FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21391

FusionGeneSummary for MDM2_POLR3B

check button Fusion gene summary
Fusion gene informationFusion gene name: MDM2_POLR3B
Fusion gene ID: 21391
HgeneTgene
Gene symbol

MDM2

POLR3B

Gene ID

4193

55703

Gene nameMDM2 proto-oncogeneRNA polymerase III subunit B
SynonymsACTFS|HDMX|hdm2C128|HLD8|INMAP|RPC2
Cytomap

12q15

12q23.3

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase Mdm2MDM2 oncogene, E3 ubiquitin protein ligaseMDM2 proto-oncogene, E3 ubiquitin protein ligaseMdm2, p53 E3 ubiquitin protein ligase homologMdm2, transformed 3T3 cell double minute 2, p53 binding proteindouble minute 2, humDNA-directed RNA polymerase III subunit RPC2DNA-directed RNA polymerase III 127.6 kDa polypeptideDNA-directed RNA polymerase III subunit BRNA polymerase III subunit C2interphase nucleus and mitotic apparatus associated proteinpolymerase (RNA) III (DN
Modification date2018052720180523
UniProtAcc

Q00987

Q9NW08

Ensembl transtripts involved in fusion geneENST00000462284, ENST00000356290, 
ENST00000540827, ENST00000258149, 
ENST00000428863, ENST00000393412, 
ENST00000258148, ENST00000544561, 
ENST00000393410, ENST00000393413, 
ENST00000517852, ENST00000545204, 
ENST00000350057, ENST00000360430, 
ENST00000299252, ENST00000348801, 
ENST00000478070, ENST00000544125, 
ENST00000228347, ENST00000539066, 
ENST00000549195, 
Fusion gene scores* DoF score24 X 14 X 8=26882 X 2 X 2=8
# samples 252
** MAII scorelog2(25/2688*10)=-3.42653313811667
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: MDM2 [Title/Abstract] AND POLR3B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMDM2

GO:0000122

negative regulation of transcription by RNA polymerase II

9271120|17310983

HgeneMDM2

GO:0006511

ubiquitin-dependent protein catabolic process

11278372|15314173|16173922|17310983

HgeneMDM2

GO:0016567

protein ubiquitination

9450543|15878855|19656744|20153724

HgeneMDM2

GO:0031648

protein destabilization

9529249|10360174|15314173

HgeneMDM2

GO:0032436

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

11278372

HgeneMDM2

GO:0034504

protein localization to nucleus

10360174

HgeneMDM2

GO:0042176

regulation of protein catabolic process

9153395

HgeneMDM2

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

9529249|10360174

HgeneMDM2

GO:0045184

establishment of protein localization

10360174

HgeneMDM2

GO:0045892

negative regulation of transcription, DNA-templated

9271120

HgeneMDM2

GO:0065003

protein-containing complex assembly

10608892|12915590

HgeneMDM2

GO:0071157

negative regulation of cell cycle arrest

9529249

HgeneMDM2

GO:0071480

cellular response to gamma radiation

16213212

HgeneMDM2

GO:0072717

cellular response to actinomycin D

15314173

HgeneMDM2

GO:1901797

negative regulation of signal transduction by p53 class mediator

16173922


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A48N-01AMDM2chr12

69230529

+POLR3Bchr12

106820975

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000462284ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000462284ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000462284ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000356290ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000356290ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000356290ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000540827ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000540827ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000540827ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000258149ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000258149ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000258149ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000428863ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000428863ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000428863ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393412ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393412ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000393412ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000258148ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000258148ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000258148ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000544561ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000544561ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000544561ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393410ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393410ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000393410ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393413ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000393413ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000393413ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000517852ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000517852ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000517852ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000545204ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000545204ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000545204ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000350057ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000350057ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000350057ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000360430ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000360430ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000360430ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000299252ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
In-frameENST00000299252ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
5CDS-3UTRENST00000299252ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000348801ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000348801ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000348801ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000478070ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000478070ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000478070ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000544125ENST00000228347MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3CDSENST00000544125ENST00000539066MDM2chr12

69230529

+POLR3Bchr12

106820975

+
intron-3UTRENST00000544125ENST00000549195MDM2chr12

69230529

+POLR3Bchr12

106820975

+

Top

FusionProtFeatures for MDM2_POLR3B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MDM2

