTGCTGGACTTAAAGC
TGCCGCCTCCCCCCTGAGGGCTGGAGGCCCAAGGTCGGGGAGGGGAGGGAAAAGCAGCACCCACAGGGAGCGCCTGCGAGGTTTCTTCTC
ATCACCAGCTCAGCTAGGCCGGGCAGACAAGGACAGAAGACTCTGGGCCACTGTAATGTTTGTGTTTAGATTTGGACACACAGTGGAGAC
CCTTTTCTGAAAGGCATCTGGCGGAGGAGTTGATGTGGCTGCTGTCGTTTTTCTCGGCTGCTCTGATGACATCGGGCCAGGGTGAAGGTC
TGGGGTGGGGTGTGAGAGTGGCCCTCCCTCACCTGGGCTGGGCTTCTTCCATGGGGCCAGGGGGTGCCCCCTCACTGCTGCGGATTGAGC
AGCAGCTTCTTCCTCCTCCTCTACCCTCAGAGACCCTAAGAGACATGGGAAGGCTCGAAGGTTGTTGCGTCCAGGCATGGCCCCTCTCTA
GCTCAGAAATAATTGCAGGCCATGTGGTGTCTCCTTGACACCTGCTGTGTCTGGGGCTCCAGTAAGAAGAGGGCCTACTGGACATGTCAG
CTGTGACCTGGCTGAAACCAGGGTGCCCTCCTGGGCTGGTTGGTGTGCACCGGGGCATGATCTGTTGTGCCTGGGTTGGGCAGAGCAGGG
AGCCTGTAGGCTCTAGGACCCCTCTTGTGCTGGGGGTACCCAGTGAGAGGGACCCATGCAGGGGGAATAAACTTCATTCCAAGTTCCACC
CTGGAGAAGACAGACCCAGGACCAGCTTCAGACTTCTCCCTCCCTTTCTTCCAGGATATTGGCATCTCACACGGGTGCCCCAGCCTCCAT
GCCCAGCCTTGTTTTAGGGTCTTTTTCTTTCCTTTTGCTGCCCTGACACTACTTTGTGCCTCTCTTTGGTTATGGAGACAGTGTTTTGAA
ACATTCATGCGTGTGTGTGTGTGTGTGCGTATATGTGTGTATGTGATGGGAAAGGTAACTGAGGCACGACAGCGCCTGCAGAGAAGGCAT
GGAGGATGCAGGGGGCCCATGTGGGCATCCGTGAGAGGTGGCAGACCGTGGTGTGCTGTGGTTGCTGAATGTCCTTGCTTTGACAAAGCC
TGCCCCCTTCCTTCCCATCTCCTGTCCCTTCCACACCTGCCCCTGAGCATCACTGACCGGTGGCAGAATGGCCCTGCTGGAGGGAGAGCT
CAAGCCCTCCAAGGATCCCTGGATGCTGAGGTTTGCCAGGTTCAGCTCTTGTTTCCGTCTGAGATGGCCTTCATATCCAAAAAGGTTCCA
TCCTATCTCCCTTAGGAGAGAAAGAGCTTTGGGGGCGCAAGAGAGGCTGGGGTAGGAATGTTGAGGCCATGTGTCCATTTAAGTTAGGGG
GACAGGAGGCTACAGGAAGAGGAATTCCAGTTTAGTTGGAAAACTTTGCCTCAGGAGAATTGTTGGGTGCATGGATGAACCTCAGAGGGA
GGGCAGCCAGTAGCCTCGGAGGCTTGGATGCGGGAGAGAACATGGTGGTTATCAAATCCACCCCACCCCATTACACAGGTGAGAAAACAA
GATGGAGGGAATGACCCTCCTAACAGGAGCTGGTGCAGGCCCCGAATGGAGGGCATGAGGATGACCTTTGACAAAAGATGACACTCCCTT
TATCGTGCTCTTGGAATTCTCAACCACTGACAGCCCAGAAGAACAAAGAACGCCAGGCCTGGGAGGAGGCAGGGGGGCTGGGCGTGTCCA
GAAACAGGGGCAGGAGTGTGGGAACGGTCTTCCTCCAGCCTGGTGCCCATCCTGGCCCTTGAGTGTAGCAGGGTCCAGGGTCAGTCAGGC
CAGGCATTTGGGGTCTTGGGCCACAGTGGCTTCCCATCCTGGTGACTACATGTAAATGGGCTCACTCACTCACTGGCAGGCGAGGCCCAG
CCATACCGCATCTTGGCCCACTGCTAAATAGATTGCCCTGGCCTCATCCACATATGTAGTTCCCTAGGTCCTGCTCCCCTGCACCAGTGC
CATGCTGAGGGCCGCAGCCTGTGGCACTGTGGGCCCACGCCTTTGGCGGTGTTGCGTCAGCCTGGGGCGTCTTGTGTGTGCCCTGCCCAC
CGTTCTCTGCCCTAGTGATAGAAAGATGTAGATGGAAGTCAGTGCCTCAGAGGAGGAGGCTCTGAGGCTGTGGAGCTGGGCTCAGGGAAG
ACCAGGGGAGGATGCAGAAGGAGTCAGGACATTGCTGCCTCTGCCTGGGCTGCAGCCGCACTAAGCTGAGCGATGAGGTCCTTTCCTGGA
GGGATGGAGAATCCCCTCCAGATTCCTGTCCTGGCCCCTGGGGATTCTGTGGTGTGGGTGGAATGAGCAGAGTGCCACCTCTGTCTGGTA
TGACCTGGAGAGGGGGCTTCCTCTCTTAGGGGTGAGAAAGCATTGAACTAGAAGATTCTAGAAATCCCTCATAGAAGCACTCAGCTCCCT
CGGGGACTCCCAGGGAAGCTTGTTACTGAGAAGGACAGTGGAGGCGGAATCGTGTCTCCCACCATGTTAAGTGTGTCCTCTGCTGCCAAG
GACCCTCGTCTACACCTTAGACCACCAGCCCCAGCTGTTCTCTGTCAGCACACCCACCTCCATCCCCTCTCCCAACCATGACTTCCAAGC
GGGGCCACAGGGTGGGGTCATAGGGTCACTTCACCTGACCCAGGCCTCTCCCCAGGTCAGGAGGCAGCTGTCTGGTCAGAGGGGTTCTCT
TTGTGGCATCTGGCTTTCTCCTCAGCAGGTCCCACCACCCTCTCAGCAGCACTTCCCCATGGCCAAGGCTGGCCGTGTCCTCTGTGCCTC
TTTCCTTGTCTGAGGTGGCTGCCAGCCCAGGGGGTGGTGTGTAAATCTTCAGGCTGGTGGAGGTAGGTTGGCCTTTTATCCACAGGATAC
AGAAACTGAAAGCTGGGGAATCCCCAAACAGCAGCCATAGACTCACTGGCTCTCATTAAACGGGAGAGGAATCACAGAAACTGGGGAAGG
GAAAACAAACCTTCAAAGGAGAAATTTCGCTTTAATGACACCATTCATCATTCGTTTTTTAATTAGGAAAAGCTCCCTAATGAGGCTCTT
TTGCCAGCTAATAGGACTCTCGATTTCCATGAGAACCATTCTTGCCCAGAGGATTAGGGGAGCTGTTGCTCACCACACCAGGATCTTCCC
CCAGCGTCCAATTTAATTTGCAAATACGTAATGCAGATTCCCTGGGTGCCGTGAAAGCCTTTCCTGGCATCATTCATGTTGCTCCCCGTG
CTGGCTGGAAAGCACGGTTCTCCTCTGCCTTAAAAACAGTGCCCAACAGTGAACTGCCCCTCCGAGGACTTGAGTAAGTGGAAAAAACAA
AACACAGACTGCAATGTTTGTTTCTAAGTATTTTTGTATTGTGTACATTCTGTATATTTTTGTTGTAACATATTATTTGAGCACAGATTC


