FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21385

FusionGeneSummary for MDM2_FMO6P

check button Fusion gene summary
Fusion gene informationFusion gene name: MDM2_FMO6P
Fusion gene ID: 21385
HgeneTgene
Gene symbol

MDM2

FMO6P

Gene ID

4193

388714

Gene nameMDM2 proto-oncogeneflavin containing monooxygenase 6 pseudogene
SynonymsACTFS|HDMX|hdm2FMO6
Cytomap

12q15

1q24.3

Type of geneprotein-codingpseudo
DescriptionE3 ubiquitin-protein ligase Mdm2MDM2 oncogene, E3 ubiquitin protein ligaseMDM2 proto-oncogene, E3 ubiquitin protein ligaseMdm2, p53 E3 ubiquitin protein ligase homologMdm2, transformed 3T3 cell double minute 2, p53 binding proteindouble minute 2, humnovel flavin containing monooxygenase
Modification date2018052720180329
UniProtAcc

Q00987

O60774

Ensembl transtripts involved in fusion geneENST00000462284, ENST00000356290, 
ENST00000540827, ENST00000258149, 
ENST00000428863, ENST00000393412, 
ENST00000258148, ENST00000544561, 
ENST00000393410, ENST00000393413, 
ENST00000517852, ENST00000545204, 
ENST00000350057, ENST00000360430, 
ENST00000299252, ENST00000348801, 
ENST00000478070, ENST00000544125, 
ENST00000236166, 
Fusion gene scores* DoF score24 X 14 X 8=26881 X 1 X 1=1
# samples 251
** MAII scorelog2(25/2688*10)=-3.42653313811667
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: MDM2 [Title/Abstract] AND FMO6P [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMDM2

GO:0000122

negative regulation of transcription by RNA polymerase II

9271120|17310983

HgeneMDM2

GO:0006511

ubiquitin-dependent protein catabolic process

11278372|15314173|16173922|17310983

HgeneMDM2

GO:0016567

protein ubiquitination

9450543|15878855|19656744|20153724

HgeneMDM2

GO:0031648

protein destabilization

9529249|10360174|15314173

HgeneMDM2

GO:0032436

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

11278372

HgeneMDM2

GO:0034504

protein localization to nucleus

10360174

HgeneMDM2

GO:0042176

regulation of protein catabolic process

9153395

HgeneMDM2

GO:0043518

negative regulation of DNA damage response, signal transduction by p53 class mediator

9529249|10360174

HgeneMDM2

GO:0045184

establishment of protein localization

10360174

HgeneMDM2

GO:0045892

negative regulation of transcription, DNA-templated

9271120

HgeneMDM2

GO:0065003

protein-containing complex assembly

10608892|12915590

HgeneMDM2

GO:0071157

negative regulation of cell cycle arrest

9529249

HgeneMDM2

GO:0071480

cellular response to gamma radiation

16213212

HgeneMDM2

GO:0072717

cellular response to actinomycin D

15314173

HgeneMDM2

GO:1901797

negative regulation of signal transduction by p53 class mediator

16173922


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A1L3-01AMDM2chr12

69229764

+FMO6Pchr1

171112320

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000462284ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000356290ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000540827ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000258149ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000428863ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000393412ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000258148ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000544561ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000393410ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000393413ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000517852ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000545204ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000350057ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000360430ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000299252ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
In-frameENST00000348801ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000478070ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+
intron-3CDSENST00000544125ENST00000236166MDM2chr12