Q00987

POLR3B

Q9NW08

DNA-dependent RNA polymerase catalyzes the transcriptionof DNA into RNA using the four ribonucleoside triphosphates assubstrates. Second largest core component of RNA polymerase IIIwhich synthesizes small RNAs, such as 5S rRNA and tRNAs. Proposedto contribute to the polymerase catalytic activity and forms thepolymerase active center together with the largest subunit. PolIII is composed of mobile elements and RPC2 is part of the coreelement with the central large cleft and probably a clamp elementthat moves to open and close the cleft (By similarity). Plays akey role in sensing and limiting infection by intracellularbacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensorinvolved in innate immune response. Can sense non-self dsDNA thatserves as template for transcription into dsRNA. The non-self RNApolymerase III transcripts, such as Epstein-Barr virus-encodedRNAs (EBERs) induce type I interferon and NF- Kappa-B through theRIG-I pathway. {ECO:0000250, ECO:0000269|PubMed:19609254,ECO:0000269|PubMed:19631370}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89210_215245437Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011210_215306498Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011243_301306498Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+8927_107245437DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+4527_107130322DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+5627_107130322DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+3427_107105297DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+101127_107306498DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+4527_107105297DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89179_185245437MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89190_202245437MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011179_185306498MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011190_202306498MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011210_304306498RegionNote=ARF-binding
TgenePOLR3Bchr12:69230529chr12:106820975ENST00000228347+11281080_10953671134Zinc fingerNote=C4-type
TgenePOLR3Bchr12:69230529chr12:106820975ENST00000539066+11281080_10953091076Zinc fingerNote=C4-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89243_301245437Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45210_215130322Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45243_301130322Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13210_2150266Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13243_3010266Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56210_215130322Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56243_301130322Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34210_215105297Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34243_301105297Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13210_215-92219Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13243_301-92219Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12210_2150219Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12243_3010219Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14210_215-102271Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14243_301-102271Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45210_215105297Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45243_301105297Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+1327_1070266DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+1327_107-92219DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+1227_1070219DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+1427_107-102271DomainNote=SWIB
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89466_473245437MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45179_185130322MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45190_202130322MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45466_473130322MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13179_1850266MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13190_2020266MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13466_4730266MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56179_185130322MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56190_202130322MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56466_473130322MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34179_185105297MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34190_202105297MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34466_473105297MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13179_185-92219MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13190_202-92219MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13466_473-92219MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12179_1850219MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12190_2020219MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12466_4730219MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14179_185-102271MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14190_202-102271MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14466_473-102271MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011466_473306498MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45179_185105297MotifNuclear localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45190_202105297MotifNote=Nuclear export signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45466_473105297MotifNucleolar localization signal
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89210_304245437RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89242_331245437RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45210_304130322RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45242_331130322RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13210_3040266RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13242_3310266RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56210_304130322RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56242_331130322RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34210_304105297RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34242_331105297RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13210_304-92219RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13242_331-92219RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12210_3040219RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12242_3310219RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14210_304-102271RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14242_331-102271RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011242_331306498RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45210_304105297RegionNote=ARF-binding
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45242_331105297RegionNote=Region II
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89299_328245437Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89438_479245437Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45299_328130322Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45438_479130322Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13299_3280266Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13438_4790266Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56299_328130322Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56438_479130322Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34299_328105297Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34438_479105297Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13299_328-92219Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13438_479-92219Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12299_3280219Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12438_4790219Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14299_328-102271Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14438_479-102271Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011299_328306498Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011438_479306498Zinc fingerRING-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45299_328105297Zinc fingerRanBP2-type
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45438_479105297Zinc fingerRING-type


Top

FusionGeneSequence for MDM2_POLR3B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_1073aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEE
GQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIST
GNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPI
VKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKK
QKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGK
QAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKR
YTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMI
SSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYG
TAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEME

>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_1073aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEE
GQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIST
GNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPI
VKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKK
QKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGK
QAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKR
YTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMI
SSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYG
TAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEME

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_897aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVN
AISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDME
DGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYI
IVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQC
AMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKC
TLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIE
KVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGR
FHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRL

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_897aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVN
AISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDME
DGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYI
IVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQC
AMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKC
TLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIE
KVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGR
FHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRL

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_872aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGE
SDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSR
LSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELS
YPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFE
DFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLL
ATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKP
IWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPE
IGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTN
YLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISS

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_872aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGE
SDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSR
LSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELS
YPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFE
DFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLL
ATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKP
IWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPE
IGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTN
YLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISS

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_1012aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPS
FSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDW
LDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVI
PKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPS
DTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFV
SISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPF
TLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIE
DALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEG
SNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPH
GFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHA
RARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQCGLLGTSGWCHYCKSSCHVSSLRIPTACKL

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_1012aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPS
FSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDW
LDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVI
PKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPS
DTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFV
SISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPF
TLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIE
DALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEG
SNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPH
GFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHA
RARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQCGLLGTSGWCHYCKSSCHVSSLRIPTACKL

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_1018aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVS
EHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKK
IADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQW
GMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAG
TINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTH
LEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMST
SGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVT
QIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPD
IIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMV
LDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQCGLLGTSGWCHYCKSSCHVSSLRI

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_1018aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVS
EHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKK
IADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQW
GMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAG
TINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTH
LEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMST
SGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVT
QIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPD
IIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMV
LDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQCGLLGTSGWCHYCKSSCHVSSLRI

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_1042aa
MCNTNMSVPTDGAVTTSQIPASEQETLVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPSFSVKEHRKITTMIYRNLVVVNQQES
SDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREI
CCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDP
EISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMM
TRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLN
GNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVET
LDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKT
KTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDAD
GICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHG
QKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSG
ITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQ

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_1042aa
MCNTNMSVPTDGAVTTSQIPASEQETLVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPSFSVKEHRKITTMIYRNLVVVNQQES
SDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREI
CCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDP
EISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMM
TRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLN
GNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVET
LDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKT
KTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDAD
GICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHG
QKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSG
ITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISSDAFEVDVCGQ

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_872aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGE
SDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSR
LSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELS
YPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFE
DFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLL
ATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKP
IWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPE
IGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTN
YLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISS

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_872aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEVTQVTVTQAGE
SDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNWSLKRFKMDRQGVTQVLSR
LSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELS
YPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFE
DFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQCAMGKQAMGTIGYNQRNRIDTLMTLL
ATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKCTLKRYTNQTFDKVMGPMLDAATRKP
IWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIEKVMISSNAEDAFLIKMLLRQTRRPE
IGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRHGTN
YLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGTGASMLLLERLMISS

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_897aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVN
AISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDME
DGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYI
IVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQC
AMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKC
TLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIE
KVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGR
FHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRL

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_897aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEVTQVTVTQAGESDTDSFEEDPEISLALLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVN
AISTGNWSLKRFKMDRQGVTQVLSRLSTISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDME
DGPIVKLASNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVNTFRLMRRAGTINEFVSISTNLTDRCVTISSDGGRLCRPYI
IVKKQKPAVTNKHMEELAQGYRNFEDFLHESLVETLDVNEENDCNIALYEHTINKDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTTQC
AMGKQAMGTIGYNQRNRIDTLMTLLATPQKPMVKTKTIELIEFEKLPAGQNATVAVMSTSGTDIEDALVLNKASLDRGFGRCLVTKNAKC
TLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSTIE
KVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGR
FHYGTAFGGSKVKDVCEDLVRHGTNYLGKDTVTSGITGEPLEAYITFGPVYTQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3219nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
TCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAA
GAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAA
TTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAG
ATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGAT
TGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAA
GGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGAT
CCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTG
ATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACC
GGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATG
ATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCT
TCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATT
GTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTT
AATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTT
GTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAA
CAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAA
TATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCC
TTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAA
CAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAG
ACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATT
GAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGA
TACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCA
GATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAA
GGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATA
TCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCAT
GGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCA
CACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGC
ACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCC
GGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCAT
GCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAA
CGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGG
CAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAG

>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3219nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
TCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAA
GAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAA
TTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAG
ATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGAT
TGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAA
GGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGAT
CCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTG
ATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACC
GGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATG
ATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCT
TCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATT
GTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTT
AATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTT
GTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAA
CAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAA
TATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCC
TTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAA
CAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAG
ACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATT
GAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGA
TACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCA
GATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAA
GGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATA
TCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCAT
GGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCA
CACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGC
ACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCC
GGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCAT
GCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAA
CGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGG
CAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAG

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_2691nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_2691nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_2616nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_2616nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3036nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTAT
ATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGC
TTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3036nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTAT
ATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGC
TTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3054nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
GAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTG
TGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGT
GAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTAT
AGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGAT
TCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAG
ATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTG
AATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATA
TCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGG
GGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATG
GAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTG
TTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGA
TATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTAC
ATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACAT
GAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCAC
TTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAG
TGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAA
AAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTAT
AGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAA
TGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACAT
GAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACT
CAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATT
GAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAA
TTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGAC
ATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGC
AGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAA
GACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTG
CTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGT
CTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAG
GTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATT

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3054nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
GAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTG
TGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGT
GAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTAT
AGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGAT
TCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAG
ATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTG
AATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATA
TCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGG
GGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATG
GAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTG
TTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGA
TATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTAC
ATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACAT
GAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCAC
TTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAG
TGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAA
AAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTAT
AGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAA
TGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACAT
GAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACT
CAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATT
GAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAA
TTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGAC
ATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGC
AGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAA
GACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTG
CTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGT
CTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAG
GTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATT

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3126nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3126nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_2616nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_2616nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_2691nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_2691nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_4170nt
GGGGCGCGCACCGAGGCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGC
CCGAGGGGCGGCCGCGACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGC
CCAGTGCCCTGGCCCGGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGA
GGGACCCCCGACTCCAAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTG
TAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCAC
AAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATA
TTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCT
ACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTG
ATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAG
CAATTAGTGAGACAGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAG
GGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTA
ATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGA
TCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGT
CTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCC
TCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACAC
ACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGC
TCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGAC
TCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAA
GGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATT
TTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTA
ATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCAC
CGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATC
TACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAG
TTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTG
TATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGA
AACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGT
CCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAG
CAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTC
CAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATT
CTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGG
CCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTT
ATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGA
AGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTC
GTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTT
CAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACG
TGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGT
ACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTC
TCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAA
ACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAA
AGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAAT
TTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTG
TCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATA
ATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATG

>In-frame_MDM2_ENST00000462284_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_4168nt
GGGGCGCGCACCGAGGCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGC
CCGAGGGGCGGCCGCGACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGC
CCAGTGCCCTGGCCCGGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGA
GGGACCCCCGACTCCAAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTG
TAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCAC
AAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATA
TTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCT
ACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTG
ATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAG
CAATTAGTGAGACAGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAG
GGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTA
ATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGA
TCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGT
CTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCC
TCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACAC
ACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGC
TCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGAC
TCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAA
GGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATT
TTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTA
ATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCAC
CGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATC
TACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAG
TTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTG
TATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGA
AACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGT
CCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAG
CAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTC
CAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATT
CTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGG
CCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTT
ATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGA
AGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTC
GTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTT
CAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACG
TGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGT
ACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTC
TCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAA
ACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAA
AGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAAT
TTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTG
TCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATA
ATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATG

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3645nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAAT
TTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTA
CTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACT
TGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACA
TGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTG
TAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGA
GTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACT
TGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTAT
TATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAG
TGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTT
CTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCC
AAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGT
ACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTC
ACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTG
ATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTG
GACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCT
TTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGG
ATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAG
TGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCA
TAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGA
GACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACA
TGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGC
TGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACC
TCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCC
CCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCA
CTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAG
AGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCA
AGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGT
TAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGG
ATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATAC
TCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAG
ATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAA
TGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGG
TCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAG
TCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTG

>In-frame_MDM2_ENST00000356290_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3643nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAAT
TTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTA
CTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACT
TGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACA
TGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTG
TAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGA
GTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACT
TGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTAT
TATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAG
TGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTT
CTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCC
AAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGT
ACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTC
ACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTG
ATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTG
GACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCT
TTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGG
ATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAG
TGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCA
TAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGA
GACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACA
TGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGC
TGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACC
TCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCC
CCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCA
CTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAG
AGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCA
AGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGT
TAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGG
ATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATAC
TCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAG
ATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAA
TGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGG
TCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAG
TCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTG

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3570nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATC
AGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATG
AGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTC
TTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTG
ATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAA
TGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAA
AAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTG
GTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAG
AAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAG
ACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATC
GATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATA
TGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATT
GTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGAC
TTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACC
AGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTG
AGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCT
CTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGA
TGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAG
TAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGT
ACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGA
TCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCG
TCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGG
GGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGG
ATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCAT
ACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCC
TTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCA
GTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCT
GGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGA
ACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAA
CGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAG
AGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGG
CTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTT
ACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGA
ATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAA
ACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCT

>In-frame_MDM2_ENST00000540827_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3568nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATC
AGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATG
AGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTC
TTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTG
ATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAA
TGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAA
AAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTG
GTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAG
AAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAG
ACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATC
GATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATA
TGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATT
GTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGAC
TTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACC
AGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTG
AGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCT
CTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGA
TGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAG
TAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGT
ACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGA
TCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCG
TCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGG
GGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGG
ATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCAT
ACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCC
TTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCA
GTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCT
GGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGA
ACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAA
CGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAG
AGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGG
CTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTT
ACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGA
ATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAA
ACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCT

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3990nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAA
ATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAG
TAGTCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAG
GGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTA
ATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGA
TCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGT
CTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCC
TCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACAC
ACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGC
TCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGAC
TCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAA
GGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATT
TTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTA
ATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCAC
CGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATC
TACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAG
TTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTG
TATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGA
AACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGT
CCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAG
CAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTC
CAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATT
CTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGG
CCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTT
ATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGA
AGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTC
GTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTT
CAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACG
TGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGT
ACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTC
TCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAA
ACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAA
AGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAAT
TTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTG
TCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATA
ATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATG

>In-frame_MDM2_ENST00000258149_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3988nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAA
ATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAG
TAGTCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAG
GGGAGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTA
ATTCTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGA
TCACCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGT
CTCGCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCC
TCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACAC
ACATCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGC
TCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGAC
TCATGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAA
GGCTATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATT
TTGAAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTA
ATAAAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCAC
CGAGAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATC
TACTAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAG
TTGCTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTG
TATATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGA
AACCTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGT
CCATGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAG
CAACAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTC
CAGAAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATT
CTGGCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGG
CCGGTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTT
ATAACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGA
AGCTGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTC
GTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTT
CAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACG
TGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGT
ACAATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTC
TCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAA
ACAACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAA
AGGATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAAT
TTACCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTG
TCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATA
ATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATG

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3717nt
CGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTC
CAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTA
TGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATG
ATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAG
TCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATG
AAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTG
ATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCG
ACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGG
AGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATT
CTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCA
CCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTC
GCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCC
AGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACA
TCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCT
CTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCA
TGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGC
TATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTG
AAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATA
AAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGA
GAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTAC
TAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTG
CTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTAT
ATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAAC
CTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCA
TGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAA
CAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAG
AAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTG
GCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCG
GTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATA
ACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGC
TGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTG
ATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAA
GTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGT
CTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACA
ATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCC
TCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACA
ACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGG
ATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTA
CCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCG
TGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATG
AATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAA

>In-frame_MDM2_ENST00000258148_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3715nt
CGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTC
CAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTA
TGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATG
ATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAG
TCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATG
AAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTG
ATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCG
ACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGG
AGAGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATT
CTGAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCA
CCAATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTC
GCTTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCC
AGCCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACA
TCACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCT
CTTACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCA
TGAGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGC
TATGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTG
AAGATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATA
AAGACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGA
GAAACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTAC
TAGCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTG
CTGTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTAT
ATAAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAAC
CTATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCA
TGCCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAA
CAGACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAG
AAATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTG
GCATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCG
GTGTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATA
ACTACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGC
TGAAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTG
ATGGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAA
GTGATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGT
CTTCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACA
ATGAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCC
TCCTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACA
ACCTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGG
ATAAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTA
CCATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCG
TGGTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATG
AATTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAA

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3775nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG
CTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAG
AGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCT
CTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGA
GATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCT
TGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTC
TTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAA
TTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTC

>In-frame_MDM2_ENST00000350057_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3773nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCATTTGAAGAAGATCCT
GAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATTGCCGACCAGGTGATT
CCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAATGCTATTTCTACCGGA
AATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCCGCACTGGGCATGATG
ACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGAATGCTGTGTCCTTCG
GACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAAGATGGACCCATTGTT
AAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTTCTTAAT
GGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATATATCAATGAATTTGTT
TCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATAATTGTCAAGAAACAG
AAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAGAGTCTGGTTGAATAT
TTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTGGAGATTGAACCCTTC
ACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGTGCCATGGGGAAACAA
GCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAACCCATGGTTAAGACA
AAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGTGGCTATGATATTGAA
GATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGTACGTTGAAACGATAC
ACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAAATCTTAGATGCAGAT
GGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAGATTCCTTTGGAAGGA
AGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAAAAAGTGATGATATCT
TCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTCAGCAGTCGTCATGGG
CAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATCATCATGAACCCACAC
GGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGATTCCACTACGGCACT
GCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGACTATGTTACATCCGGC
ATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTAGATAAAATGCATGCC
CGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTCGGGGAAATGGAACGT
GACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTTGATGTCTGTGGGCAG
TGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCGTATGCCTGCAAGCTG
CTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAAAAATGATTATTAAAG
AGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCCTTGCGTATTCTCTCT
CTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCCTCGAGCCATGGGAGA
GATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACTTATGTGCTGATCTCT
TGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAACCATATTCAAGATTC
TTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGATAAATTTTCCCAACAA
TTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTGTCAAGCAAGAATGTC

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3265nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT
GAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTC
CTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAAC
CTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGAT
AAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACC
ATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTG
GTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAA
TTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAATA

>In-frame_MDM2_ENST00000360430_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3263nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAG
AGTGATACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCT
GAAATGAAAAAGATTGCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACC
AATGGCATGGTGAATGCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGC
TTGTCATATATATCCGCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAG
CCATCTCAGTGGGGAATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATC
ACAACTGATATGGAAGATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCT
TACCCAAATGTGTTTCTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATG
AGAAGAGCAGGATATATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTA
TGCAGACCCTACATAATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAA
GATTTCTTACATGAGAGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAA
GACACCACCCACTTGGAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGA
AACACTTATCAGTGTGCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTA
GCATATCCACAAAAACCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCT
GTGATGAGCTATAGTGGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATAT
AAAAATGCTAAATGTACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCT
ATCTGGCGACATGAAATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATG
CCCACAGTGACTCAGATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACA
GACTCATATATTGAAAAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAA
ATTGGAGACAAATTCAGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGC
ATCTGTCCGGACATCATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGT
GTGCTGGACGGCAGATTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAAC
TACTTGGGGAAAGACTATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTG
AAACACATGGTGCTAGATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGAT
GGTGGCTTGCGTCTCGGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGT
GATGCCTTTGAGGTTGATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCT
TCCCTCCGTATTCCGTATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAAT
GAATGAGGATGGAAAAAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTC
CTGTGAAGAATTCCCTTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAAC
CTTGATCATTGAGCCTCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGAT
AAATAAGCTATTACTTATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACC
ATATCTTCTGGCTAACCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTG
GTGGCTGGCTCGGATAAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAA
TTTGTTCCTACCTTGTCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAATA

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000228347_chr12_106820975_+_3340nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG
TATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAA
AAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCC
TTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCC
TCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACT
TATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAA
CCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGAT
AAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTG
TCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAATACTATTCGTTAAATAT

>In-frame_MDM2_ENST00000299252_chr12_69230529_+_POLR3B_ENST00000539066_chr12_106820975_+_3338nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGATACAGATTCA
TTTGAAGAAGATCCTGAAATTTCCTTAGCTCTTTTATCTCTTCTTTTTGAAGACTTGTTCAAAAAATTTAATTCTGAAATGAAAAAGATT
GCCGACCAGGTGATTCCTAAGCAAAGAGCAGCCCAGTTTGATGTTGTCAAACACATGCGCCAAGACCAGATCACCAATGGCATGGTGAAT
GCTATTTCTACCGGAAATTGGTCTTTAAAGAGATTTAAAATGGACCGCCAGGGTGTAACCCAAGTGCTGTCTCGCTTGTCATATATATCC
GCACTGGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAAACGAGAAAAGTGAGTGGTCCTCGCTCCCTCCAGCCATCTCAGTGGGGA
ATGCTGTGTCCTTCGGACACTCCTGAAGGAGAGGCATGTGGTTTGGTTAAAAACTTGGCCCTTATGACACACATCACAACTGATATGGAA
GATGGACCCATTGTTAAATTAGCCAGTAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGGGAAGAGCTCTCTTACCCAAATGTGTTT
CTTGTCTTTCTTAATGGTAACATCTTAGGTGTCATTCGAGACCACAAAAAGCTAGTGAATACATTTCGACTCATGAGAAGAGCAGGATAT
ATCAATGAATTTGTTTCCATCTCAACAAATCTTACAGATCGATGTGTCTATATTTCTTCTGATGGGGGAAGGCTATGCAGACCCTACATA
ATTGTCAAGAAACAGAAGCCAGCAGTCACAAATAAACATATGGAAGAGCTGGCCCAAGGGTACAGGAATTTTGAAGATTTCTTACATGAG
AGTCTGGTTGAATATTTAGATGTGAATGAAGAAAATGATTGTAACATTGCACTGTACGAACACACAATTAATAAAGACACCACCCACTTG
GAGATTGAACCCTTCACTCTTCTCGGCGTGTGTGCTGGACTTATCCCATACCCTCACCATAACCAGTCACCGAGAAACACTTATCAGTGT
GCCATGGGGAAACAAGCCATGGGTACTATAGGATACAACCAGCGAAACAGAATTGATACTCTCATGTATCTACTAGCATATCCACAAAAA
CCCATGGTTAAGACAAAAACCATTGAATTGATAGAATTTGAGAAACTGCCAGCTGGACAGAATGCAACAGTTGCTGTGATGAGCTATAGT
GGCTATGATATTGAAGATGCTCTTGTTTTAAACAAGGCCTCTTTAGACAGAGGCTTTGGGCGTTGCCTTGTATATAAAAATGCTAAATGT
ACGTTGAAACGATACACCAATCAGACTTTTGATAAAGTGATGGGGCCCATGTTGGATGCTGCTACAAGGAAACCTATCTGGCGACATGAA
ATCTTAGATGCAGATGGTATTTGTTCTCCAGGTGAGAAAGTAGAAAACAAACAAGTGCTTGTAAATAAGTCCATGCCCACAGTGACTCAG
ATTCCTTTGGAAGGAAGTAATGTACCACAGCAACCACAGTACAAAGATGTACCCATAACCTACAAAGGAGCAACAGACTCATATATTGAA
AAAGTGATGATATCTTCAAATGCTGAAGATGCTTTTCTGATCAAAATGCTGCTGAGACAGACAAGGCGTCCAGAAATTGGAGACAAATTC
AGCAGTCGTCATGGGCAAAAAGGTGTTTGTGGCTTGATCGTCCCCCAGGAAGACATGCCATTTTGTGATTCTGGCATCTGTCCGGACATC
ATCATGAACCCACACGGCTTCCCATCACGAATGACGGTGGGGAAGCTCATTGAGCTGCTGGCTGGCAAGGCCGGTGTGCTGGACGGCAGA
TTCCACTACGGCACTGCGTTTGGAGGCAGTAAAGTGAAGGATGTGTGTGAGGACCTCGTTCGCCATGGTTATAACTACTTGGGGAAAGAC
TATGTTACATCCGGCATCACAGGTGAGCCCTTAGAAGCATACATCTATTTTGGCCCCGTGTACTATCAGAAGCTGAAACACATGGTGCTA
GATAAAATGCATGCCCGGGCCCGGGGCCCACGAGCCGTCCTTACCAGGCAACCCACTGAAGGACGGTCTCGTGATGGTGGCTTGCGTCTC
GGGGAAATGGAACGTGACTGTTTAATCGGTTATGGAGCCAGTATGCTTTTGCTAGAGAGACTAATGATTTCAAGTGATGCCTTTGAGGTT
GATGTCTGTGGGCAGTGTGGACTTCTGGGGTATTCTGGCTGGTGCCATTACTGCAAGTCATCCTGCCACGTGTCTTCCCTCCGTATTCCG
TATGCCTGCAAGCTGCTCTTCCAGGAACTACAGTCTATGAACATCATCCCCAGGTTAAAACTGTCCAAGTACAATGAATGAGGATGGAAA
AAATGATTATTAAAGAGAACAAGTGATACATCCAATGCAACGGAAAGCAGAAGGGATTTAGGACTACGTCTCCTCCTGTGAAGAATTCCC
TTGCGTATTCTCTCTCTAAAACAACCAAAAAAAAATGGAGAGGCTTTTTATATACTCTAAGACTGGCTAAACAACCTTGATCATTGAGCC
TCGAGCCATGGGAGAGATGCTGACCATGTGGACTGCAAGGCTGCTTGATTCACAGATGGATGTGACCTAAAGGATAAATAAGCTATTACT
TATGTGCTGATCTCTTGACATTCACTCATTAGAAGACCTTACTCCTTCAAGCAAATGTTTGGGGTCAAATTTACCATATCTTCTGGCTAA
CCATATTCAAGATTCTTCTGAAACTTGGAGGATGTAAAGAATCCATTTGATTTGGTCAGCCTGGCTTTTGTCGTGGTGGCTGGCTCGGAT
AAATTTTCCCAACAATTAAATCTTGCCTTTACACACCCAAACTTTGTAATTTTAGTCTTGGTGAAATATAATGAATTTGTTCCTACCTTG
TCAAGCAAGAATGTCGTCTTCTCCTATGGACTCAATTGCTATTATTTTAAACCTGCATGATTGTACCATGCAATACTATTCGTTAAATAT


