FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21418

FusionGeneSummary for MECOM_ANKRD10

check button Fusion gene summary
Fusion gene informationFusion gene name: MECOM_ANKRD10
Fusion gene ID: 21418
HgeneTgene
Gene symbol

MECOM

ANKRD10

Gene ID

2122

55608

Gene nameMDS1 and EVI1 complex locusankyrin repeat domain 10
SynonymsAML1-EVI-1|EVI1|KMT8E|MDS1|MDS1-EVI1|PRDM3|RUSAT2-
Cytomap

3q26.2

13q34

Type of geneprotein-codingprotein-coding
DescriptionMDS1 and EVI1 complex locus proteinMDS1 and EVI1 complex locus protein EVI1AML1-EVI-1 fusion proteinMDS1 and EVI1 complex locus protein MDS1PR domain 3ecotropic virus integration site 1 protein homologmyelodysplasia syndrome-associated protein 1oncankyrin repeat domain-containing protein 10
Modification date2018052220180519
UniProtAcc

Q03112

Q9NXR5

Ensembl transtripts involved in fusion geneENST00000264674, ENST00000392736, 
ENST00000464456, ENST00000472280, 
ENST00000494292, ENST00000468789, 
ENST00000460814, ENST00000433243, 
ENST00000485957, 
ENST00000267339, 
ENST00000375758, ENST00000489973, 
ENST00000310847, 
Fusion gene scores* DoF score15 X 7 X 10=10504 X 4 X 2=32
# samples 214
** MAII scorelog2(21/1050*10)=-2.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MECOM [Title/Abstract] AND ANKRD10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMECOM

GO:0045892

negative regulation of transcription, DNA-templated

10856240|11568182

HgeneMECOM

GO:0045893

positive regulation of transcription, DNA-templated

11568182|19767769

HgeneMECOM

GO:0051726

regulation of cell cycle

11568182


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-BR-4191-01AMECOMchr3

168849217

-ANKRD10chr13

111536140

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264674ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000264674ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000264674ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000264674ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
In-frameENST00000392736ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000392736ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000392736ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000392736ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
Frame-shiftENST00000464456ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000464456ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000464456ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000464456ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
In-frameENST00000472280ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000472280ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000472280ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000472280ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
In-frameENST00000494292ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000494292ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000494292ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000494292ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
Frame-shiftENST00000468789ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000468789ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000468789ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000468789ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
Frame-shiftENST00000460814ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000460814ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000460814ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000460814ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
Frame-shiftENST00000433243ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-3UTRENST00000433243ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-5UTRENST00000433243ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
5CDS-intronENST00000433243ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-
intron-3CDSENST00000485957ENST00000267339MECOMchr3

168849217

-ANKRD10chr13

111536140

-
intron-3UTRENST00000485957ENST00000375758MECOMchr3

168849217

-ANKRD10chr13

111536140

-
intron-5UTRENST00000485957ENST00000489973MECOMchr3

168849217

-ANKRD10chr13

111536140

-
intron-intronENST00000485957ENST00000310847MECOMchr3

168849217

-ANKRD10chr13

111536140

-

Top

FusionProtFeatures for MECOM_ANKRD10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MECOM

