FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21517

FusionGeneSummary for MED1_PIP4K2B

check button Fusion gene summary
Fusion gene informationFusion gene name: MED1_PIP4K2B
Fusion gene ID: 21517
HgeneTgene
Gene symbol

MED1

PIP4K2B

Gene ID

8930

8396

Gene namemethyl-CpG binding domain 4, DNA glycosylasephosphatidylinositol-5-phosphate 4-kinase type 2 beta
SynonymsMED1PI5P4KB|PIP5K2B|PIP5KIIB|PIP5KIIbeta|PIP5P4KB
Cytomap

3q21.3

17q12

Type of geneprotein-codingprotein-coding
Descriptionmethyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylaseG/5-fluorouracil mismatch glycosylase with biphasic kineticsG/T mismatch glycosylaseG/U mismatch glycosylasemethyl-CpG binding domain protein 4methyl-CpG-binding endonuclease 1methphosphatidylinositol 5-phosphate 4-kinase type-2 beta1-phosphatidylinositol 5-phosphate 4-kinase 2-beta1-phosphatidylinositol-4-phosphate kinasePI(5)P 4-kinase type II betaPIP4KII-betaPTDINS(4)P-5-kinasediphosphoinositide kinase 2-betaphosphatidyli
Modification date2018052320180519
UniProtAcc

Q15648

P78356

Ensembl transtripts involved in fusion geneENST00000394287, ENST00000300651, 
ENST00000269554, ENST00000311500, 
Fusion gene scores* DoF score25 X 11 X 9=24757 X 6 X 4=168
# samples 259
** MAII scorelog2(25/2475*10)=-3.30742852519225
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/168*10)=-0.900464326449086
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MED1 [Title/Abstract] AND PIP4K2B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A1XJ-01AMED1chr17

37607291

-PIP4K2Bchr17

36943173

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394287ENST00000269554MED1chr17

37607291

-PIP4K2Bchr17

36943173

-
5CDS-5UTRENST00000394287ENST00000311500MED1chr17

37607291

-PIP4K2Bchr17

36943173

-
In-frameENST00000300651ENST00000269554MED1chr17

37607291

-PIP4K2Bchr17

36943173

-
5CDS-5UTRENST00000300651ENST00000311500MED1chr17

37607291

-PIP4K2Bchr17

36943173

-

Top

FusionProtFeatures for MED1_PIP4K2B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MED1

Q15648

PIP4K2B

P78356

Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors (PubMed:10406464, PubMed:11867769,PubMed:12037571, PubMed:12218053, PubMed:12556447,PubMed:14636573, PubMed:15340084, PubMed:15471764,PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as acoactivator for GATA1-mediated transcriptional activation duringerythroid differentiation of K562 erythroleukemia cells(PubMed:24245781). {ECO:0000269|PubMed:10406464,ECO:0000269|PubMed:11867769, ECO:0000269|PubMed:12037571,ECO:0000269|PubMed:12218053, ECO:0000269|PubMed:12556447,ECO:0000269|PubMed:14636573, ECO:0000269|PubMed:15340084,ECO:0000269|PubMed:15471764, ECO:0000269|PubMed:15989967,ECO:0000269|PubMed:16574658, ECO:0000269|PubMed:24245781,ECO:0000269|PubMed:9653119}. Participates in the biosynthesis of phosphatidylinositol4,5-bisphosphate. {ECO:0000269|PubMed:9038203}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-1171078_148281582Compositional biasNote=Ser-rich
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-1171496_152981582Compositional biasNote=Lys-rich
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-1181078_14828557Compositional biasNote=Ser-rich
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-1181496_15298557Compositional biasNote=Lys-rich
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117604_60881582MotifNote=LXXLL motif 1
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117645_64981582MotifNote=LXXLL motif 2
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118604_6088557MotifNote=LXXLL motif 1
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118645_6498557MotifNote=LXXLL motif 2
TgenePIP4K2Bchr17:37607291chr17:36943173ENST00000269554-01038_41553417DomainPIPK


Top

FusionGeneSequence for MED1_PIP4K2B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MED1_ENST00000394287_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_372aa
MKAQGETEDQXAEQCSCSCHANARXLQSLQQDQGGQSSLQXGEPAQPLXVXGVLPHGVPKPSGEVWNXXSGLPEFSDAQRPHQQXQPGSV
WHAFPHHLRPALCHQDCVQRGRGGDAQHLKEIPPVYSGVSWQHAFATVPGHVPPDRGWCGNLHGGYQERVQPSAHCASQVXPQGFYGCQR
SERQGEGQGLANIQRQXLPQXRAEAACGRGEXKELPGETEAGRXVLGTAEDHGLQPAGGHPRRGPGRAGGDGGGGAGRGRGVXEXWGGWQ
PTLLLWHTSGQPWQPPQLSSVLWSWGIRPLCXRLCHEKPXKFPQEGGVFHGHHXYPHAIRYKEESCTCCQNGETRGRGRDLDCEPXAVLQ