69229764

+FMO6Pchr1

171112320

+

Top

FusionProtFeatures for MDM2_FMO6P


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MDM2

Q00987

FMO6P

O60774

It is probable that this protein is only produced invery small quantity or not at all as the gene coding for it seemsto be unable to produce full-length transcripts.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79210_215219437Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911210_215280498Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+7927_107219437DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+3527_107104322DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+4627_107104322DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+91127_107280498DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79179_185219437MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79190_202219437MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911179_185280498MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911190_202280498MotifNote=Nuclear export signal
TgeneFMO6Pchr12:69229764chr1:171112320ENST00000236166+08195_198-37419Nucleotide bindingNADP
TgeneFMO6Pchr12:69229764chr1:171112320ENST00000236166+0840_41-37419Nucleotide bindingFAD
TgeneFMO6Pchr12:69229764chr1:171112320ENST00000236166+0861_62-37419Nucleotide bindingFAD
TgeneFMO6Pchr12:69229764chr1:171112320ENST00000236166+089_13-37419Nucleotide bindingFAD
TgeneFMO6Pchr12:69229764chr1:171112320ENST00000236166+08518_538-37419TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79243_301219437Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35210_215104322Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35243_301104322Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23210_21574266Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23243_30174266Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46210_215104322Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46243_301104322Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24210_21579297Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24243_30179297Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13210_215-92219Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13243_301-92219Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12210_2150219Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12243_3010219Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34210_21579271Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34243_30179271Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911243_301280498Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35210_21579297Compositional biasNote=Poly-Ser
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35243_30179297Compositional biasNote=Asp/Glu-rich (acidic)
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+2327_10774266DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+2427_10779297DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+1327_107-92219DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+1227_1070219DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+3427_10779271DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+3527_10779297DomainNote=SWIB
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79466_473219437MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35179_185104322MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35190_202104322MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35466_473104322MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23179_18574266MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23190_20274266MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23466_47374266MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46179_185104322MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46190_202104322MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46466_473104322MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24179_18579297MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24190_20279297MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24466_47379297MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13179_185-92219MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13190_202-92219MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13466_473-92219MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12179_1850219MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12190_2020219MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12466_4730219MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34179_18579271MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34190_20279271MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34466_47379271MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911466_473280498MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35179_18579297MotifNuclear localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35190_20279297MotifNote=Nuclear export signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35466_47379297MotifNucleolar localization signal
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79210_304219437RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79242_331219437RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35210_304104322RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35242_331104322RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23210_30474266RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23242_33174266RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46210_304104322RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46242_331104322RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24210_30479297RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24242_33179297RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13210_304-92219RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13242_331-92219RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12210_3040219RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12242_3310219RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34210_30479271RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34242_33179271RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911210_304280498RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911242_331280498RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35210_30479297RegionNote=ARF-binding
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35242_33179297RegionNote=Region II
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79299_328219437Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79438_479219437Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35299_328104322Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35438_479104322Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23299_32874266Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23438_47974266Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46299_328104322Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46438_479104322Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24299_32879297Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24438_47979297Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13299_328-92219Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13438_479-92219Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12299_3280219Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12438_4790219Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34299_32879271Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34438_47979271Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911299_328280498Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911438_479280498Zinc fingerRING-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35299_32879297Zinc fingerRanBP2-type
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35438_47979297Zinc fingerRING-type


Top

FusionGeneSequence for MDM2_FMO6P


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MDM2_ENST00000462284_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_655aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEE
GQELSDEDDEDHTEEGRASIYQSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQ
WVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIIST
RSASWVMSRVWDDGTPWDMMTVTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVK
EFTETSAVFEDGTMFEAIDSVIFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFA

>In-frame_MDM2_ENST00000356290_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_479aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEDHTEEGRASIYQSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFL
VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQV
IISTRSASWVMSRVWDDGTPWDMMTVTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIK
PSVKEFTETSAVFEDGTMFEAIDSVIFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAA

>In-frame_MDM2_ENST00000540827_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_454aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIY
QSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMI
CSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMT
VTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSV
IFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGK

>In-frame_MDM2_ENST00000258149_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_594aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPS
FSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDW
LDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIYQSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTA
QKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGK
RVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMTVTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLN
GSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPT

>In-frame_MDM2_ENST00000428863_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_454aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIY
QSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMI
CSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMT
VTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSV
IFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGK

>In-frame_MDM2_ENST00000258148_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_600aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGD
LFGVPSFSVKEHRKITTMIYRNLVVVNQQEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVS
EHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIYQSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQE
TIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNP
EAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMTVTRFASFLRNVLPSFISDWLTVQKMNTWFKHENT
GLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPP

>In-frame_MDM2_ENST00000350057_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_624aa
MCNTNMSVPTDGAVTTSQIPASEQETLVLFTLGQTIMTKRLTDEKQQHIVTCSNDLLGDLFGVPSFSVKEHRKITTMIYRNLVVVNQQES
SDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREI
CCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIYQSVFTNSSKE
MMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNL
PTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMTVTRFASFLRN
VLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATGTDTSY

>In-frame_MDM2_ENST00000360430_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_454aa
MCNTNMSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIY
QSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMI
CSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMT
VTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSV
IFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGK

>In-frame_MDM2_ENST00000299252_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_479aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTTTMKEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTS
LSEEGQELSDEDDEDHTEEGRASIYQSVFTNSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFL
VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQV
IISTRSASWVMSRVWDDGTPWDMMTVTRFASFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIK
PSVKEFTETSAVFEDGTMFEAIDSVIFATGTDTSYPFLDETIMKSRNNEVTLFKGIFPPLMEKPTLAVIGLVQSLGAAIPTADLQAWWAA

>In-frame_MDM2_ENST00000348801_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_449aa
MSVPTDGAVTTSQIPASEQETLDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDTSLSEEGQELSDEDDEDHTEEGRASIYQSVFT
NSSKEMMCFPDFPTPDDYPNTIHHSKLQETIKTTAQKKDLLRYIQFETLVSGIKKCPSFLVTGQWVVVTEKDGKQESTIFDAVMICSGHH
VYPNLPTDSFPGLDQFRGNYLHSRDTKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGTPWDMMTVTRFA
SFLRNVLPSFISDWLTVQKMNTWFKHENTGLMPLNGSLRKEPVFNDELPSRILCGTLSIKPSVKEFTETSAVFEDGTMFEAIDSVIFATG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MDM2_ENST00000462284_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1965nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
TCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAA
GAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAA
TTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAG
ATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGAT
TGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAA
GGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAA
GAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATAT
GCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAA
TGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAAT
CTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGG
AAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACC
AGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGG
AATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTA
AATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAG
GAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCC
TACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCA
ACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCA

>In-frame_MDM2_ENST00000356290_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1437nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACA
AACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATAT
ATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTA
GTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCAC
GTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAA
GCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTC
ATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCA
TCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGC
CTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAG
CCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGC
TATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTA
ATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCT

>In-frame_MDM2_ENST00000540827_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1362nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTAC
CAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGC
AAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAA
TGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATT
TGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGAT
TATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGT
CTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTAT
GTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAG
CATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGC
ACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTC
ATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGC
ATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAA
GCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAA

>In-frame_MDM2_ENST00000258149_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1782nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTAT
ATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGC
TTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAA
ATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATATGCT
CAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGG
GTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAATCTG
CCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAG
AGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGA
AGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAAT
GTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAAT
GGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAG
TTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTAC
CCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACC
TTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAAC

>In-frame_MDM2_ENST00000428863_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1362nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTAC
CAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGC
AAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAA
TGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATT
TGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGAT
TATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGT
CTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTAT
GTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAG
CATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGC
ACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTC
ATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGC
ATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAA
GCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAA

>In-frame_MDM2_ENST00000258148_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1800nt
ATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGTTCTT
TTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGAT
TTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAA
GAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTG
TGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGT
GAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTAT
AGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTC
ACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAA
TATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTC
TTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACAT
CACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCA
GAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAG
GTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTT
GCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTAT
GGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATC
AAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACA
GGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCA
CTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCT
GCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAGTGA

>In-frame_MDM2_ENST00000350057_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1872nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAA
ATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATATGCT
CAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGG
GTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAATCTG
CCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAG
AGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGA
AGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAAT
GTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAAT
GGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAG
TTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTAC
CCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACC
TTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAAC

>In-frame_MDM2_ENST00000360430_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1362nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTAC
CAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGC
AAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAA
TGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATT
TGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGAT
TATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGT
CTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTAT
GTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAG
CATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGC
ACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTC
ATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGC
ATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAA
GCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAA

>In-frame_MDM2_ENST00000299252_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1437nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACA
AACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATAT
ATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTA
GTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCAC
GTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAA
GCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTC
ATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCA
TCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGC
CTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAG
CCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGC
TATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTA
ATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCT

>In-frame_MDM2_ENST00000348801_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1347nt
ATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGGACCACACAGAAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACA
AACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATAT
ATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTA
GTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCAC
GTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAA
GCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTC
ATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCA
TCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGC
CTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAG
CCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGC
TATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTA
ATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MDM2_ENST00000462284_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_2588nt
GGGGCGCGCACCGAGGCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGC
CCGAGGGGCGGCCGCGACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGC
CCAGTGCCCTGGCCCGGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGA
GGGACCCCCGACTCCAAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTG
TAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCAC
AAAAAGACACTTATACTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATA
TTGTATATTGTTCAAATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCT
ACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCATCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTG
ATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAGAAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAG
CAATTAGTGAGACAGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCT
GTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTC
CAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCC
AGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCA
GGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAG
AATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCT
ACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACC
CGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAG
AACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTG
TCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTT
GCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTC
CCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGG
TGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTC
AAGTGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCT
TCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATG
GGGCCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCT

>In-frame_MDM2_ENST00000356290_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_2063nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAAT
TTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCC
AGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATA
CACCACAGCAAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGT
ATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCT
GTAATGATTTGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCAT
AGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAG
CTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGAT
ATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACG
TGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATC
CTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATC
GACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTG
TTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCA
GACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAA
ATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTA
ACATACCATGGCTCTTCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGAC
CAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTC

>In-frame_MDM2_ENST00000540827_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1988nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATC
AGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATG
AGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGAT
TACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAG
ACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCT
ACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGA
GGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCT
GACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGAT
GGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTC
CAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAG
CTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACC
ATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAAC
AATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCT
GCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGAT
GACACTGATGAGAAAATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCA
TAGGGGCCAAGCCTAACATACCATGGCTCTTCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGT
TTCGACTGATGGGACCAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAG
TTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTACAATTTGCTTAAAATGCTTTCATTCCCATTACTCCTTCTGGCTGTTACACTTACAT

>In-frame_MDM2_ENST00000258149_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_2408nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATA
CTATGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAA
ATGATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAG
TAGTCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTG
ATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATC
TTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTC
TCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCT
GTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTC
CAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCC
AGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCA
GGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAG
AATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCT
ACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACC
CGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAG
AACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTG
TCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTT
GCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTC
CCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGG
TGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTC
AAGTGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCT
TCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATG
GGGCCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCT

>In-frame_MDM2_ENST00000428863_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1988nt
GCACCGCGGCGAGCTTGGCTGCTTCTGGGGCCTGTGTGGCCCTGTGTGTCGGAAAGATGGAGCAAGAAGCCGAGCCCGAGGGGCGGCCGC
GACCCCTCTGACCGAGATCCTGCTGCTTTCGCAGCCAGGAGCACCGTCCCTCCCCGGATTAGTGCGTACGAGCGCCCAGTGCCCTGGCCC
GGAGAGTGGAATGATCCCCGAGGCCCAGGGCGTCGTGCTTCCGCGCGCCCCGTGAAGGAAACTGGGGAGTCTTGAGGGACCCCCGACTCC
AAGCGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGA
TTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATC
AGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATG
AGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGAT
TACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAG
ACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCT
ACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGA
GGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCT
GACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGAT
GGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTC
CAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAG
CTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACC
ATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAAC
AATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCT
GCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGAT
GACACTGATGAGAAAATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCA
TAGGGGCCAAGCCTAACATACCATGGCTCTTCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGT
TTCGACTGATGGGACCAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAG
TTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTACAATTTGCTTAAAATGCTTTCATTCCCATTACTCCTTCTGGCTGTTACACTTACAT