Q03112

ANKRD10

Q9NXR5


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneANKRD10chr3:168849217chr13:111536140ENST00000310847-05124_153-24221RepeatNote=ANK 4
TgeneANKRD10chr3:168849217chr13:111536140ENST00000310847-0521_50-24221RepeatNote=ANK 1
TgeneANKRD10chr3:168849217chr13:111536140ENST00000310847-0557_86-24221RepeatNote=ANK 2
TgeneANKRD10chr3:168849217chr13:111536140ENST00000310847-0591_120-24221RepeatNote=ANK 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-4171065_1116801117Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-3161065_1116161052Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-4171065_1116161053Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-3151065_1116161043Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-3161065_1116161052Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-3161065_1116161053Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-41778_190801117DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-31678_190161052DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-41778_190161053DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-31578_190161043DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-31678_190161052DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-31678_190161053DomainSET
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417609_622801117MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417741_745801117MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417772_776801117MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316609_622161052MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316741_745161052MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316772_776161052MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417609_622161053MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417741_745161053MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417772_776161053MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315609_622161043MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315741_745161043MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315772_776161043MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316609_622161052MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316741_745161052MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316772_776161052MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316609_622161053MotifNuclear localization signal
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316741_745161053MotifCTBP-binding motif 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316772_776161053MotifCTBP-binding motif 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417209_236801117Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417263_285801117Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417291_313801117Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417319_342801117Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417348_370801117Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417376_398801117Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417405_427801117Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417912_934801117Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417940_963801117Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417969_991801117Zinc fingerC2H2-type 10
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316209_236161052Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316263_285161052Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316291_313161052Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316319_342161052Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316348_370161052Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316376_398161052Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316405_427161052Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316912_934161052Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316940_963161052Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316969_991161052Zinc fingerC2H2-type 10
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417209_236161053Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417263_285161053Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417291_313161053Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417319_342161053Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417348_370161053Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417376_398161053Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417405_427161053Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417912_934161053Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417940_963161053Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417969_991161053Zinc fingerC2H2-type 10
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315209_236161043Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315263_285161043Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315291_313161043Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315319_342161043Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315348_370161043Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315376_398161043Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315405_427161043Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315912_934161043Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315940_963161043Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315969_991161043Zinc fingerC2H2-type 10
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316209_236161052Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316263_285161052Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316291_313161052Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316319_342161052Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316348_370161052Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316376_398161052Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316405_427161052Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316912_934161052Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316940_963161052Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316969_991161052Zinc fingerC2H2-type 10
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316209_236161053Zinc fingerC2H2-type 1
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316263_285161053Zinc fingerC2H2-type 2
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316291_313161053Zinc fingerC2H2-type 3
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316319_342161053Zinc fingerC2H2-type 4
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316348_370161053Zinc fingerC2H2-type 5
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316376_398161053Zinc fingerC2H2-type 6
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316405_427161053Zinc fingerC2H2-type 7%3B atypical
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316912_934161053Zinc fingerC2H2-type 8
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316940_963161053Zinc fingerC2H2-type 9
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316969_991161053Zinc fingerC2H2-type 10
TgeneANKRD10chr3:168849217chr13:111536140ENST00000267339-36124_153230421RepeatNote=ANK 4
TgeneANKRD10chr3:168849217chr13:111536140ENST00000267339-3621_50230421RepeatNote=ANK 1
TgeneANKRD10chr3:168849217chr13:111536140ENST00000267339-3657_86230421RepeatNote=ANK 2
TgeneANKRD10chr3:168849217chr13:111536140ENST00000267339-3691_120230421RepeatNote=ANK 3
TgeneANKRD10chr3:168849217chr13:111536140ENST00000375758-47124_153261659RepeatNote=ANK 4
TgeneANKRD10chr3:168849217chr13:111536140ENST00000375758-4721_50261659RepeatNote=ANK 1
TgeneANKRD10chr3:168849217chr13:111536140ENST00000375758-4757_86261659RepeatNote=ANK 2
TgeneANKRD10chr3:168849217chr13:111536140ENST00000375758-4791_120261659RepeatNote=ANK 3


Top

FusionGeneSequence for MECOM_ANKRD10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MECOM_ENST00000264674_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_271aa
MILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMAPDIHAQSLDSAVPL
TNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVINGHLDFPSTTPLSGMESRNGQCLTGTNGISSGLAPGQPFPSSQGSLCISG
TEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVVEHSKSVKVQERYDSAVLGTMHLHHGS

>In-frame_MECOM_ENST00000392736_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_207aa
MKSEDYPHETMAPDIHAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVINGHLDFPSTTPLSGMESRNGQCLT
GTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVV

>In-frame_MECOM_ENST00000472280_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_207aa
MKSEDYPHETMAPDIHAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVINGHLDFPSTTPLSGMESRNGQCLT
GTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVV

>In-frame_MECOM_ENST00000494292_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_395aa
MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGA
GLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVINGHLDFPSTTPLSGME
SRNGQCLTGTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MECOM_ENST00000264674_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_813nt
ATGATCTTAGACGAATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGCTCAAGTACATTAGATTCGCT
GGCTGTTATGATCAGCACAACCTTGTTGCATGCCAGATAAATGATCAGATATTCTATAGAGTAGTTGCAGACATTGCGCCGGGAGAGGAG
CTTCTGCTGTTCATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTC
ACGAATGGCGACACAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTA
TCGAATACATTGACAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGC
CAGTGCTTGACAGGAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGG
ACTGAGGAGCCAGAGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGT
AGGCCTTCCTGGGTGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTG
AACAGTGTGGTCGAGCATTCCAAGTCCGTGAAGGTGCAGGAGCGGTACGACAGTGCCGTGCTGGGCACCATGCACCTGCACCACGGCTCC