>In-frame_MED1_ENST00000300651_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_372aa
MKAQGETEDQXAEQCSCSCHANARXLQSLQQDQGGQSSLQXGEPAQPLXVXGVLPHGVPKPSGEVWNXXSGLPEFSDAQRPHQQXQPGSV
WHAFPHHLRPALCHQDCVQRGRGGDAQHLKEIPPVYSGVSWQHAFATVPGHVPPDRGWCGNLHGGYQERVQPSAHCASQVXPQGFYGCQR
SERQGEGQGLANIQRQXLPQXRAEAACGRGEXKELPGETEAGRXVLGTAEDHGLQPAGGHPRRGPGRAGGDGGGGAGRGRGVXEXWGGWQ
PTLLLWHTSGQPWQPPQLSSVLWSWGIRPLCXRLCHEKPXKFPQEGGVFHGHHXYPHAIRYKEESCTCCQNGETRGRGRDLDCEPXAVLQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MED1_ENST00000394287_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_1117nt
ATGAAAGCTCAGGGGGAAACCGAGGATCAATGAGCTGAGCAATGTTCCTGTTCCTGTCATGCTAATGCCAGATGACTTCAAAGCCTACAG
CAAGATCAAGGTGGACAATCATCTCTTCAATAAGGAGAACCTGCCCAGCCGCTTTAAGTTTAAGGAGTATTGCCCCATGGTGTTCCGAAA
CCTTCGGGAGAGGTTTGGAATTGATGATCAGGATTACCAGAATTCAGTGACGCGCAGCGCCCCCATCAACAGTGACAGCCAGGGTCGGTG
TGGCACGCGTTTCCTCACCACCTACGACCGGCGCTTTGTCATCAAGACTGTGTCCAGCGAGGACGTGGCGGAGATGCACAACATCTTAAA
GAAATACCACCAGTTTATAGTGGAGTGTCATGGCAACACGCTTTTGCCACAGTTCCTGGGCATGTACCGCCTGACCGTGGATGGTGTGGA
AACCTACATGGTGGTTACCAGGAACGTGTTCAGCCATCGGCTCACTGTGCATCGCAAGTATGACCTCAAGGGTTCTACGGTTGCCAGAGA
AGCGAGCGACAAGGAGAAGGCCAAGGACTTGCCAACATTCAAAGACAATGACTTCCTCAATGAAGGGCAGAAGCTGCATGTGGGAGAGGA
GAGTAAAAAGAACTTCCTGGAGAAACTGAAGCGGGACGTTGAGTTCTTGGCACAGCTGAAGATCATGGACTACAGCCTGCTGGTGGGCAT
CCACGACGTGGACCGGGCAGAGCAGGAGGAGATGGAGGTGGAGGAGCGGGCAGAGGACGAGGAGTGTGAGAATGATGGGGTGGGTGGCAA
CCTACTCTGCTCCTATGGCACACCTCCGGACAGCCCTGGCAACCTCCTCAGCTTTCCTCGGTTCTTTGGTCCTGGGGAATTCGACCCCTC
TGTTGACGTCTATGCCATGAAAAGCCATGAAAGTTCCCCCAAGAAGGAGGTGTATTTCATGGCCATCATTGATATCCTCACGCCATACGA
TACAAAGAAGAAAGCTGCACATGCTGCCAAAACGGTGAAACACGGGGCAGGGGCCGAGATCTCGACTGTGAACCCTGAGCAGTACTCCAA