>In-frame_MDM2_ENST00000258148_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_2135nt
CGCGAAAACCCCGGATGGTGAGGAGCAGGCAAATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTC
CAGCTTCGGAACAAGAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTA
TGAAAGAGGTTCTTTTTTATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATG
ATCTTCTAGGAGATTTGTTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAG
TCAATCAGCAGGAAGAAAATTCAGATGAATTATCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATG
AAAGCCTGGCTCTGTGTGTAATAAGGGAGATATGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTG
ATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCG
ACTCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCTGTA
TTCACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAG
GAATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGC
TTCTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGA
CATCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAAT
CCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACA
CAGGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGC
TTTGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAAC
TATGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCC
ATCAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCA
ACAGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCC
CCACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGG
GCTGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAG
TGAGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCTTCC
TGACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATGGGG
CCAGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCTTTT

>In-frame_MDM2_ENST00000350057_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_2193nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTCTTTTT
TATCTTGGCCAGTATATTATGACTAAACGATTATATGATGAGAAGCAACAACATATTGTATATTGTTCAAATGATCTTCTAGGAGATTTG
TTTGGCGTGCCAAGCTTCTCTGTGAAAGAGCACAGGAAAATATATACCATGATCTACAGGAACTTGGTAGTAGTCAATCAGCAGGAATCA
TCGGACTCAGGTACATCTGTGAGTGAGAACAGGTGTCACCTTGAAGGTGGGAGTGATCAAAAGGACCTTGTACAAGAGCTTCAGGAAGAG
AAACCTTCATCTTCACATTTGGTTTCTAGACCATCTACCTCATCTAGAAGGAGAGCAATTAGTGAGACAGAAGAAAATTCAGATGAATTA
TCTGGTGAACGACAAAGAAAACGCCACAAATCTGATAGTATTTCCCTTTCCTTTGATGAAAGCCTGGCTCTGTGTGTAATAAGGGAGATA
TGTTGTGAAAGAAGCAGTAGCAGTGAATCTACAGGGACGCCATCGAATCCGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGG
TTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAGAAGGA
CAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAAAGAAATGATGTGCTT
TCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATATGCTCAAAAGAAGGA
TCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCAATGGGTTGTTGTTAC
TGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAATCTGCCAACGGATTC
CTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGGGAAGAGGGTCCTCGT
GATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTACCAGAAGTGCTTCCTG
GGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCGGAATGTCCTTCCTTC
ATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTTAAATGGTTCCCTGAG
AAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAAGGAGTTCACGGAAAC
CTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTCCTACCCCTTCCTTGA
TGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCCAACCTTGGCTGTGAT
TGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGCAAACTCATGTACCCT
GCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAGACAGATTACATCACA
TATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCTTCCTGACAGATCCCCGCCTGGCCCTGGAGGTGTAC
TTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTGACCCAGTGGAACCGG
ACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTACAATTTGCTTAAAATGCTTTCATTCCCATTA

>In-frame_MDM2_ENST00000360430_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1683nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGAT
GCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGAC
TCAGAAGATTATAGCCTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATT
CACAAACTCTTCCAAAGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGA
ATATATAAAGACATATGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTT
CTTAGTCACGGGCCAATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACA
TCACGTATACCCCAATCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCC
AGAAGCCTTCAAGGGGAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACA
GGTCATTATCAGTACCAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTT
TGCATCCTTTCTCCGGAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTA
TGGCCTGATGCCTTTAAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCAT
CAAGCCCAGTGTGAAGGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAAC
AGGCTATGATTATTCCTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCC
ACTAATGGAGAAGCCAACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGC
TGCTAAAGTATTTGCAAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAGTG
AGCCAGACTTTGCAGACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCTTCCTG
ACAGATCCCCGCCTGGCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATGGGGCC
AGAAATGCCATCCTGACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTAC

>In-frame_MDM2_ENST00000299252_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1758nt
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGTTAGACCA
AAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACACTTATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAA
AGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATA
TGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCA
ATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAA
TCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGG
GAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTAC
CAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCG
GAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTT
AAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAA
GGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTC
CTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCC
AACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGC
AAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAG
ACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCTTCCTGACAGATCCCCGCCTG
GCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTG
ACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTACAATTTGCTTAAAATG

>In-frame_MDM2_ENST00000348801_chr12_69229764_+_FMO6P_ENST00000236166_chr1_171112320_+_1668nt
ATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAACAAGAGACCCTGGATCTTGATGCTGGTGTAAGTGAA
CATTCAGGTGATTGGTTGGATCAGGATTCAGTTTCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGC
CTTAGTGAAGAAGGACAAGAACTCTCAGATGAAGATGATGAGAGAAGGCAGAGCCAGCATTTACCAGTCTGTATTCACAAACTCTTCCAA
AGAAATGATGTGCTTTCCAGACTTCCCTTATCCGGATGATTACCCAAACTATATACACCACAGCAAGCTCCAGGAATATATAAAGACATA
TGCTCAAAAGAAGGATCTTTTAAGATACATACAGTTTGAGACCCTGGTTTCCGGTATAAAGAAATGTCCCAGCTTCTTAGTCACGGGCCA
ATGGGTTGTTGTTACTGAAAAGGATGGGAAACAGGAATCTACTATTTTTGATGCTGTAATGATTTGTTCAGGACATCACGTATACCCCAA
TCTGCCAACGGATTCCTTTCCTGGCCTGGACCAGTTTCGAGGCAACTACCTCCATAGCCGGGATTATAAGAATCCAGAAGCCTTCAAGGG
GAAGAGGGTCCTCGTGATTGGTCTGGGGAATTCGGGATCTGACATTGCTGTTGAGCTCAGCCGTCTGGCTACACAGGTCATTATCAGTAC
CAGAAGTGCTTCCTGGGTCATGAGTCGGGTCTGGGATGATGGCTATCCTTGGGATATGATGTATGTTACCCGCTTTGCATCCTTTCTCCG
GAATGTCCTTCCTTCATTCATCTCTGACTGGTTATATGTCCAGAAGATGAACACGTGGTTTAAGCATGAGAACTATGGCCTGATGCCTTT
AAATGGTTCCCTGAGAAAAGAGCCTGTGTTCAATGATGAGCTCCCATCCCGCATCCTGTGTGGCACTCTGTCCATCAAGCCCAGTGTGAA
GGAGTTCACGGAAACCTCAGCTGTGTTTGAGGATGGGACCATGTTTGAGGCTATCGACTCTGTCATCTTTGCAACAGGCTATGATTATTC
CTACCCCTTCCTTGATGAGACCATCATGAAAAGCAGAAACAATGAGGTTACCTTGTTTAAAGGCATCTTCCCCCCACTAATGGAGAAGCC
AACCTTGGCTGTGATTGGCTTGGTTCAGTCCCTTGGAGCTGCCATCCCCACAGCAGACCTGCAAGCCTGGTGGGCTGCTAAAGTATTTGC
AAACTCATGTACCCTGCCAACCACGAATGAAATGATGGATGACACTGATGAGAAAATGGGGAAAAAACTCAAGTGAGCCAGACTTTGCAG
ACAGATTACATCACATATGTGGATGAGCTGGGCTCTTTCATAGGGGCCAAGCCTAACATACCATGGCTCTTCCTGACAGATCCCCGCCTG
GCCCTGGAGGTGTACTTTGGCCCTTGCAGCCCATACCAGTTTCGACTGATGGGACCAGGGAAGTGGGATGGGGCCAGAAATGCCATCCTG
ACCCAGTGGAACCGGACAGTGAAGCCAACCAGGACAAGAGTTGTCAGTGAAGTTCAGCGACCCCATCCCTTTTACAATTTGCTTAAAATG