>In-frame_MECOM_ENST00000392736_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_621nt
ATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTCACGAATGGCGAC
ACAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTATCGAATACATTG
ACAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGCCAGTGCTTGACA
GGAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGGACTGAGGAGCCA
GAGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGTAGGCCTTCCTGG
GTGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTGAACAGTGTGGTC

>In-frame_MECOM_ENST00000472280_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_621nt
ATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTCACGAATGGCGAC
ACAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTATCGAATACATTG
ACAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGCCAGTGCTTGACA
GGAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGGACTGAGGAGCCA
GAGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGTAGGCCTTCCTGG
GTGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTGAACAGTGTGGTC

>In-frame_MECOM_ENST00000494292_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_1185nt
ATGAGATCCAAAGGCAGGGCAAGGAAACTGGCCACAAATAATGAGTGTGTATATGGCAACTACCCTGAAATACCTTTGGAAGAAATGCCA
GATGCAGATGGAGTAGCCAGCACTCCCTCCCTCAATATTCAAGAGCCATGCTCTCCTGCCACATCCAGTGAAGCATTCACTCCAAAGGAG
GGTTCTCCTTACAAAGCCCCCATCTACATCCCTGATGATATCCCCATTCCTGCTGAGTTTGAACTTCGAGAGTCAAATATGCCTGGGGCA
GGACTAGGAATATGGACCAAAAGGAAGATCGAAGTAGGTGAAAAGTTTGGGCCTTATGTGGGAGAGCAGAGGTCAAACCTGAAAGACCCC
AGTTATGGATGGGAGATCTTAGACGAATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGCTCAAGTAC
ATTAGATTCGCTGGCTGTTATGATCAGCACAACCTTGTTGCATGCCAGATAAATGATCAGATATTCTATAGAGTAGTTGCAGACATTGCG
CCGGGAGAGGAGCTTCTGCTGTTCATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCT
GCCGTGCCACTCACGAATGGCGACACAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAAC
AGTAGCTCCGTATCGAATACATTGACAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAA
AGCAGGAATGGCCAGTGCTTGACAGGAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTC
TGCATTAGTGGGACTGAGGAGCCAGAGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGC
TGCATAGCCAGTAGGCCTTCCTGGGTGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGC
ATCCCAGAACTGAACAGTGTGGTCGAGCATTCCAAGTCCGTGAAGGTGCAGGAGCGGTACGACAGTGCCGTGCTGGGCACCATGCACCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MECOM_ENST00000264674_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_2049nt
CCTTGCCAAGTAACAGCTTTGCTGTCCAACATCGTGTGCTGCTTCGCGAGAAAGTCACATTCGGACCCTTTGGCTAGATTGCTTATTCAT
AGGGCTTCTTGACTAAAGCCCTTGGAGCACTGGGTTTTTCTTGAAGTATATGATCTTAGACGAATTTTACAATGTGAAGTTCTGCATAGA
TGCCAGTCAACCAGATGTTGGAAGCTGGCTCAAGTACATTAGATTCGCTGGCTGTTATGATCAGCACAACCTTGTTGCATGCCAGATAAA
TGATCAGATATTCTATAGAGTAGTTGCAGACATTGCGCCGGGAGAGGAGCTTCTGCTGTTCATGAAGAGCGAAGACTATCCCCATGAAAC
TATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTCACGAATGGCGACACAGAAGACGATGCTGACAAAATGCACGT
TGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTATCGAATACATTGACAAATGGATGTGTCATCAATGGACATTT
GGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGCCAGTGCTTGACAGGAACTAACGGAATTAGCAGTGGATTAGC
CCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGGACTGAGGAGCCAGAGAAGACCCTGAGAGCTAACCCTGAGTT
GTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGTAGGCCTTCCTGGGTGGAAGACATTGGGGATAACCTGTACTA
TGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTGAACAGTGTGGTCGAGCATTCCAAGTCCGTGAAGGTGCAGGA
GCGGTACGACAGTGCCGTGCTGGGCACCATGCACCTGCACCACGGCTCCTAGAGACGCTGACCTGGCTCTCGGAAACGCAGGAGTCCTTC
CTGGTAGCCAGCTCAGAATACCCATGTAGCAGCAACTTGAACGAATGTCACAACTTGTACGTTTTTTATATACTTCAACTTTCTGAAAAA
GTAAACTTCGACAAGTTCCCAGCAACTGCTTGTTTGTGCATGAGTAGGGCTTACTAAGTGCATAGATGTTTCTACAGTGAGGTGTCCTTT
TTATAAGGTGCACTTTTGGAGTTTTTCTGATGCCAATCTCAACATTGTCTTTTTAATACTGTCACCAGATATTGCCATTTTTCTTTTTGT
TAAAAGATTATATGATCAAGATAAATTGGGGTGGTAAATCAGGTGCCTGGTAATTTATCTCTTTGCACATGGGCATCATTTTAAAAAGCT
TGCTTCCACTCTTTTCTGTAGAATTTGACGGAACACAGCTATTTCCCTATGCAAGGTACAGCCTTACAAAGATTTCTGCAGTGATTTGTG
TGAAGAAGAGAACGTTTGTCTTTTTCAATGAAGCTTTGCAGATCACCATGTGGTTGAAGGTTTTAGTTGTGGACACAGTGGTCCCTCCTT
AATGATGAAGATCACTGCCTTGGGCTTCATGGAAAACAGGCCCAGCCTGGGGCTGCGTTTGGATTTATTGTTTTTATTCCACACTTCCTA
CTTGGTCTCTGGAAGTTTTACCACATGTAACAGATTCCTTTATATGTAGTGGAAATCACTATTTGTAGAAACTGTCAGGTCAAAATATTT
AACTGACTGTTGACATGTATTTTCTTTTTTCCTTGTTTTTGTTTTTTGGGGTTTTCTGCTTTAAGATATATACCACTATGTATATCCAGT
TAACTGAGAGAATTTTGACTCTCTTAATAAAACTGCATTAAGTTTTTGATTTTGTAGAAATTAGCTTTTGTCTAGGCAACTAGTGGTTAT
ACTCTGCAAATATTGTAATGAATTTTTACTTTTTTGATTTTTGTAATAAAAATTGGTGCAGATAAAATGTCAAATGAACAAACCAGTGTT