>In-frame_MED1_ENST00000300651_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_1117nt
ATGAAAGCTCAGGGGGAAACCGAGGATCAATGAGCTGAGCAATGTTCCTGTTCCTGTCATGCTAATGCCAGATGACTTCAAAGCCTACAG
CAAGATCAAGGTGGACAATCATCTCTTCAATAAGGAGAACCTGCCCAGCCGCTTTAAGTTTAAGGAGTATTGCCCCATGGTGTTCCGAAA
CCTTCGGGAGAGGTTTGGAATTGATGATCAGGATTACCAGAATTCAGTGACGCGCAGCGCCCCCATCAACAGTGACAGCCAGGGTCGGTG
TGGCACGCGTTTCCTCACCACCTACGACCGGCGCTTTGTCATCAAGACTGTGTCCAGCGAGGACGTGGCGGAGATGCACAACATCTTAAA
GAAATACCACCAGTTTATAGTGGAGTGTCATGGCAACACGCTTTTGCCACAGTTCCTGGGCATGTACCGCCTGACCGTGGATGGTGTGGA
AACCTACATGGTGGTTACCAGGAACGTGTTCAGCCATCGGCTCACTGTGCATCGCAAGTATGACCTCAAGGGTTCTACGGTTGCCAGAGA
AGCGAGCGACAAGGAGAAGGCCAAGGACTTGCCAACATTCAAAGACAATGACTTCCTCAATGAAGGGCAGAAGCTGCATGTGGGAGAGGA
GAGTAAAAAGAACTTCCTGGAGAAACTGAAGCGGGACGTTGAGTTCTTGGCACAGCTGAAGATCATGGACTACAGCCTGCTGGTGGGCAT
CCACGACGTGGACCGGGCAGAGCAGGAGGAGATGGAGGTGGAGGAGCGGGCAGAGGACGAGGAGTGTGAGAATGATGGGGTGGGTGGCAA
CCTACTCTGCTCCTATGGCACACCTCCGGACAGCCCTGGCAACCTCCTCAGCTTTCCTCGGTTCTTTGGTCCTGGGGAATTCGACCCCTC
TGTTGACGTCTATGCCATGAAAAGCCATGAAAGTTCCCCCAAGAAGGAGGTGTATTTCATGGCCATCATTGATATCCTCACGCCATACGA
TACAAAGAAGAAAGCTGCACATGCTGCCAAAACGGTGAAACACGGGGCAGGGGCCGAGATCTCGACTGTGAACCCTGAGCAGTACTCCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MED1_ENST00000394287_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_5325nt
TTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGATTGATCCTTCCCGGGAA
GAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAGGGCTTATCCTTTTGTGGC
GGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGATCAATGAGCTGAGCAATGTTCCTGTTCCTGTCATGCTA
ATGCCAGATGACTTCAAAGCCTACAGCAAGATCAAGGTGGACAATCATCTCTTCAATAAGGAGAACCTGCCCAGCCGCTTTAAGTTTAAG
GAGTATTGCCCCATGGTGTTCCGAAACCTTCGGGAGAGGTTTGGAATTGATGATCAGGATTACCAGAATTCAGTGACGCGCAGCGCCCCC
ATCAACAGTGACAGCCAGGGTCGGTGTGGCACGCGTTTCCTCACCACCTACGACCGGCGCTTTGTCATCAAGACTGTGTCCAGCGAGGAC
GTGGCGGAGATGCACAACATCTTAAAGAAATACCACCAGTTTATAGTGGAGTGTCATGGCAACACGCTTTTGCCACAGTTCCTGGGCATG
TACCGCCTGACCGTGGATGGTGTGGAAACCTACATGGTGGTTACCAGGAACGTGTTCAGCCATCGGCTCACTGTGCATCGCAAGTATGAC
CTCAAGGGTTCTACGGTTGCCAGAGAAGCGAGCGACAAGGAGAAGGCCAAGGACTTGCCAACATTCAAAGACAATGACTTCCTCAATGAA
GGGCAGAAGCTGCATGTGGGAGAGGAGAGTAAAAAGAACTTCCTGGAGAAACTGAAGCGGGACGTTGAGTTCTTGGCACAGCTGAAGATC