Top

FusionGenePPI for MDM2_FMO6P


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MDM2TP53, MDC1, CTBP1, CTBP2, TP73, PML, RPL11, RPL5, CDKN2A, NUMB, UBE2A, HIF1A, KAT5, HDAC1, EID1, MDM4, KAT2B, EP300, TBP, TAF1, MDM2, ESR1, ARRB2, ABL1, CCNG1, ARRB1, TSG101, RB1, MTBP, FKBP3, RYBP, RRM2B, RPL26, GNAS, FOXO4, IGF1R, DAXX, DHFR, GNL3, CCAR1, PSMD10, PSME3, PTK2, AR, PPM1D, USP7, COPS5, SFN, RBBP6, CDH1, CHEK2, YWHAQ, NCL, UBE2G2, UBE2U, UBE2Z, PYHIN1, BANP, DDX17, E2F1, TRIM28, UBC, GATA3, ATF3, HIST2H2BE, RPL23, YY1, AKT1, RAD23A, CDKN1A, NR3C1, UBE2I, HIST3H3, EHMT1, SUV39H1, RPS27L, RPS27, ADRB2, SIVA1, MTA1, RCHY1, UBE2D1, CASP2, RPS27A, RPS7, G3BP2, PSMD2, PAK1IP1, RPS6KB1, ZNF668, TP63, PCNA, USP10, PSMC1, PSMD4, PSMC3, PSMC5, PSMC6, PSMA7, PSMD1, RUNX3, GNL3L, TERT, APEX1, UIMC1, CREBBP, SOX4, UBE4B, TBRG1, BAIAP2L1, RFWD3, ERBB3, PA2G4, HEXIM1, CDK9, DYRK2, HSP90AA1, HSPA4, HSPA8, LAMP2, RPS3, USP2, TRIM13, XRCC6, GORAB, FOXO1, FOXO3, UCHL1, S100A1, S100A2, S100A4, S100A6, S100B, USP42, CUL1, BTRC, FBXW11, CSNK1D, RFWD2, SMURF1, NOTCH4, CSNK1A1, PDLIM7, SENP3, RN5S1@, PDE4D, NOTCH1, SNAI1, RASSF1, TRIM27, RFFL, RPS14, PPP2R4, TTF1, PSMB6, PSMA8, RASSF3, NR0B2, UBE2B, PIAS1, RANBP1, LATS1, RAD50, NBN, MRE11A, CUL4A, DTL, PIM1, GSK3B, PSMA3, ESR2, ADRBK1, AATF, HNRNPK, BUB1B, SUMO1, RASSF5, UBE2D2, POLH, NPM1, TCAP, CDK5RAP3, ARIH2, IRF2, RPS25, TPT1, ANG, RHOA, PDCD5, CDKN2AIP, LATS2, WWOX, MED1, ERCC6, ERCC8, DDB1, CUL4B, HIPK2, DHRS2, CASP3, ITCH, EEF1A1, DCD, TUBB, TUBB2A, KRT14, RPS20, GAPDH, TUBA1C, GSN, ERBB4, XIAP, HNF4A, PLK1, NME2, NEDD4, DAPK1, DAPK3, ATM, PBX1, UBE2D3, UBE3A, UBE2L3, UBE2E2, UBE2E3, RNF2, EGR1, PAK6, DLG4, IRF1, VCP, STRA13, GADD45A, RABL6, RPS26, RPL37, RPS15, RNF8, TRIM4, TRIM23, TRAF5, TRIM9, MKRN3, PHF7, RNF10, RNF126, UBE2K, LMO7, HLA-DMB, SETDB1, YY1AP1, NACA, ATF4, MYD88, RELA, SDHC, WT1, SORBS2, HRSP12, DNAJB4, GCAT, SHPK, POT1, ANKRD17, GLTSCR2, SESN2, RASSF6, JUND, EZR, RYR2, JUN, CLSTN1, APP, CLU, SREK1, SET, HSP90B1, CWC25, ZNF133, PKM, TAB1, RPL6, AURKA, NOC2L, JAK1, XPC, PGAM1, PGAM2, DNAJB1, ANAPC2, NLK, SNAI2, RBM38, FHIT, AGPS, ALDH16A1, DDX5, DHX9, DLAT, EDC4, EIF2AK1, ESYT1, GTF2I, HMHA1, HNRNPM, HNRNPU, HRNR, HSP90AB1, IARS, IFI16, IGF2BP3, ILF3, KARS, CCAR2, NEK9, OGDH, OGDHL, RARS, RBBP8, RECQL, SF3B1, SFPQ, TOP1, ZNF318, PER2, SIRT6, TSC22D3, RPS6, UBE2M, RAD54B, SMARCA2, ACACA, PTBP1, IYD, ACTB, HNRNPD, U2AF2, FUBP1, TFRC, EEF2, XPO1, KRT2, EIF3B, SND1, DCAF8, USO1, EFTUD2, EXOSC6, IPO7, SF3B3, DET1, UBE2N, RPL10A, DIRAS3, SURF2, RFPL2, CMSS1, PPARD, RPL22L1, IER2, MAGEA2, ZNF420, ELF4, ABL2, SRC, HCK, GTF2E2, ATP2A2, BRINP1, C19orf10, CANX, MS4A1, PDIA3, PPIB, RAB8A, RPS23, RUVBL2, SMARCA4, SMARCE1, SRSF11, TPR, UBTF, PPARG, VDR, FBXO31, TFIP11, SETD7, PPP1CA, RARA, DDX24, NAT10, CCND1, RLIM, IER3, FHL2, RPL23A, SUZ12, EZH2, EED, RRM1, RPL4, NOLC1, DDX42, MAP2, NUCKS1, RRP1, PDS5A, RPL36A, TP53RK, RPL15, NPIPB3, HMGN1, MAP1LC3A, PRDM2, KIAA1551, PBXIP1, SP1, SHARPIN, MAPKAPK2, USP15, USP26, FKBP1A, NGFR, SMG7, RSL1D1, SIRT1, SIRT7, SIRT2, SIRT3, KPNA1, KPNA6, MSI2, PHLDB3, CLPB, XAGE1B, ZNF550, YAF2, PDGFB, ARNTL2, RPS11, TSPYL6, HIST1H2BJ, ZNF764, MAK16, ZNF274, PPAN, RPL37A, CRTC2, CRTC3, TRIM25, CSNK2A1, CSNK2B, CSNK2A2, HEY1, RANBP2FMO6P