>In-frame_MECOM_ENST00000392736_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_1987nt
CCTTGCCAAGTAACAGCTTTGCTGTCCAACATCGTGTGCTGCTTCGCGAGAAAGTCACATTCGGACCCTTTGGCTAGATTATCTTAGACG
AATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGCTCAAGTACATTAGATTCGCTGGCTGTTATGATC
AGCACAACCTTGTTGCATGCCAGATAAATGATCAGATATTCTATAGAGTAGTTGCAGACATTGCGCCGGGAGAGGAGCTTCTGCTGTTCA
TGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTCACGAATGGCGACA
CAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTATCGAATACATTGA
CAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGCCAGTGCTTGACAG
GAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGGACTGAGGAGCCAG
AGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGTAGGCCTTCCTGGG
TGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTGAACAGTGTGGTCG
AGCATTCCAAGTCCGTGAAGGTGCAGGAGCGGTACGACAGTGCCGTGCTGGGCACCATGCACCTGCACCACGGCTCCTAGAGACGCTGAC
CTGGCTCTCGGAAACGCAGGAGTCCTTCCTGGTAGCCAGCTCAGAATACCCATGTAGCAGCAACTTGAACGAATGTCACAACTTGTACGT
TTTTTATATACTTCAACTTTCTGAAAAAGTAAACTTCGACAAGTTCCCAGCAACTGCTTGTTTGTGCATGAGTAGGGCTTACTAAGTGCA
TAGATGTTTCTACAGTGAGGTGTCCTTTTTATAAGGTGCACTTTTGGAGTTTTTCTGATGCCAATCTCAACATTGTCTTTTTAATACTGT
CACCAGATATTGCCATTTTTCTTTTTGTTAAAAGATTATATGATCAAGATAAATTGGGGTGGTAAATCAGGTGCCTGGTAATTTATCTCT
TTGCACATGGGCATCATTTTAAAAAGCTTGCTTCCACTCTTTTCTGTAGAATTTGACGGAACACAGCTATTTCCCTATGCAAGGTACAGC
CTTACAAAGATTTCTGCAGTGATTTGTGTGAAGAAGAGAACGTTTGTCTTTTTCAATGAAGCTTTGCAGATCACCATGTGGTTGAAGGTT
TTAGTTGTGGACACAGTGGTCCCTCCTTAATGATGAAGATCACTGCCTTGGGCTTCATGGAAAACAGGCCCAGCCTGGGGCTGCGTTTGG
ATTTATTGTTTTTATTCCACACTTCCTACTTGGTCTCTGGAAGTTTTACCACATGTAACAGATTCCTTTATATGTAGTGGAAATCACTAT
TTGTAGAAACTGTCAGGTCAAAATATTTAACTGACTGTTGACATGTATTTTCTTTTTTCCTTGTTTTTGTTTTTTGGGGTTTTCTGCTTT
AAGATATATACCACTATGTATATCCAGTTAACTGAGAGAATTTTGACTCTCTTAATAAAACTGCATTAAGTTTTTGATTTTGTAGAAATT
AGCTTTTGTCTAGGCAACTAGTGGTTATACTCTGCAAATATTGTAATGAATTTTTACTTTTTTGATTTTTGTAATAAAAATTGGTGCAGA
TAAAATGTCAAATGAACAAACCAGTGTTCTAAGAGTGTTACTAACATTTTGTTCTAAAACTGTCCTTCACAAATTGAATAAAAAACTCTC