ATGGACTACAGCCTGCTGGTGGGCATCCACGACGTGGACCGGGCAGAGCAGGAGGAGATGGAGGTGGAGGAGCGGGCAGAGGACGAGGAG
TGTGAGAATGATGGGGTGGGTGGCAACCTACTCTGCTCCTATGGCACACCTCCGGACAGCCCTGGCAACCTCCTCAGCTTTCCTCGGTTC
TTTGGTCCTGGGGAATTCGACCCCTCTGTTGACGTCTATGCCATGAAAAGCCATGAAAGTTCCCCCAAGAAGGAGGTGTATTTCATGGCC
ATCATTGATATCCTCACGCCATACGATACAAAGAAGAAAGCTGCACATGCTGCCAAAACGGTGAAACACGGGGCAGGGGCCGAGATCTCG
ACTGTGAACCCTGAGCAGTACTCCAAACGCTTCAACGAGTTTATGTCCAACATCCTGACGTAGTTCTCTTCTACCTTCAGCCAGAGCCAG
AGAGCTGGATATGGGGTCGGGGATCGGGAGTTAGGGAGAAGGGTGTATTTGGGCTAGATGGGAGGGTGGGAGCAGAGTCGGGTTTGGGAG
GGCTTTAGCAATGAGACTGCAGCCTGTGACACCGAAAGAGACTTTAGCTGAAGAGGAGGGGGATGTGCTGTGTGTGCACCTGCTCACAGG
ATGTAACCCCACCTTCTGCTTACCCTTGATTTTTTCTCCCCATTTGACACCCAGGTTAAAAAGGGGTTCCCTTTTTGGTACCTTGTAACC
TTTTAAGATACCTTGGGGCTAGAGATGACTTCGTGGGTTTATTTGGGTTTTGTTTCTGAAATTTCATTGCTCCAGGTTTGCTATTTATAA
TCATATTTCATCAGCCTACCCACCCTCCCCATCTTTGCTGAGCTCTCAGTTCCCTTCAATTAAAGAGATACCCGGTAGACCCAGCACAAG
GGTCCTTCCAGAACCAAGTGCTATGGATGCCAGATTGGAGAGGTCAGACACCTCGCCCTGCTGCATTTGCTCTTGTCTGGATTAACTTTG
TAATTTATGGAGTATTGTGCACAACTTCCTCCACCTTTCCCTTGGATTCAAGTGAAAACTGTTGCATTATTCCTCCATCCTGTCTGGAAT
ACACCAGGTCAACACCAGAGATCTCAGATCAGAATCAGAGATCTCAGAGGGGAATAAGTTCATCCTCATGGGATGGTGAGGGGCAGGAAA
GCGGCTGGGCTCTTGGACACCTGGTTCTCAGAGAACCCTGTGATGATCACCCAAGCCCCAGGCTGTCTTAGCCCCTGGAGTTCAGAAGTC
CTCTCTGTAAAGCCTGCCTCCCACTAGGTCAAGAGGAACTAGAGTACCTTTGGATTTATCAGGACCCTCATGTTTAAATGGTTATTTCCC
TTTGGGAAAACTTCAGAAACTGATGTATCAAATGAGGCCCTGTGCCCTCGATCTATTTCCTTCTTCCTTCTGACCTCCTCCCAGGCACTC
TTACTTCTAGCCGAACTCTTAGCTCTGGGCAGATCTCCAAGCGCCTGGAGTGCTTTTTAGCAGAGACACCTCGTTAAGCTCCGGGATGAC
CTTGTAGGAGATCTGTCTCCCTGTGCCTGGAGAGTTACAGCCAGCAAGGTGCCCCCATCTTAGAGTGTGGTGTCCAAACGTGAGGTGGCT
TCCTAGTTACATGAGGATGTGATCCAGGAAATCCAGTTTGGAGGCTTGATGTGGGTTTTGACCTGGCCTCAGCCTTGGGGCTGTTTTTCC
TTGTTGCCCCGCTCTAGACTTTTAGCAGATCTGCAGCCCACAGGCTTTTTTGGAAGGAGTGGCTTCCTGCAGGTGTTCCACCTGCCTTCG
GAGCCTGCCACCCAGGCCCTCAGAACTGAGCCACAGGCTGCTCTGGCCAGGAGAGAAACAGCTCTGTTGTTCTGCATTGGGGGAGGTACA
TTCCTGCATCTTCTCACCCCCTCAACCAGGAACTGGGGATTTGGGATGAGATATGGTCAGACTTGTAGATAACCCCAAAGATGTGAAGAT
CGCTTGTGAAACCATTTTGAATGAATAGATTGGTTTCCTGTGGCTCCCTCCAAACCTGGCCAAGCCCAGCTTCCGAAGCAGGAACCAGCA
CTGTCTCTGTGCCTGACTCACAGCATATAGGTCAGGAAAGAATGGAGACGGCATTCTTGGACTTCACTGGGGCTGCTGGATTGGATGGGA
AACCTTCTGGAAGAGGCAGATGGGGGTCAAACCACTGCCTTGGCCCCAGGAAGGGGCCATAGGTAGGTCTGAACAACTGCCGCAAGACCA