Top

FusionGenePPI for MDM2_POLR3B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MDM2TP53, MDC1, CTBP1, CTBP2, TP73, PML, RPL11, RPL5, CDKN2A, NUMB, UBE2A, HIF1A, KAT5, HDAC1, EID1, MDM4, KAT2B, EP300, TBP, TAF1, MDM2, ESR1, ARRB2, ABL1, CCNG1, ARRB1, TSG101, RB1, MTBP, FKBP3, RYBP, RRM2B, RPL26, GNAS, FOXO4, IGF1R, DAXX, DHFR, GNL3, CCAR1, PSMD10, PSME3, PTK2, AR, PPM1D, USP7, COPS5, SFN, RBBP6, CDH1, CHEK2, YWHAQ, NCL, UBE2G2, UBE2U, UBE2Z, PYHIN1, BANP, DDX17, E2F1, TRIM28, UBC, GATA3, ATF3, HIST2H2BE, RPL23, YY1, AKT1, RAD23A, CDKN1A, NR3C1, UBE2I, HIST3H3, EHMT1, SUV39H1, RPS27L, RPS27, ADRB2, SIVA1, MTA1, RCHY1, UBE2D1, CASP2, RPS27A, RPS7, G3BP2, PSMD2, PAK1IP1, RPS6KB1, ZNF668, TP63, PCNA, USP10, PSMC1, PSMD4, PSMC3, PSMC5, PSMC6, PSMA7, PSMD1, RUNX3, GNL3L, TERT, APEX1, UIMC1, CREBBP, SOX4, UBE4B, TBRG1, BAIAP2L1, RFWD3, ERBB3, PA2G4, HEXIM1, CDK9, DYRK2, HSP90AA1, HSPA4, HSPA8, LAMP2, RPS3, USP2, TRIM13, XRCC6, GORAB, FOXO1, FOXO3, UCHL1, S100A1, S100A2, S100A4, S100A6, S100B, USP42, CUL1, BTRC, FBXW11, CSNK1D, RFWD2, SMURF1, NOTCH4, CSNK1A1, PDLIM7, SENP3, RN5S1@, PDE4D, NOTCH1, SNAI1, RASSF1, TRIM27, RFFL, RPS14, PPP2R4, TTF1, PSMB6, PSMA8, RASSF3, NR0B2, UBE2B, PIAS1, RANBP1, LATS1, RAD50, NBN, MRE11A, CUL4A, DTL, PIM1, GSK3B, PSMA3, ESR2, ADRBK1, AATF, HNRNPK, BUB1B, SUMO1, RASSF5, UBE2D2, POLH, NPM1, TCAP, CDK5RAP3, ARIH2, IRF2, RPS25, TPT1, ANG, RHOA, PDCD5, CDKN2AIP, LATS2, WWOX, MED1, ERCC6, ERCC8, DDB1, CUL4B, HIPK2, DHRS2, CASP3, ITCH, EEF1A1, DCD, TUBB, TUBB2A, KRT14, RPS20, GAPDH, TUBA1C, GSN, ERBB4, XIAP, HNF4A, PLK1, NME2, NEDD4, DAPK1, DAPK3, ATM, PBX1, UBE2D3, UBE3A, UBE2L3, UBE2E2, UBE2E3, RNF2, EGR1, PAK6, DLG4, IRF1, VCP, STRA13, GADD45A, RABL6, RPS26, RPL37, RPS15, RNF8, TRIM4, TRIM23, TRAF5, TRIM9, MKRN3, PHF7, RNF10, RNF126, UBE2K, LMO7, HLA-DMB, SETDB1, YY1AP1, NACA, ATF4, MYD88, RELA, SDHC, WT1, SORBS2, HRSP12, DNAJB4, GCAT, SHPK, POT1, ANKRD17, GLTSCR2, SESN2, RASSF6, JUND, EZR, RYR2, JUN, CLSTN1, APP, CLU, SREK1, SET, HSP90B1, CWC25, ZNF133, PKM, TAB1, RPL6, AURKA, NOC2L, JAK1, XPC, PGAM1, PGAM2, DNAJB1, ANAPC2, NLK, SNAI2, RBM38, FHIT, AGPS, ALDH16A1, DDX5, DHX9, DLAT, EDC4, EIF2AK1, ESYT1, GTF2I, HMHA1, HNRNPM, HNRNPU, HRNR, HSP90AB1, IARS, IFI16, IGF2BP3, ILF3, KARS, CCAR2, NEK9, OGDH, OGDHL, RARS, RBBP8, RECQL, SF3B1, SFPQ, TOP1, ZNF318, PER2, SIRT6, TSC22D3, RPS6, UBE2M, RAD54B, SMARCA2, ACACA, PTBP1, IYD, ACTB, HNRNPD, U2AF2, FUBP1, TFRC, EEF2, XPO1, KRT2, EIF3B, SND1, DCAF8, USO1, EFTUD2, EXOSC6, IPO7, SF3B3, DET1, UBE2N, RPL10A, DIRAS3, SURF2, RFPL2, CMSS1, PPARD, RPL22L1, IER2, MAGEA2, ZNF420, ELF4, ABL2, SRC, HCK, GTF2E2, ATP2A2, BRINP1, C19orf10, CANX, MS4A1, PDIA3, PPIB, RAB8A, RPS23, RUVBL2, SMARCA4, SMARCE1, SRSF11, TPR, UBTF, PPARG, VDR, FBXO31, TFIP11, SETD7, PPP1CA, RARA, DDX24, NAT10, CCND1, RLIM, IER3, FHL2, RPL23A, SUZ12, EZH2, EED, RRM1, RPL4, NOLC1, DDX42, MAP2, NUCKS1, RRP1, PDS5A, RPL36A, TP53RK, RPL15, NPIPB3, HMGN1, MAP1LC3A, PRDM2, KIAA1551, PBXIP1, SP1, SHARPIN, MAPKAPK2, USP15, USP26, FKBP1A, NGFR, SMG7, RSL1D1, SIRT1, SIRT7, SIRT2, SIRT3, KPNA1, KPNA6, MSI2, PHLDB3, CLPB, XAGE1B, ZNF550, YAF2, PDGFB, ARNTL2, RPS11, TSPYL6, HIST1H2BJ, ZNF764, MAK16, ZNF274, PPAN, RPL37A, CRTC2, CRTC3, TRIM25, CSNK2A1, CSNK2B, CSNK2A2, HEY1, RANBP2POLR3BPOLR3D, RAE1, POLR3H, GPN1, RPAP2, RPAP1, POLR3A, POLR2H, POLR1C, CRCP, POLR1D, TSR1, MOV10, NXF1, MAF1, GPN3, PIH1D1, PPP1CC, PPP1CA, SKAP1, EEF1A1, IPO9, MRPL17, NOB1, POLR1A, POLR1B, POLR2A, POLR2E, POLR3C, POLR3E, LOC101060521, POLR3F, POLR3G, POLR3K, RPL30, RRS1, SMARCA5, NTRK1, KRAS, GSK3A, POLR2F, MATR3, DSN1, POLR3GL, UXT, P4HA2, APOBEC3D, URI1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011170_306306498MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89150_230245437PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011150_230306498PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89223_232245437USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000462284+1011223_232306498USP7