>In-frame_MECOM_ENST00000472280_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_1987nt
CCTTGCCAAGTAACAGCTTTGCTGTCCAACATCGTGTGCTGCTTCGCGAGAAAGTCACATTCGGACCCTTTGGCTAGATTATCTTAGACG
AATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGCTCAAGTACATTAGATTCGCTGGCTGTTATGATC
AGCACAACCTTGTTGCATGCCAGATAAATGATCAGATATTCTATAGAGTAGTTGCAGACATTGCGCCGGGAGAGGAGCTTCTGCTGTTCA
TGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCTTGGATTCTGCCGTGCCACTCACGAATGGCGACA
CAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATATGAAAAACAGTAGCTCCGTATCGAATACATTGA
CAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTGGGATGGAAAGCAGGAATGGCCAGTGCTTGACAG
GAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGGGTTCTCTCTGCATTAGTGGGACTGAGGAGCCAG
AGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTCCAAGTAGCTGCATAGCCAGTAGGCCTTCCTGGG
TGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTGCTGAAAGCATCCCAGAACTGAACAGTGTGGTCG
AGCATTCCAAGTCCGTGAAGGTGCAGGAGCGGTACGACAGTGCCGTGCTGGGCACCATGCACCTGCACCACGGCTCCTAGAGACGCTGAC
CTGGCTCTCGGAAACGCAGGAGTCCTTCCTGGTAGCCAGCTCAGAATACCCATGTAGCAGCAACTTGAACGAATGTCACAACTTGTACGT
TTTTTATATACTTCAACTTTCTGAAAAAGTAAACTTCGACAAGTTCCCAGCAACTGCTTGTTTGTGCATGAGTAGGGCTTACTAAGTGCA
TAGATGTTTCTACAGTGAGGTGTCCTTTTTATAAGGTGCACTTTTGGAGTTTTTCTGATGCCAATCTCAACATTGTCTTTTTAATACTGT
CACCAGATATTGCCATTTTTCTTTTTGTTAAAAGATTATATGATCAAGATAAATTGGGGTGGTAAATCAGGTGCCTGGTAATTTATCTCT
TTGCACATGGGCATCATTTTAAAAAGCTTGCTTCCACTCTTTTCTGTAGAATTTGACGGAACACAGCTATTTCCCTATGCAAGGTACAGC
CTTACAAAGATTTCTGCAGTGATTTGTGTGAAGAAGAGAACGTTTGTCTTTTTCAATGAAGCTTTGCAGATCACCATGTGGTTGAAGGTT
TTAGTTGTGGACACAGTGGTCCCTCCTTAATGATGAAGATCACTGCCTTGGGCTTCATGGAAAACAGGCCCAGCCTGGGGCTGCGTTTGG
ATTTATTGTTTTTATTCCACACTTCCTACTTGGTCTCTGGAAGTTTTACCACATGTAACAGATTCCTTTATATGTAGTGGAAATCACTAT
TTGTAGAAACTGTCAGGTCAAAATATTTAACTGACTGTTGACATGTATTTTCTTTTTTCCTTGTTTTTGTTTTTTGGGGTTTTCTGCTTT
AAGATATATACCACTATGTATATCCAGTTAACTGAGAGAATTTTGACTCTCTTAATAAAACTGCATTAAGTTTTTGATTTTGTAGAAATT
AGCTTTTGTCTAGGCAACTAGTGGTTATACTCTGCAAATATTGTAATGAATTTTTACTTTTTTGATTTTTGTAATAAAAATTGGTGCAGA
TAAAATGTCAAATGAACAAACCAGTGTTCTAAGAGTGTTACTAACATTTTGTTCTAAAACTGTCCTTCACAAATTGAATAAAAAACTCTC