CTACATGACTTAGGGAACTTGAAACCAACTGGCTCATGGAGAAAACAAATTTGACTTGGGAAAGGGATTATGTAGGAATAATGTTTGGAC
TTGATTTCCCCACGTCATAATGAAGAATGGAAGTTTGGATCTGCTCCTCGTCAGGCGCAGCATCTCTGAAGCTTGGAAAGCTGTCTTCCA
GCAGCCTCCGTGGCCTCGGGTTCCTACCGGCTTCTCTGCATTTGGTCTGCTGATCATGTTGCCATAATGTGTATGGAAAGTGTAACACAT
TCTTACTGGTTAAAGACGACTACCAGGTATCTAACTTGTTTAACATTGAGTTTGTGTGTGTGTGTGTATGTTTGTGTGTTTTGTATATTG
TTTACATTTTGAGAGGTAGCATTCTGTTTCAAATGCTTTTTGTTTTTCTGACAGTATTGTTGACTGGGTCATAACATTTTGAGCTGTGGT
TTGGTGGATTTTCAATTTTTTTTTTTAAAGGTCATTCGCTGTGCTATCTTCAAAACCTTGAGTTTGGCCCCCAATTTTTGGCATTCAAAT
GTTTAAAAGCTATTTATCTTGGTTTATACAAGTTTCCTTTCTCTTCTTTTTGTCATGGTATTCTATTTGGTCTGCAGTTTGAATGTAGAG
AAAGTGGACTGATCCCCCAAGCGTTGTCTGCCCCCACTCTTTCCTCCTTGGGTCCCGCCATTCTTTTACTGGGCAGTCGAGGGCATTGGA
GGGGAAGTGACTGCCCTCAGCCTCACTCCCTGGGGCCATGAAGAAAAGCTAAACAGTCTCATGGCATCTCAGAATAATGTTGGGTCTCCC
AAGAAGAAAGGTGTAAGAATAACGACATGGCTGATTAGGCGAGGCCAGGATAGGGCTAAGGCCAGGATTCCTGGCTGGCATCCAGTCACC
CCTTCTCCCATCCTTCCCCCTCTTCTTCCACAAGTCCGCAGCCGAGACACTGTAGTCTCCCAGCCACAGTGATGAGTGCCCTGGAGACTC
CACTGACCTCTAGATGAAGGCCCCTGGCCCTGGTTCCTGTTAATTAACCTCTGGGTCTTTGAGTCCCCCAGCACAAACTTCTTTCCTGTA
CCCTGCGGCTTGGGGTCACAGGGCATGCCGGGAAGCCACAGCTGAGGGGCGCAGACTGAAGCAGTGCTCCACCTCTCCTTCTTTAGCTCA
GGGGTTGCTGGTCTGTGGCAGGCGCCACGAGTGGCCCCTGTGGCTGTTCTCAGTGGCAGTCTCTTAAGTTCCCACCACAGGCAGCTCTTT
ATCCCCTCTCCCTACTTGACTCTTTCTCTTGCCTGTGCTTTTGGCCTCAAACAGGCCTGCTGGTAGCGCTCAGGGCGTGAGGCTACACTC
CTGCCCTGCCTTTCCTGTCTTCATGGTCTGCCAGGGCATACCTTGGGGAGGTGGACCAAAGACCCAGGACTTTTTGCAGTAGCCAGTCCT
ACCCCCCAGTTGTCTTTTTACCAATTCAGGGTGGGAGAGAAAACTGCAGCACCCCAGCATGTGAGTTACTCAGGTGTTGGGGGCTAGAAG
GGACAGTGCGTTTAAACAACACTCAGAGCTCTGGCCTTAAACCTGTGGCCCCCCAAGTCTAGGAGCCTCATCTCTTCCTGGCAGTCATGC
GGGCAGGAGGTCCTGAAAGGGAAAACCCATTCAGACAACTGTTCCCCAATCTACCAGCCATCTGCAGGGGTCAGTGACCGTGGCCCTCTC
CCTCCTCTAGAATGTGCCACTTATGAAGAGTGCCCCATGGGGAAAAGGAGACTCAGCTGTCCCTTGGCAGCTTGTGCCAGTATCCCAGGG
CAGAAGTTTCCACAGGAGCCTCTTGCCCTTGCGCAGAGCCACTGTGAGAGGCGGTGGGAGCCAACACCCTTGGGGGAGGGGGCAGTACTG
CTCGGCACATCCCAGCATCAGGTCAGATCATTGAAATTAAAAAATGTGAATTAAGTTCATATCCACCTTTTGGGGAAGCAGGACAAACCA
CCACCCCACCAAGTGTGTGACTTCTCCATATCCCACTGCAGTTTCCATTTTTTAAATGGGAATTTTCAATCCCCTGTGCTTGTCTAACGT
CTGCTTTAAAAAGTTTGAGACCCTGTTACTGTTTGAAAATGCATGCATGTTACGATGAATCTCCAACCTGAGGAAAAAAATAAAACTCAA

