FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21352

FusionGeneSummary for MDGA1_PTK7

check button Fusion gene summary
Fusion gene informationFusion gene name: MDGA1_PTK7
Fusion gene ID: 21352
HgeneTgene
Gene symbol

MDGA1

PTK7

Gene ID

266727

5754

Gene nameMAM domain containing glycosylphosphatidylinositol anchor 1protein tyrosine kinase 7 (inactive)
SynonymsGPIM|MAMDC3CCK-4|CCK4
Cytomap

6p21.2

6p21.1

Type of geneprotein-codingprotein-coding
DescriptionMAM domain-containing glycosylphosphatidylinositol anchor protein 1GPI and MAM proteinMAM domain-containing protein 3glycosylphosphatidylinositol-MAMinactive tyrosine-protein kinase 7PTK7 protein tyrosine kinase 7colon carcinoma kinase 4pseudo tyrosine kinase receptor 7tyrosine-protein kinase-like 7
Modification date2018052220180523
UniProtAcc

Q8NFP4

Q13308

Ensembl transtripts involved in fusion geneENST00000297153, ENST00000434837, 
ENST00000505425, ENST00000510077, 
ENST00000230419, ENST00000349241, 
ENST00000345201, ENST00000352931, 
ENST00000481273, ENST00000476760, 
ENST00000471863, 
Fusion gene scores* DoF score1 X 1 X 1=15 X 5 X 3=75
# samples 16
** MAII scorelog2(1/1*10)=3.32192809488736log2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MDGA1 [Title/Abstract] AND PTK7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0129-01AMDGA1chr6

37623476

-PTK7chr6

43126555

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000297153ENST00000230419MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000297153ENST00000349241MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000297153ENST00000345201MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000297153ENST00000352931MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000297153ENST00000481273MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000297153ENST00000476760MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000297153ENST00000471863MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000434837ENST00000230419MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000434837ENST00000349241MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000434837ENST00000345201MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000434837ENST00000352931MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000434837ENST00000481273MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000434837ENST00000476760MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000434837ENST00000471863MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000505425ENST00000230419MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000505425ENST00000349241MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000505425ENST00000345201MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000505425ENST00000352931MDGA1chr6

37623476

-PTK7chr6

43126555

+
In-frameENST00000505425ENST00000481273MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000505425ENST00000476760MDGA1chr6

37623476

-PTK7chr6

43126555

+
5CDS-intronENST00000505425ENST00000471863MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-3CDSENST00000510077ENST00000230419MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-3CDSENST00000510077ENST00000349241MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-3CDSENST00000510077ENST00000345201MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-3CDSENST00000510077ENST00000352931MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-3CDSENST00000510077ENST00000481273MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-intronENST00000510077ENST00000476760MDGA1chr6

37623476

-PTK7chr6

43126555

+
intron-intronENST00000510077ENST00000471863MDGA1chr6

37623476

-PTK7chr6

43126555

+

Top

FusionProtFeatures for MDGA1_PTK7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MDGA1

Q8NFP4

PTK7

Q13308

Required for radial migration of cortical neurons in thesuperficial layer of the neocortex (By similarity). Plays a rolein the formation or maintenance of inhibitory synapses. Mayfunction by inhibiting the activity of NLGN2. {ECO:0000250,ECO:0000269|PubMed:23248271}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-41724_123193956DomainNote=Ig-like 1
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-41624_123193974DomainNote=Ig-like 1
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317796_1066777941DomainProtein kinase%3B inactive