>In-frame_MECOM_ENST00000494292_chr3_168849217_-_ANKRD10_ENST00000267339_chr13_111536140_-_2380nt
AGAGAGAGGGAGGGAGCGAGAGGGAGAGCAAAAGAAGGAAAGGATCCAAGAAAAAAAAGCCCCAACCACACACCAGCGGCTGCAGGACTG
GGCACAGCATGAGATCCAAAGGCAGGGCAAGGAAACTGGCCACAAATAATGAGTGTGTATATGGCAACTACCCTGAAATACCTTTGGAAG
AAATGCCAGATGCAGATGGAGTAGCCAGCACTCCCTCCCTCAATATTCAAGAGCCATGCTCTCCTGCCACATCCAGTGAAGCATTCACTC
CAAAGGAGGGTTCTCCTTACAAAGCCCCCATCTACATCCCTGATGATATCCCCATTCCTGCTGAGTTTGAACTTCGAGAGTCAAATATGC
CTGGGGCAGGACTAGGAATATGGACCAAAAGGAAGATCGAAGTAGGTGAAAAGTTTGGGCCTTATGTGGGAGAGCAGAGGTCAAACCTGA
AAGACCCCAGTTATGGATGGGAGATCTTAGACGAATTTTACAATGTGAAGTTCTGCATAGATGCCAGTCAACCAGATGTTGGAAGCTGGC
TCAAGTACATTAGATTCGCTGGCTGTTATGATCAGCACAACCTTGTTGCATGCCAGATAAATGATCAGATATTCTATAGAGTAGTTGCAG
ACATTGCGCCGGGAGAGGAGCTTCTGCTGTTCATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGCTCAAAGCT
TGGATTCTGCCGTGCCACTCACGAATGGCGACACAGAAGACGATGCTGACAAAATGCACGTTGATAGGGAGTTTGCTGTTGTAACAGATA
TGAAAAACAGTAGCTCCGTATCGAATACATTGACAAATGGATGTGTCATCAATGGACATTTGGACTTCCCCTCCACGACCCCGCTCAGTG
GGATGGAAAGCAGGAATGGCCAGTGCTTGACAGGAACTAACGGAATTAGCAGTGGATTAGCCCCAGGACAGCCGTTTCCGAGTAGCCAGG
GTTCTCTCTGCATTAGTGGGACTGAGGAGCCAGAGAAGACCCTGAGAGCTAACCCTGAGTTGTGCGGTTCTCTGCACCTGAACGGGAGTC
CAAGTAGCTGCATAGCCAGTAGGCCTTCCTGGGTGGAAGACATTGGGGATAACCTGTACTATGGACACTACCACGGGTTTGGGGACACTG
CTGAAAGCATCCCAGAACTGAACAGTGTGGTCGAGCATTCCAAGTCCGTGAAGGTGCAGGAGCGGTACGACAGTGCCGTGCTGGGCACCA
TGCACCTGCACCACGGCTCCTAGAGACGCTGACCTGGCTCTCGGAAACGCAGGAGTCCTTCCTGGTAGCCAGCTCAGAATACCCATGTAG
CAGCAACTTGAACGAATGTCACAACTTGTACGTTTTTTATATACTTCAACTTTCTGAAAAAGTAAACTTCGACAAGTTCCCAGCAACTGC
TTGTTTGTGCATGAGTAGGGCTTACTAAGTGCATAGATGTTTCTACAGTGAGGTGTCCTTTTTATAAGGTGCACTTTTGGAGTTTTTCTG
ATGCCAATCTCAACATTGTCTTTTTAATACTGTCACCAGATATTGCCATTTTTCTTTTTGTTAAAAGATTATATGATCAAGATAAATTGG
GGTGGTAAATCAGGTGCCTGGTAATTTATCTCTTTGCACATGGGCATCATTTTAAAAAGCTTGCTTCCACTCTTTTCTGTAGAATTTGAC
GGAACACAGCTATTTCCCTATGCAAGGTACAGCCTTACAAAGATTTCTGCAGTGATTTGTGTGAAGAAGAGAACGTTTGTCTTTTTCAAT
GAAGCTTTGCAGATCACCATGTGGTTGAAGGTTTTAGTTGTGGACACAGTGGTCCCTCCTTAATGATGAAGATCACTGCCTTGGGCTTCA
TGGAAAACAGGCCCAGCCTGGGGCTGCGTTTGGATTTATTGTTTTTATTCCACACTTCCTACTTGGTCTCTGGAAGTTTTACCACATGTA
ACAGATTCCTTTATATGTAGTGGAAATCACTATTTGTAGAAACTGTCAGGTCAAAATATTTAACTGACTGTTGACATGTATTTTCTTTTT
TCCTTGTTTTTGTTTTTTGGGGTTTTCTGCTTTAAGATATATACCACTATGTATATCCAGTTAACTGAGAGAATTTTGACTCTCTTAATA
AAACTGCATTAAGTTTTTGATTTTGTAGAAATTAGCTTTTGTCTAGGCAACTAGTGGTTATACTCTGCAAATATTGTAATGAATTTTTAC
TTTTTTGATTTTTGTAATAAAAATTGGTGCAGATAAAATGTCAAATGAACAAACCAGTGTTCTAAGAGTGTTACTAACATTTTGTTCTAA