>In-frame_MED1_ENST00000300651_chr17_37607291_-_PIP4K2B_ENST00000269554_chr17_36943173_-_5343nt
ACGGTTTATCTCGCGAATTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCTCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAG
ATTGATCCTTCCCGGGAAGAGTAGGGACTGCTGGTGCCCTGCGTCCCGGGATCCCGAGCCAACTTGTTTCCTCCGTTAGTGGTGGGGAAG
GGCTTATCCTTTTGTGGCGGATCTAGCTTCTCCTCGCCTTCAGGATGAAAGCTCAGGGGGAAACCGAGGATCAATGAGCTGAGCAATGTT
CCTGTTCCTGTCATGCTAATGCCAGATGACTTCAAAGCCTACAGCAAGATCAAGGTGGACAATCATCTCTTCAATAAGGAGAACCTGCCC
AGCCGCTTTAAGTTTAAGGAGTATTGCCCCATGGTGTTCCGAAACCTTCGGGAGAGGTTTGGAATTGATGATCAGGATTACCAGAATTCA
GTGACGCGCAGCGCCCCCATCAACAGTGACAGCCAGGGTCGGTGTGGCACGCGTTTCCTCACCACCTACGACCGGCGCTTTGTCATCAAG
ACTGTGTCCAGCGAGGACGTGGCGGAGATGCACAACATCTTAAAGAAATACCACCAGTTTATAGTGGAGTGTCATGGCAACACGCTTTTG
CCACAGTTCCTGGGCATGTACCGCCTGACCGTGGATGGTGTGGAAACCTACATGGTGGTTACCAGGAACGTGTTCAGCCATCGGCTCACT
GTGCATCGCAAGTATGACCTCAAGGGTTCTACGGTTGCCAGAGAAGCGAGCGACAAGGAGAAGGCCAAGGACTTGCCAACATTCAAAGAC
AATGACTTCCTCAATGAAGGGCAGAAGCTGCATGTGGGAGAGGAGAGTAAAAAGAACTTCCTGGAGAAACTGAAGCGGGACGTTGAGTTC
TTGGCACAGCTGAAGATCATGGACTACAGCCTGCTGGTGGGCATCCACGACGTGGACCGGGCAGAGCAGGAGGAGATGGAGGTGGAGGAG
CGGGCAGAGGACGAGGAGTGTGAGAATGATGGGGTGGGTGGCAACCTACTCTGCTCCTATGGCACACCTCCGGACAGCCCTGGCAACCTC
CTCAGCTTTCCTCGGTTCTTTGGTCCTGGGGAATTCGACCCCTCTGTTGACGTCTATGCCATGAAAAGCCATGAAAGTTCCCCCAAGAAG
GAGGTGTATTTCATGGCCATCATTGATATCCTCACGCCATACGATACAAAGAAGAAAGCTGCACATGCTGCCAAAACGGTGAAACACGGG
GCAGGGGCCGAGATCTCGACTGTGAACCCTGAGCAGTACTCCAAACGCTTCAACGAGTTTATGTCCAACATCCTGACGTAGTTCTCTTCT
ACCTTCAGCCAGAGCCAGAGAGCTGGATATGGGGTCGGGGATCGGGAGTTAGGGAGAAGGGTGTATTTGGGCTAGATGGGAGGGTGGGAG
CAGAGTCGGGTTTGGGAGGGCTTTAGCAATGAGACTGCAGCCTGTGACACCGAAAGAGACTTTAGCTGAAGAGGAGGGGGATGTGCTGTG
TGTGCACCTGCTCACAGGATGTAACCCCACCTTCTGCTTACCCTTGATTTTTTCTCCCCATTTGACACCCAGGTTAAAAAGGGGTTCCCT
TTTTGGTACCTTGTAACCTTTTAAGATACCTTGGGGCTAGAGATGACTTCGTGGGTTTATTTGGGTTTTGTTTCTGAAATTTCATTGCTC
CAGGTTTGCTATTTATAATCATATTTCATCAGCCTACCCACCCTCCCCATCTTTGCTGAGCTCTCAGTTCCCTTCAATTAAAGAGATACC
CGGTAGACCCAGCACAAGGGTCCTTCCAGAACCAAGTGCTATGGATGCCAGATTGGAGAGGTCAGACACCTCGCCCTGCTGCATTTGCTC
TTGTCTGGATTAACTTTGTAATTTATGGAGTATTGTGCACAACTTCCTCCACCTTTCCCTTGGATTCAAGTGAAAACTGTTGCATTATTC
CTCCATCCTGTCTGGAATACACCAGGTCAACACCAGAGATCTCAGATCAGAATCAGAGATCTCAGAGGGGAATAAGTTCATCCTCATGGG
ATGGTGAGGGGCAGGAAAGCGGCTGGGCTCTTGGACACCTGGTTCTCAGAGAACCCTGTGATGATCACCCAAGCCCCAGGCTGTCTTAGC
CCCTGGAGTTCAGAAGTCCTCTCTGTAAAGCCTGCCTCCCACTAGGTCAAGAGGAACTAGAGTACCTTTGGATTTATCAGGACCCTCATG
TTTAAATGGTTATTTCCCTTTGGGAAAACTTCAGAAACTGATGTATCAAATGAGGCCCTGTGCCCTCGATCTATTTCCTTCTTCCTTCTG
ACCTCCTCCCAGGCACTCTTACTTCTAGCCGAACTCTTAGCTCTGGGCAGATCTCCAAGCGCCTGGAGTGCTTTTTAGCAGAGACACCTC
GTTAAGCTCCGGGATGACCTTGTAGGAGATCTGTCTCCCTGTGCCTGGAGAGTTACAGCCAGCAAGGTGCCCCCATCTTAGAGTGTGGTG
TCCAAACGTGAGGTGGCTTCCTAGTTACATGAGGATGTGATCCAGGAAATCCAGTTTGGAGGCTTGATGTGGGTTTTGACCTGGCCTCAG