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911150_230280498PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911223_232280498USP7


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79170_306219437MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35170_306104322MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23170_30674266MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46170_306104322MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24170_30679297MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13170_306-92219MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12170_3060219MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34170_30679271MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000462284+911170_306280498MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35170_30679297MTBP
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79150_230219437PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35150_230104322PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23150_23074266PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46150_230104322PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24150_23079297PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13150_230-92219PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12150_2300219PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34150_23079271PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35150_23079297PYHIN1 and necessary for interaction with RFFL and RNF34
HgeneMDM2chr12:69229764chr1:171112320ENST00000258149+79223_232219437USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000299252+35223_232104322USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000348801+23223_23274266USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000356290+46223_232104322USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000360430+24223_23279297USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000393412+13223_232-92219USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000393413+12223_2320219USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000428863+34223_23279271USP7
HgeneMDM2chr12:69229764chr1:171112320ENST00000540827+35223_23279297USP7


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MDM2_FMO6P


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneMDM2Q00987DB01593ZincE3 ubiquitin-protein ligase Mdm2small moleculeapproved|investigational

Top

RelatedDiseases for MDM2_FMO6P


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMDM2C0007131Non-Small Cell Lung Carcinoma2CTD_human
HgeneMDM2C0007621Neoplastic Cell Transformation1CTD_human
HgeneMDM2C0019693HIV Infections1CTD_human
HgeneMDM2C0021364Male infertility1CTD_human
HgeneMDM2C0025202melanoma1CTD_human
HgeneMDM2C0032927Precancerous Conditions1CTD_human
HgeneMDM2C0033578Prostatic Neoplasms1CTD_human
HgeneMDM2C1458155Mammary Neoplasms1CTD_human