Top

FusionGenePPI for MECOM_ANKRD10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MECOMHDAC1, CTBP1, HDAC4, CREBBP, KAT2B, SMAD3, MBD3, SUV39H1, EHMT2, SMAD1, SMAD2, SMAD4, SIRT1, ELAVL1, SOX2, PIAS4, PRMT1, UBE2I, SPDEF, NLRP14, PIK3R3, RABGAP1L, MED23, HIC1, FOXJ2, ERMAP, L3MBTL1ANKRD10ELAVL1, APPBP2, NXF1, DPP9, CHRNA9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMECOMchr3:168849217chr13:111536140ENST00000264674-417189_440801117MAPK9%2C SMAD3 and probably SUV39H1
HgeneMECOMchr3:168849217chr13:111536140ENST00000392736-316189_440161052MAPK9%2C SMAD3 and probably SUV39H1
HgeneMECOMchr3:168849217chr13:111536140ENST00000433243-417189_440161053MAPK9%2C SMAD3 and probably SUV39H1
HgeneMECOMchr3:168849217chr13:111536140ENST00000464456-315189_440161043MAPK9%2C SMAD3 and probably SUV39H1
HgeneMECOMchr3:168849217chr13:111536140ENST00000468789-316189_440161052MAPK9%2C SMAD3 and probably SUV39H1
HgeneMECOMchr3:168849217chr13:111536140ENST00000472280-316189_440161053MAPK9%2C SMAD3 and probably SUV39H1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MECOM_ANKRD10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MECOM_ANKRD10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMECOMC0009375Colonic Neoplasms1CTD_human
HgeneMECOMC0023448Lymphoid leukemia1CTD_human
HgeneMECOMC0023470Myeloid Leukemia1CTD_human
HgeneMECOMC0027439Nasopharyngeal Neoplasms1CTD_human
HgeneMECOMC0919267ovarian neoplasm1CTD_human
HgeneMECOMC1458155Mammary Neoplasms1CTD_human
HgeneMECOMC4225221RADIOULNAR SYNOSTOSIS WITH AMEGAKARYOCYTIC THROMBOCYTOPENIA 21UNIPROT