Top

FusionGenePPI for MED1_RHBDL3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MED1MED10, MED9, MED29, MED19, MED28, MED26, PPARGC1A, NR3C1, YWHAQ, TGS1, TP53, CDK8, VDR, MED1, HNF4A, THRA, THRAP3, MED24, AR, ESR1, ESR2, MED13, MED6, MED16, MED17, MED20, MED14, MED12, MED23, MED27, MED4, MED7, MED8, MED30, MED22, MED31, MED15, MED18, MED11, MED25, POLR2A, MED21, POLR2F, GABPA, GATA1, ATM, POU1F1, GATA2, PARP1, RXRA, TRRAP, PPARG, RARA, SREBF1, KAT2A, SUPT3H, SUPT7L, MYC, CCNC, CDK19, POLR2E, CDK9, ZC3H13, TRIP4, OBFC1, QKI, TADA2A, TRA, NR1H2, KIF1A, BRD4, CTDP1, NCOA6, ELAVL1, MDM2, ZNF281, ZNF326, RALY, SETD7, FBXW7, MED13L, EPAS1, EZH2, BAG3, GJB5, PIN1, POLL, NR1I3, TCL1B, HNRNPC, NTRK1, POLR2G, EMC2, SMEK1, MED12L, RPAP2, POLR2D, BIRC5, PLK1, SPAG5RHBDL3PTCRA, EIF2AK3, BIK, VCP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-21716_590441582ESR1
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217656_1066441582ESR1
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-21816_59044557ESR1
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218656_106644557ESR1
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217681_715441582GATA1
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218681_71544557GATA1
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217622_701441582PPARGC1A and THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218622_70144557PPARGC1A and THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217108_212441582the Mediator complex
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217215_390441582the Mediator complex
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218108_21244557the Mediator complex
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218215_39044557the Mediator complex
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-2171_670441582the Mediator complex and THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-2181_67044557the Mediator complex and THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217405_644441582THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218405_64444557THRA
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-2171249_1421441582TP53
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-2181249_142144557TP53
HgeneMED1chr17:37604051chr17:30615811ENST00000300651-217542_789441582VDR
HgeneMED1chr17:37604051chr17:30615811ENST00000394287-218542_78944557VDR


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MED1_RHBDL3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MED1_RHBDL3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMED1C0014175Endometriosis1CTD_human
HgeneMED1C2239176Liver carcinoma1CTD_human
HgeneMED1C4277682Chemical and Drug Induced Liver Injury1CTD_human