CCTTGGGGCTGTTTTTCCTTGTTGCCCCGCTCTAGACTTTTAGCAGATCTGCAGCCCACAGGCTTTTTTGGAAGGAGTGGCTTCCTGCAG
GTGTTCCACCTGCCTTCGGAGCCTGCCACCCAGGCCCTCAGAACTGAGCCACAGGCTGCTCTGGCCAGGAGAGAAACAGCTCTGTTGTTC
TGCATTGGGGGAGGTACATTCCTGCATCTTCTCACCCCCTCAACCAGGAACTGGGGATTTGGGATGAGATATGGTCAGACTTGTAGATAA
CCCCAAAGATGTGAAGATCGCTTGTGAAACCATTTTGAATGAATAGATTGGTTTCCTGTGGCTCCCTCCAAACCTGGCCAAGCCCAGCTT
CCGAAGCAGGAACCAGCACTGTCTCTGTGCCTGACTCACAGCATATAGGTCAGGAAAGAATGGAGACGGCATTCTTGGACTTCACTGGGG
CTGCTGGATTGGATGGGAAACCTTCTGGAAGAGGCAGATGGGGGTCAAACCACTGCCTTGGCCCCAGGAAGGGGCCATAGGTAGGTCTGA
ACAACTGCCGCAAGACCACTACATGACTTAGGGAACTTGAAACCAACTGGCTCATGGAGAAAACAAATTTGACTTGGGAAAGGGATTATG
TAGGAATAATGTTTGGACTTGATTTCCCCACGTCATAATGAAGAATGGAAGTTTGGATCTGCTCCTCGTCAGGCGCAGCATCTCTGAAGC
TTGGAAAGCTGTCTTCCAGCAGCCTCCGTGGCCTCGGGTTCCTACCGGCTTCTCTGCATTTGGTCTGCTGATCATGTTGCCATAATGTGT
ATGGAAAGTGTAACACATTCTTACTGGTTAAAGACGACTACCAGGTATCTAACTTGTTTAACATTGAGTTTGTGTGTGTGTGTGTATGTT
TGTGTGTTTTGTATATTGTTTACATTTTGAGAGGTAGCATTCTGTTTCAAATGCTTTTTGTTTTTCTGACAGTATTGTTGACTGGGTCAT
AACATTTTGAGCTGTGGTTTGGTGGATTTTCAATTTTTTTTTTTAAAGGTCATTCGCTGTGCTATCTTCAAAACCTTGAGTTTGGCCCCC
AATTTTTGGCATTCAAATGTTTAAAAGCTATTTATCTTGGTTTATACAAGTTTCCTTTCTCTTCTTTTTGTCATGGTATTCTATTTGGTC
TGCAGTTTGAATGTAGAGAAAGTGGACTGATCCCCCAAGCGTTGTCTGCCCCCACTCTTTCCTCCTTGGGTCCCGCCATTCTTTTACTGG
GCAGTCGAGGGCATTGGAGGGGAAGTGACTGCCCTCAGCCTCACTCCCTGGGGCCATGAAGAAAAGCTAAACAGTCTCATGGCATCTCAG
AATAATGTTGGGTCTCCCAAGAAGAAAGGTGTAAGAATAACGACATGGCTGATTAGGCGAGGCCAGGATAGGGCTAAGGCCAGGATTCCT
GGCTGGCATCCAGTCACCCCTTCTCCCATCCTTCCCCCTCTTCTTCCACAAGTCCGCAGCCGAGACACTGTAGTCTCCCAGCCACAGTGA
TGAGTGCCCTGGAGACTCCACTGACCTCTAGATGAAGGCCCCTGGCCCTGGTTCCTGTTAATTAACCTCTGGGTCTTTGAGTCCCCCAGC
ACAAACTTCTTTCCTGTACCCTGCGGCTTGGGGTCACAGGGCATGCCGGGAAGCCACAGCTGAGGGGCGCAGACTGAAGCAGTGCTCCAC
CTCTCCTTCTTTAGCTCAGGGGTTGCTGGTCTGTGGCAGGCGCCACGAGTGGCCCCTGTGGCTGTTCTCAGTGGCAGTCTCTTAAGTTCC
CACCACAGGCAGCTCTTTATCCCCTCTCCCTACTTGACTCTTTCTCTTGCCTGTGCTTTTGGCCTCAAACAGGCCTGCTGGTAGCGCTCA
GGGCGTGAGGCTACACTCCTGCCCTGCCTTTCCTGTCTTCATGGTCTGCCAGGGCATACCTTGGGGAGGTGGACCAAAGACCCAGGACTT
TTTGCAGTAGCCAGTCCTACCCCCCAGTTGTCTTTTTACCAATTCAGGGTGGGAGAGAAAACTGCAGCACCCCAGCATGTGAGTTACTCA
GGTGTTGGGGGCTAGAAGGGACAGTGCGTTTAAACAACACTCAGAGCTCTGGCCTTAAACCTGTGGCCCCCCAAGTCTAGGAGCCTCATC
TCTTCCTGGCAGTCATGCGGGCAGGAGGTCCTGAAAGGGAAAACCCATTCAGACAACTGTTCCCCAATCTACCAGCCATCTGCAGGGGTC
AGTGACCGTGGCCCTCTCCCTCCTCTAGAATGTGCCACTTATGAAGAGTGCCCCATGGGGAAAAGGAGACTCAGCTGTCCCTTGGCAGCT
TGTGCCAGTATCCCAGGGCAGAAGTTTCCACAGGAGCCTCTTGCCCTTGCGCAGAGCCACTGTGAGAGGCGGTGGGAGCCAACACCCTTG
GGGGAGGGGGCAGTACTGCTCGGCACATCCCAGCATCAGGTCAGATCATTGAAATTAAAAAATGTGAATTAAGTTCATATCCACCTTTTG
GGGAAGCAGGACAAACCACCACCCCACCAAGTGTGTGACTTCTCCATATCCCACTGCAGTTTCCATTTTTTAAATGGGAATTTTCAATCC
CCTGTGCTTGTCTAACGTCTGCTTTAAAAAGTTTGAGACCCTGTTACTGTTTGAAAATGCATGCATGTTACGATGAATCTCCAACCTGAG