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417132_230193956DomainNote=Ig-like 2
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417240_323193956DomainNote=Ig-like 3
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417338_432193956DomainNote=Ig-like 4
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417440_532193956DomainNote=Ig-like 5
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417539_631193956DomainNote=Ig-like 6
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417643_743193956DomainFibronectin type-III
HgeneMDGA1chr6:37623476chr6:43126555ENST00000434837-417751_918193956DomainMAM
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416132_230193974DomainNote=Ig-like 2
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416240_323193974DomainNote=Ig-like 3
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416338_432193974DomainNote=Ig-like 4
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416440_532193974DomainNote=Ig-like 5
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416539_631193974DomainNote=Ig-like 6
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416643_743193974DomainFibronectin type-III
HgeneMDGA1chr6:37623476chr6:43126555ENST00000505425-416751_918193974DomainMAM
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620128_2189071071DomainNote=Ig-like C2-type 2
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620225_3179071071DomainNote=Ig-like C2-type 3
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620309_4079071071DomainNote=Ig-like C2-type 4
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+162031_1209071071DomainNote=Ig-like C2-type 1
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620412_4979071071DomainNote=Ig-like C2-type 5
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620503_5869071071DomainNote=Ig-like C2-type 6
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620578_6809071071DomainNote=Ig-like C2-type 7
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620796_10669071071DomainProtein kinase%3B inactive
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519128_2188671031DomainNote=Ig-like C2-type 2
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519225_3178671031DomainNote=Ig-like C2-type 3
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519309_4078671031DomainNote=Ig-like C2-type 4
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+151931_1208671031DomainNote=Ig-like C2-type 1
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519412_4978671031DomainNote=Ig-like C2-type 5
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519503_5868671031DomainNote=Ig-like C2-type 6
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519578_6808671031DomainNote=Ig-like C2-type 7
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519796_10668671031DomainProtein kinase%3B inactive
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317128_218777941DomainNote=Ig-like C2-type 2
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317225_317777941DomainNote=Ig-like C2-type 3
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317309_407777941DomainNote=Ig-like C2-type 4
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+131731_120777941DomainNote=Ig-like C2-type 1
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317412_497777941DomainNote=Ig-like C2-type 5
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317503_586777941DomainNote=Ig-like C2-type 6
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317578_680777941DomainNote=Ig-like C2-type 7
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519128_2188511015DomainNote=Ig-like C2-type 2
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519225_3178511015DomainNote=Ig-like C2-type 3
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519309_4078511015DomainNote=Ig-like C2-type 4
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+151931_1208511015DomainNote=Ig-like C2-type 1
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519412_4978511015DomainNote=Ig-like C2-type 5
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519503_5868511015DomainNote=Ig-like C2-type 6
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519578_6808511015DomainNote=Ig-like C2-type 7
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519796_10668511015DomainProtein kinase%3B inactive
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620128_2189151079DomainNote=Ig-like C2-type 2
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620225_3179151079DomainNote=Ig-like C2-type 3
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620309_4079151079DomainNote=Ig-like C2-type 4
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+162031_1209151079DomainNote=Ig-like C2-type 1
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620412_4979151079DomainNote=Ig-like C2-type 5
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620503_5869151079DomainNote=Ig-like C2-type 6
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620578_6809151079DomainNote=Ig-like C2-type 7
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620796_10669151079DomainProtein kinase%3B inactive
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+162031_7049071071Topological domainExtracellular
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620726_10709071071Topological domainCytoplasmic
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+151931_7048671031Topological domainExtracellular
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519726_10708671031Topological domainCytoplasmic
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+131731_704777941Topological domainExtracellular
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317726_1070777941Topological domainCytoplasmic
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+151931_7048511015Topological domainExtracellular
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519726_10708511015Topological domainCytoplasmic
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+162031_7049151079Topological domainExtracellular
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620726_10709151079Topological domainCytoplasmic
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620705_7259071071TransmembraneHelical
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519705_7258671031TransmembraneHelical
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317705_725777941TransmembraneHelical
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519705_7258511015TransmembraneHelical
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620705_7259151079TransmembraneHelical


Top

FusionGeneSequence for MDGA1_PTK7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_357aa
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDKFQETSVFN
ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDITEPLYTQVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_1071nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_3088nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000297153_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_2379nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_3088nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_3081nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG
GCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGG
GAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGT
GCCACAGGTAACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGG
CTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGG
TCCCACTTGGGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACG
TCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTT
TTTGTATGCACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGG
GTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTC

>In-frame_MDGA1_ENST00000434837_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_2379nt
GGAGAGCGAGAGACCGAACGAGGAGACGCGAGGAGGAGGGAGGAGGAAGAGAGGGAGGGAGGCGGGAGGAGCGCGGAATGAAAAGCTCGG
AGGGGCGAAAAAGCAGCACAGCAAAGCCCAAGTTGCTGAGCGAGCGGAGCGCTCCCGCGGCCCGGAGCCGAGCGGCCGCCGCGCCCCGGA
GCCCGGCCCGGCCCCGCCCGCTCTGGGCCCCCGCAGGCCAAGGCCGCCGGGCGGGGGCGGGGACGACCAACTTGGGGCGCGGCGTAGCCC
CGCTCTCCCGAGAGCTCGGAGCCCGGGAGGGCTACGGCCGCGGCCAGACGGCGGGAGAGGAGCGCGGCGAGCGGAGGCGGCGAGCGGCGC
CCGCGCCGCAGCCCCGGCCTGGGCGAGAGCGCGAATATTTTTCAAAAGACTCAAACTTTCCTCCTTTCCCCGTTTTCTGGGGCCCTTCTT
GCCTGGAATTGCTCTCCAGATTCCCGCGGGGCGCCGGGCTGCTATTCTTCCCCCGGGTTTATCGGCGGCTCGGCTAACTTCACGGACCCG
GGGACCCGCGGCGCTCGTCCCTCGGCCGAACCCAGCCCGCGCTGCTCCCCGGATCAGGAGGGCCGGGCCCGGGGCTGCTTCGCCGCCGCG
AGTGCTTTCAGCCCGGCCCCCTGGAGTCGGGCCGCTGAGCCCACGGCAGCGGCCGCAGGACTGGAAACAGCAGATTGATTAACTCGAGCG
GAGCCCCGGCCTCCCCGACTCCGCTCCGCTGAGGGGCGGCCCCAGTGCGGGGAAACGACAAGTTTGTCAGTCGTCCGTGGCCTGTTGGAT
CGAAGCGCCGCCTCCGCCGCCGAGAGGTCCCCGGCGCCTAGCATCCCGCGCGGACGGCCCTGGGTACCCGGGGCGGCTCGGCGGCCGGGC
TCCTCGGGTCGGGGCGCTGGCTGCTGTGCCGGGCGCGCCGAGGCACCCGGGGCTGGGCCAGCGCCCCCTGCGTCCCCACGCGGGCAGCGG
CCCCGCCGGAGGAGAAACACGGGTCGCCGCCACCTCCGCCTCTTCAGTCTCCTGGTCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGA
AAGGGGGGGACATAGGGGCGTCGCGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGATGAAGCACCG
GCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCG
CAGATCGTGCATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATG
CTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCG
GTGTTCAACGAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCG
GCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTC
TACCAGGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCC
CACAGCCAGGACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTG
TCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTC
AGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGT
GACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCA
GATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAG
CGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGA
GGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGG

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000230419_chr6_43126555_+_1909nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG
GCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGC
CCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGG
CCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGAC
TTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGT
AACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTG
GGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTG
GGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCA
CCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGC
ACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCAT
CCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTCTCAATAAAT

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000349241_chr6_43126555_+_1902nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG
GCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGC
CCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGG
CCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGAC
TTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGT
AACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTG
GGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTG
GGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCA
CCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGC
ACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCAT
CCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTCTCAATAAAT

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000345201_chr6_43126555_+_1902nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG
GCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGC
CCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGG
CCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGAC
TTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGT
AACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTG
GGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTG
GGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCA
CCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGC
ACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCAT
CCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTCTCAATAAAT

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000352931_chr6_43126555_+_1902nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG
GCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGC
CCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGG
CCCCTGCCCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGAC
TTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGT
AACCCCAATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTG
GGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTG
GGGGTCTAGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCA
CCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGC
ACCACGGGCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCAT
CCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTTGTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTCTCAATAAAT

>In-frame_MDGA1_ENST00000505425_chr6_37623476_-_PTK7_ENST00000481273_chr6_43126555_+_1200nt
ATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCTTCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTG
CATGCGGGCCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAGGGGGACACCCTCATGCTGCAGTGC
CTTGTAACAGGGCACCCTCGACCCCAGGTACGGTGGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAAC
GAGACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCTGAGAACGGCGTGGGGGTGCCGGCCATCAAG
TCCATCCGCGTGGACGTGCAGTACCTGGATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCAGGAG
AAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATCTGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAG
GACAATGGGGTTGACATCTATGAGCCCCTCTACACTCAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAAC
CGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGAT
GTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCT
ACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAA
GTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGG
GCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGC
CCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGG


Top

FusionGenePPI for MDGA1_PTK7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MDGA1LNX2PTK7RYK, TSHR, CEACAM21, ATP1B4, BTNL8, NTRK1, PPM1G, CLNK, TMEM17, PPP3CA, PPP3CB, PPM1A, PPM1B, PPM1F, PPM1K, ILKAP, CTDSP2, PTPRR, PTPN6, PTPN7, PTPN11, PTPN12, DUSP10, DUSP14, DUSP15, DUSP18, DUSP19, DUSP21, DUSP26, DUPD1, STYX, CDC14A, PTEN, TPTE, TPTE2, MTMR1, MTMR6, MTMR9, MTMR10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePTK7chr6:37623476chr6:43126555ENST00000349241+1317794_1070777941CTNNB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgenePTK7chr6:37623476chr6:43126555ENST00000230419+1620794_10709071071CTNNB1
TgenePTK7chr6:37623476chr6:43126555ENST00000345201+1519794_10708671031CTNNB1
TgenePTK7chr6:37623476chr6:43126555ENST00000352931+1519794_10708511015CTNNB1
TgenePTK7chr6:37623476chr6:43126555ENST00000481273+1620794_10709151079CTNNB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MDGA1_PTK7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MDGA1_PTK7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMDGA1C0036341Schizophrenia2PSYGENET
HgeneMDGA1C0005586Bipolar Disorder1PSYGENET
HgeneMDGA1C0041696Unipolar Depression1PSYGENET
HgeneMDGA1C1269683Major Depressive Disorder1PSYGENET