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMDM2chr12:69230529chr12:106820975ENST00000258149+89170_306245437MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45170_306130322MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13170_3060266MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56170_306130322MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34170_306105297MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13170_306-92219MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12170_3060219MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14170_306-102271MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45170_306105297MTBP
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45150_230130322PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13150_2300266PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56150_230130322PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34150_230105297PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13150_230-92219PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12150_2300219PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14150_230-102271PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45150_230105297PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69230529chr12:106820975ENST00000299252+45223_232130322USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000348801+13223_2320266USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000356290+56223_232130322USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000360430+34223_232105297USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000393412+13223_232-92219USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000393413+12223_2320219USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000428863+14223_232-102271USP7
HgeneMDM2chr12:69230529chr12:106820975ENST00000540827+45223_232105297USP7


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MDM2_POLR3B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneMDM2Q00987DB01593ZincE3 ubiquitin-protein ligase Mdm2small moleculeapproved|investigational

Top

RelatedDiseases for MDM2_POLR3B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMDM2C0007131Non-Small Cell Lung Carcinoma2CTD_human
HgeneMDM2C0007621Neoplastic Cell Transformation1CTD_human
HgeneMDM2C0019693HIV Infections1CTD_human
HgeneMDM2C0021364Male infertility1CTD_human
HgeneMDM2C0025202melanoma1CTD_human
HgeneMDM2C0032927Precancerous Conditions1CTD_human
HgeneMDM2C0033578Prostatic Neoplasms1CTD_human
HgeneMDM2C1458155Mammary Neoplasms1CTD_human
TgenePOLR3BC3280644LEUKODYSTROPHY, HYPOMYELINATING, 8, WITH OR WITHOUT OLIGODONTIA AND/OR HYPOGONADOTROPIC HYPOGONADISM3UNIPROT
TgenePOLR3BC3714756Intellectual Disability1CTD_human