Top

FusionGenePPI for MED1_PIP4K2B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MED1MED10, MED9, MED29, MED19, MED28, MED26, PPARGC1A, NR3C1, YWHAQ, TGS1, TP53, CDK8, VDR, MED1, HNF4A, THRA, THRAP3, MED24, AR, ESR1, ESR2, MED13, MED6, MED16, MED17, MED20, MED14, MED12, MED23, MED27, MED4, MED7, MED8, MED30, MED22, MED31, MED15, MED18, MED11, MED25, POLR2A, MED21, POLR2F, GABPA, GATA1, ATM, POU1F1, GATA2, PARP1, RXRA, TRRAP, PPARG, RARA, SREBF1, KAT2A, SUPT3H, SUPT7L, MYC, CCNC, CDK19, POLR2E, CDK9, ZC3H13, TRIP4, OBFC1, QKI, TADA2A, TRA, NR1H2, KIF1A, BRD4, CTDP1, NCOA6, ELAVL1, MDM2, ZNF281, ZNF326, RALY, SETD7, FBXW7, MED13L, EPAS1, EZH2, BAG3, GJB5, PIN1, POLL, NR1I3, TCL1B, HNRNPC, NTRK1, POLR2G, EMC2, SMEK1, MED12L, RPAP2, POLR2D, BIRC5, PLK1, SPAG5PIP4K2BTNFRSF1A, PIP4K2B, SPOP, UBQLN4, MED18, CSNK2A2, HMBOX1, ARL6IP4, EAF1, ZRANB2, EPB41L3, LIN7A, DDX23, MYL9, PRPF8, SKP1, MED4, CLK1, CEP19, PIP4K2A, HIF1AN, LZTS2, ARHGAP22, AHCYL2, GPBP1L1, SPRY4, PRICKLE3, ZNF428, TULP3, TMEM194A, SUN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-11716_59081582ESR1
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117656_106681582ESR1
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-11816_5908557ESR1
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118656_10668557ESR1
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117681_71581582GATA1
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118681_7158557GATA1
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117622_70181582PPARGC1A and THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118622_7018557PPARGC1A and THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117108_21281582the Mediator complex
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117215_39081582the Mediator complex
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118108_2128557the Mediator complex
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118215_3908557the Mediator complex
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-1171_67081582the Mediator complex and THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-1181_6708557the Mediator complex and THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117405_64481582THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118405_6448557THRA
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-1171249_142181582TP53
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-1181249_14218557TP53
HgeneMED1chr17:37607291chr17:36943173ENST00000300651-117542_78981582VDR
HgeneMED1chr17:37607291chr17:36943173ENST00000394287-118542_7898557VDR


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MED1_PIP4K2B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MED1_PIP4K2B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMED1C0014175Endometriosis1CTD_human
HgeneMED1C2239176Liver carcinoma1CTD_human
HgeneMED1C4277682Chemical and Drug Induced Liver Injury1CTD_human