FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21324

FusionGeneSummary for MCPH1_CSMD1

check button Fusion gene summary
Fusion gene informationFusion gene name: MCPH1_CSMD1
Fusion gene ID: 21324
HgeneTgene
Gene symbol

MCPH1

CSMD1

Gene ID

79648

64478

Gene namemicrocephalin 1CUB and Sushi multiple domains 1
SynonymsBRIT1|MCTPPP1R24
Cytomap

8p23.1

8p23.2

Type of geneprotein-codingprotein-coding
DescriptionmicrocephalinBRCT-repeat inhibitor of TERT expression 1truncated microcephalinCUB and sushi domain-containing protein 1protein phosphatase 1, regulatory subunit 24
Modification date2018051920180520
UniProtAcc

Q8NEM0

Ensembl transtripts involved in fusion geneENST00000344683, ENST00000519480, 
ENST00000522905, ENST00000521175, 
ENST00000602723, ENST00000400186, 
ENST00000520002, ENST00000602557, 
ENST00000537824, ENST00000542608, 
ENST00000539096, ENST00000523387, 
Fusion gene scores* DoF score5 X 6 X 2=6010 X 9 X 6=540
# samples 610
** MAII scorelog2(6/60*10)=0log2(10/540*10)=-2.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MCPH1 [Title/Abstract] AND CSMD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMCPH1

GO:0000122

negative regulation of transcription by RNA polymerase II

12837246

HgeneMCPH1

GO:0071850

mitotic cell cycle arrest

24633962


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AO-A0JE-01AMCPH1chr8

6312773

+CSMD1chr8

3351248

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344683ENST00000602723MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000400186MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000520002MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000602557MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000537824MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000542608MCPH1chr8

6312773

+CSMD1chr8

3351248

-
In-frameENST00000344683ENST00000539096MCPH1chr8

6312773

+CSMD1chr8

3351248

-
5CDS-intronENST00000344683ENST00000523387MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000602723MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000400186MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000520002MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000602557MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000537824MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000542608MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000519480ENST00000539096MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-intronENST00000519480ENST00000523387MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000602723MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000400186MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000520002MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000602557MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000537824MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000542608MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000522905ENST00000539096MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-intronENST00000522905ENST00000523387MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000602723MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000400186MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000520002MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000602557MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000537824MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000542608MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-3CDSENST00000521175ENST00000539096MCPH1chr8

6312773

+CSMD1chr8

3351248

-
intron-intronENST00000521175ENST00000523387MCPH1chr8

6312773

+CSMD1chr8

3351248

-

Top

FusionProtFeatures for MCPH1_CSMD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MCPH1

Q8NEM0

CSMD1

Implicated in chromosome condensation and DNA damageinduced cellular responses. May play a role in neurogenesis andregulation of the size of the cerebral cortex.{ECO:0000269|PubMed:12046007, ECO:0000269|PubMed:15199523,ECO:0000269|PubMed:15220350}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMCPH1chr8:6312773chr8:3351248ENST00000519480+181_93-24611DomainBRCT 1
HgeneMCPH1chr8:6312773chr8:3351248ENST00000519480+18640_730-24611DomainBRCT 2
HgeneMCPH1chr8:6312773chr8:3351248ENST00000519480+18751_833-24611DomainBRCT 3
HgeneMCPH1chr8:6312773chr8:3351248ENST00000522905+171_93-9563DomainBRCT 1
HgeneMCPH1chr8:6312773chr8:3351248ENST00000522905+17640_730-9563DomainBRCT 2
HgeneMCPH1chr8:6312773chr8:3351248ENST00000522905+17751_833-9563DomainBRCT 3


Top

FusionGeneSequence for MCPH1_CSMD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602723_chr8_3351248_-_3585aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHP
GNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGF
YLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCG
DPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS
HSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPG
TPHFGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAG
GSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLT
GIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAA

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000400186_chr8_3351248_-_3585aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHP
GNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGF
YLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCG
DPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS
HSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPG
TPHFGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAG
GSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLT
GIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAA

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000520002_chr8_3351248_-_3762aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVTGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSP
DPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGV
SRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPG
VPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLR
GSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVITACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTL
ANGIQFGTDFTFNKTVSTQCNPGTVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSA
ILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPH
FGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSE
HRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLTGIY
KKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAAAIL

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602557_chr8_3351248_-_3762aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVTGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSP
DPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGV
SRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPG
VPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLR
GSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVITACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTL
ANGIQFGTDFTFNKTVSTQCNPGTVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSA
ILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPH
FGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSE
HRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLTGIY
KKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAAAIL

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000537824_chr8_3351248_-_3762aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVTGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAGHCGSP
DPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGV
SRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAISCGHPG
VPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLR
GSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVITACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCGDPGTL
ANGIQFGTDFTFNKTVSTQCNPGTVMEAVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLSHSA
ILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPGTPH
FGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSE
HRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLTGIY
KKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAAAIL

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000542608_chr8_3351248_-_3585aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL
LSTTHETLIHFTSDHSQNRQGFKLAYQATELQNCPDPPPFQNGYMINSDYSVGQSVSFECTPGYILIGHPVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDETPILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETATSSTNQVL
LKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDILTCKLSSQLQFEGSLPTCEAQCPANE
VRTGSSGVILSPGTPGNTFNSQTCSWSIKVEPNYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLTLRWS
TDHATSKKGFKIRTAAPYCSLTHPLKNGGILNRTAGAVGSKVHTFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGN
GSFTGNEFTLDSKVVTECHEGFKLESSQQATAVCQEDGLWSNKGKPPTCKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYY
LEGWRLLRCQANGTWNIGDERPSCRAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHP
GNPAHGFTNGSEFNLNDVVNFTCNTGTLLQGVSRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFETGMSILYHCKKGF
YLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTTGAVVHYSCRGSESLIGNDTRVCQEDSHWSGALPHCTGNNPGFCG
DPGTPAHGSRLGDDFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPVCEAVLCPQPPPVQNGTVEGSDFRWGSSISYSCMDGYQLS
HSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGRLSGKSFTTKSEVFFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNTCPDPG
TPHFGIQNSSRGTEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAG
GSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSLWKGTTETLGKRQPATLTVDWFNATSSKVNATFSEASPVELKLT
GIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGTVSSGLERGGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSSHYHGTSSGSVAA

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000539096_chr8_3351248_-_2307aa
MAAPILKDVVATVEVWSSNGTENTSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESL
FPAANMNEHLSSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLITTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERKLEGSINDIKSDVCISSLVLK
ANNIHSSPSFTHLDKSSPQKFLSNLSKEEINLQRNIAGKVVTPDQKQAAGMSQETFEEKTRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSTDDTFSPDNLKERTSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDL
IKPHEELKKSGRGKKVIKLAFEEFELERGTDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIE
KGGCGDPGIPATGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNTPEETGNNMNCVWL
IISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIP
INGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGTTKDSLHCEWIIEAKPG
HSIKITFDRFQTEVNTDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHTESVTLESDSCLDPGIPVNGH
RHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIQGKSGTVLSPGFPDFTPNSLNCTWTIEVSHGKGVQMIFH
TFHLESSHDTLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSETDLEPCDDPGVPAFSRRIGFHFGV
GDSLTFSCFLGTRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNTDNNHECITKIETEAGKGIHLRTRSFQLFE
GDTLKVTDGKDSSSRPLGTFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTTTSFDLVKCEDPGIPNYGTRIRDEGHFTDTVVLYS
CNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGTPAPTDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILK
VWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRTGDSREAGDTVTFQCDPGTQL
QGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPTPPGKECDWRVKVNPDFVIALIFKSFNMEPSTDFLHITEGEDS
NSPLIGSYQGSQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGTDFKLGSTITYQCDSGTKILDPSSIT
CVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLTSITVPKEFVVFGQFATFQTALNDLAELFDGTHAQARLLSS
LSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVTQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQS
VPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFS
GTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRW
NTPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGTGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAAL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602723_chr8_3351248_-_10755nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGT
TCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGG
CTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCT
GGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAG
GGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTT
GTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTT
TACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACAC
CCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTC
ATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGT
GATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAG
CTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCG
CCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCT
CACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATC
CCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCC
TCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGT
ACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAA
GGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACC
CCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGG
GGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAA
ACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCC
GCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACA
GGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAAT
GACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGA
AAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCT
GCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAAT
GGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000400186_chr8_3351248_-_10755nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGT
TCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGG
CTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCT
GGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAG
GGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTT
GTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTT
TACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACAC
CCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTC
ATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGT
GATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAG
CTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCG
CCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCT
CACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATC
CCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCC
TCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGT
ACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAA
GGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACC
CCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGG
GGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAA
ACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCC
GCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACA
GGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAAT
GACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGA
AAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCT
GCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAAT
GGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000520002_chr8_3351248_-_11286nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGA
AGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACG
CTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCA
GACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTG
GGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAAC
CCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTG
TCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAA
AATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTG
CTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGG
GTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGC
AACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCG
GGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGG
GGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACA
CCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGG
CTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTA
GCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACA
TCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTG
CAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCC
ATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAA
GGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGA
GTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACAC
TTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACG
ACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACAC
GCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAG
CACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACT
AAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTA
ACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTAC
AAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGG
GGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAG
CTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTG
GTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCT
GGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602557_chr8_3351248_-_11286nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGA
AGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACG
CTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCA
GACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTG
GGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAAC
CCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTG
TCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAA
AATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTG
CTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGG
GTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGC
AACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCG
GGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGG
GGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACA
CCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGG
CTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTA
GCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACA
TCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTG
CAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCC
ATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAA
GGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGA
GTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACAC
TTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACG
ACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACAC
GCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAG
CACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACT
AAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTA
ACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTAC
AAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGG
GGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAG
CTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTG
GTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCT
GGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000537824_chr8_3351248_-_11286nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGA
AGCCTTTCCTTTCCCCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACG
CTTGTGGGGTCTCATGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCA
GACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTG
GGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAAC
CCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTG
TCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAA
AATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTG
CTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGG
GTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGC
AACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCG
GGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGG
GGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACA
CCCACCAACGGAATGATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGG
CTCATGACACGGCATTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTA
GCAAATGGCATCCAGTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACA
TCCGCCACTATTCGCTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTG
CAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCC
ATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAA
GGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGA
GTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACAC
TTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACG
ACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACAC
GCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAG
CACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACT
AAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTA
ACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTAC
AAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGG
GGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAG
CTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTG
GTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCT
GGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000542608_chr8_3351248_-_10755nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAA
TTACAGAACTGTCCAGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGT
TATCCTGGGTACATTCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGAT
GCCCCTTGTGGGTACAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATT
TGGCTCATCACGGTGCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGG
GACGGTCCCGATCAGAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTG
CTCAAGTTCCACAGCGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCG
GTTCCACAGGCAGAAATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTG
GGGACCGACATTCTGACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAA
GTCCGGACTGGATCATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTG
GAACCAAACTACAACATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGG
CAAAGTCCTCTGCTAGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCC
ACTGACCATGCCACCAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATT
CTAAACAGGACTGCAGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGT
AGACGAAACCCACTTGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAAC
GGTTCATTTACCGGGAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCA
ACAGCCGTGTGTCAAGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAG
CTCTCAGAACATGTCATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTAC
TTAGAAGGCTGGAGGCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGT
TCCCCAGACCCGATTGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGG
CTTGTGGGAACTTCCGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCT
GGAAACCCTGCCCACGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAG
GGCGTGTCTCGAGCCCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTT
GTGGAAAATGCCATTCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTT
TACTTGCTGGGATCTTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACAC
CCAGGGGTCCCTGCCAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTC
ATAGGCAACGACACGAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGT
GATCCGGGGACCCCAGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAG
CTGAGGGGCTCCCCTGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCG
CCGCCGGTGCAGAATGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCT
CACTCCGCCATCCTCTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATC
CCCGCAGAAGGGCGACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCC
TCCAGAAGAGTCTGCCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGT
ACGCCACACTTTGGAATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAA
GGTTCCACGACTCGCACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACC
CCGGCACACGCGGATGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGG
GGATCTGAGCACAGAACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAA
ACAGTTACTAAAACTCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCC
GCCACTCTAACTGTTGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACA
GGCATTTACAAGAAGGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAAT
GACAACTGGGGACTAGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGA
AAATTTAAGCTAGAAAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCT
GCCATTCTGGTTCCTTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAAT
GGCTATGCTGGGCATGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCT

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000539096_chr8_3351248_-_6921nt
ATGGCGGCCCCCATCCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACA
CAGCTTGTGGATATGGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGG
GACAAAGCTCAGAAGAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTG
TTCCCTGCAGCTAATATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACA
CCAGAAAATGATAAGAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCT
ATTCTCTTATTTGAATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTA
CAAGAGATGAAGGAGAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGT
GAAGCACCTTTGAACATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGA
AACTCAGGATGTGGAAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAA
GCAAATAATATTCATTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATA
AACTTGCAAAGAAATATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTAT
CGTTTGTCTCCTACCTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCA
CATGGCTCCCATTCACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCG
GAAGACAGGCTGCAGCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAAT
CTTAAGGAAAGGTATTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAG
GAGAGAACAAGCATATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACC
ATCTCCAGTCCTCGGAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGT
AGACAGGCTGGGAAAGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGAT
GATTTAACTCCTTTGGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATA
TCAAACTCCTCTGAAGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAA
AACTTACCCGGAGGATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTC
ATCAAACCTCATGAGGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTAT
GACACCCTGACGGTTGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATT
GTGAGCATGAGCAACCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAA
AAGGGAGGGTGTGGGGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGC
CCGGCGGCCTTTGAGCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCA
TGTTTCTTCAACTTTACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTG
ATTATCTCGGAGCCAGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGAT
GGCATTTCTGACATAACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAA
TTTCAGTCTGACCATTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCT
ATAAACGGACGACGTTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCC
GAGTCCATTACCTGCATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACA
GCGTCCAGCGGAGTCATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGC
CACTCTATCAAAATAACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCA
CTGATCGGCGAGTACCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGC
CGCTCCAGCATCGGCTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCAT
CGCCACGGTGGAGACTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGT
GAGAGGAACCACCAGTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCT
CCTGGGTTTCCAGATTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCAC
ACCTTTCATCTTGAGAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTG
TTGCCTCATACGATCAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTC
AATATCACATTTTCAGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTG
GGAGACTCTCTGACGTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGG
AGTGCACCTCTGCCAAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAAT
TATGATAATAACCATGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAA
GGAGATACTCTAAAGGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTA
AACAGCACATCCAATCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGAT
CTGGTAAAATGTGAGGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGT
TGCAACCCGGGGTACGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGC
ATAGCGGAATGTGGTGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCAC
TGCACCTGGATTATAGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAG
GTCTGGGACGGGCCGGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCA
CTCACCCTGCAGTTCGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGAT
CCAGGTATGCCCCAAAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTC
CAAGGACAAGCCAAAATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGG
AATCTGACGGGCCCAGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTG
AACCCGGACTTTGTCATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCC
AACAGCCCCCTCATTGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGT
GATGCCTCCGTGGGCCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGG
ACAAGAGTTGGAACAGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACC
TGTGTGATTGGGGCTGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAA
GGGGTAGTTTTATCACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTC
TTTGGACAGTTTGCCTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCA
CTCTCGGGGTCTCACTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCC
CGCGGCTTCCACTTCGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATT
GGTTCTGAGTTTTCTGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCC
GTGCCCAACGCCTTGGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATC
CTGTCCCCCGGCTACCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAA
GTGATCAGTTTTGCCACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCA
GGCACCACAGTACCGGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTC
CACCTGGAATACAAAACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTG
AACGACGTGCTCTCCTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGG
AACTATCCGTCTCCCCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCT
TACCCCAACAACTTAGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCT
AATCATGACTTCCTTGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTG
CTGAGCACAACGCATGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGGAGGATCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602723_chr8_3351248_-_11317nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGAT
TGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTC
CGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCA
CGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGC
CCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCAT
TCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATC
TTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGC
CAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACAC
GAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCC
AGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCC
TGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAA
TGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCT
CTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCG
ACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTG
CCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGG
AATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCG
CACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGA
TGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAG
AACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAAC
TCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGT
TGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAA
GGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACT
AGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGA
AAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCC
TTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCA
TGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACAC
AACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATT
CCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATC
TCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGT
ATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGA
GATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTG

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000400186_chr8_3351248_-_11317nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGAT
TGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTC
CGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCA
CGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGC
CCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCAT
TCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATC
TTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGC
CAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACAC
GAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCC
AGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCC
TGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAA
TGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCT
CTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCG
ACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTG
CCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGG
AATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCG
CACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGA
TGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAG
AACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAAC
TCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGT
TGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAA
GGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACT
AGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGA
AAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCC
TTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCA
TGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACAC
AACTCTGAACACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATT
CCTTTGGTGCCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATC
TCTACTCAAATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGT
ATGAAATCAAGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGA
GATGCCTTTCAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTG

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000520002_chr8_3351248_-_11848nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCC
CCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCA
TGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAA
CGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAG
GATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATT
CACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTG
TCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCA
CGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGC
CTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGC
CGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGT
GTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACA
TGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACG
CACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAAT
GATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCA
TTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCA
GTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCG
CTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGT
GGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGA
AGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGG
GAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGA
CGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAA
TAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCT
TGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGC
CATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAA
AGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCC
TTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTT
CAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGC
CCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTA
TGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGA
TCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGC
TCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAG
CAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAA
CACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTG
CCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAA
ATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCA
AGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTT
CAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTC

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000602557_chr8_3351248_-_11848nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCC
CCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCA
TGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAA
CGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAG
GATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATT
CACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTG
TCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCA
CGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGC
CTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGC
CGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGT
GTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACA
TGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACG
CACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAAT
GATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCA
TTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCA
GTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCG
CTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGT
GGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGA
AGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGG
GAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGA
CGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAA
TAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCT
TGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGC
CATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAA
AGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCC
TTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTT
CAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGC
CCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTA
TGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGA
TCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGC
TCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAG
CAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAA
CACAGTCTGTACAGTGGTATAGCCCTCAGTGCCCCAACAGGACTGATTCATAGCCATACCTCTGATGGACAAGCAGTGATTCCTTTGGTG
CCATATACCACTCTCCCTTCCACTCTGGCTTTACTGCAGCGATCTTCAACCTTGTCTACTGGCATAAGTGCAGCGGGGATCTCTACTCAA
ATGTGTCAGGGTCTTCTACGGATCAAACTACACATGCGTTTTCATTCCAAAAGTGGGTTCTAAATGCCTGGCTGCATCTGTATGAAATCA
AGGCACACTCCAGGAAGACTGCCACGTCGCGCCAACACGTCATACTCAATGCCTCAGACTTTCATATTTCTGTGTTGCTGAGATGCCTTT
CAATGCAATCGTCTGGGCTCGTGGATATGTCCCTCAGGTGCGGTGACAGAATGGTGGCACCACGATATGTGTTCTCTTGTGTTGTTTTTC

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000537824_chr8_3351248_-_11362nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGTTATCTCGTGTGGAAGCCTTTCCTTTCC
CCCAAATGGCAACAAGATTGGAACGTTGACAGTTTATGGGGCCACAGCTATATTTACGTGCAACACCGGCTACACGCTTGTGGGGTCTCA
TGTCAGAGAGTGCTTGGCAAATGGGCTCTGGAGCGGCAGCGAAACTCGATGTCTGGCTGGCCACTGCGGTTCCCCAGACCCGATTGTGAA
CGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTCCGTGAG
GATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCACGGATT
CACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGCCCAGTG
TCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCATTCGTCA
CGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATCTTCAGC
CTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGCCAACGC
CGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACACGAGAGT
GTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCCAGCACA
TGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCCTGAACG
CACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGTCCTGTGGCAACCCTGGCACACCCACCAACGGAAT
GATTGTCAGTAGTGATGGCATTCTGTTCTCCAGCTCGGTCATCTATGCCTGCTGGGAAGGCTACAAGACCTCAGGGCTCATGACACGGCA
TTGCACAGCCAATGGGACCTGGACAGGCACTGCTCCCGACTGCACAATTATAAGTTGTGGGGATCCAGGCACACTAGCAAATGGCATCCA
GTTTGGGACCGACTTCACCTTCAACAAGACTGTGAGCTATCAGTGTAACCCAGGCTATGTCATGGAAGCAGTCACATCCGCCACTATTCG
CTGTACCAAAGACGGCAGGTGGAATCCGAGCAAACCTGTCTGCAAAGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAATGGAACAGT
GGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCTCTCCTGTGA
AGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCGACTTAGTGG
GAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTGCCAAGCTGA
CGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGGAATACAGAA
TAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCGCACCTGCCT
TGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGATGTGAGAGC
CATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAGAACATGTAA
AGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAACTCCAGTTCC
TTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGTTGACTGGTT
CAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAAGGAGGAGGC
CCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACTAGATGGTTA
TGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGAAAGGCAAGA
TCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCCTTTCTTTGC
TCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCATGAAAACAG
CAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACACAACTCTGAA

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000542608_chr8_3351248_-_10831nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGCCTATGAATTACAGAACTGTCC
AGATCCACCCCCATTTCAGAATGGGTACATGATCAACTCGGATTACAGCGTGGGGCAATCAGTATCTTTCGAGTGTTATCCTGGGTACAT
TCTAATAGGCCATCCTGTCCTCACTTGTCAGCATGGGATCAACAGAAACTGGAACTACCCTTTTCCAAGATGTGATGCCCCTTGTGGGTA
CAACGTAACTTCTCAGAACGGCACCATCTACTCCCCTGGCTTTCCTGATGAGTATCCGATCCTGAAGGACTGCATTTGGCTCATCACGGT
GCCTCCAGGGCACGGAGTTTACATCAACTTCACCCTGTTACAGACGGAAGCTGTCAACGATTACATTGCTGTTTGGGACGGTCCCGATCA
GAACTCACCCCAGCTGGGAGTTTTCAGTGGCAACACAGCCCTCGAAACGGCGTATAGCTCCACCAACCAAGTCCTGCTCAAGTTCCACAG
CGACTTTTCAAATGGAGGCTTCTTTGTCCTCAATTTCCACGCATTTCAGCTCAAGAAATGTCAACCTCCCCCAGCGGTTCCACAGGCAGA
AATGCTTACTGAGGATGATGATTTCGAAATAGGAGATTTTGTGAAGTACCAGTGCCACCCCGGGTACACCTTGGTGGGGACCGACATTCT
GACTTGCAAGCTCAGTTCCCAGTTGCAGTTTGAGGGTTCTCTCCCAACATGTGAAGCACAATGCCCAGCAAATGAAGTCCGGACTGGATC
ATCGGGAGTCATTCTCAGTCCAGGGTATCCGGGTAATTATTTTAACTCCCAGACTTGCTCTTGGAGTATTAAAGTGGAACCAAACTACAA
CATTACCATCTTTGTGGACACATTTCAAAGTGAAAAGCAGTTTGATGCACTGGAAGTGTTTGATGGTTCTTCTGGGCAAAGTCCTCTGCT
AGTAGTCTTAAGTGGGAATCATACTGAACAATCAAATTTTACAAGCAGGAGTAATCAGTTATATCTCCGCTGGTCCACTGACCATGCCAC
CAGTAAGAAAGGATTCAAGATTCGCTATGCAGCACCTTACTGCAGTTTGACCCACCCCCTGAAGAATGGGGGTATTCTAAACAGGACTGC
AGGAGCGGTTGGAAGCAAAGTGCATTATTTTTGCAAGCCTGGATACCGAATGGTCGGCCACAGCAATGCAACCTGTAGACGAAACCCACT
TGGCATGTACCAGTGGGACTCCCTCACGCCACTCTGCCAGGCTGTGTCCTGTGGAATCCCAGAATCCCCAGGAAACGGTTCATTTACCGG
GAACGAGTTCACTTTGGACAGTAAAGTGGTCTATGAATGTCATGAGGGCTTCAAGCTTGAATCCAGCCAGCAAGCAACAGCCGTGTGTCA
AGAAGATGGGTTGTGGAGTAACAAGGGGAAGCCGCCCACGTGTAAGCCGGTCGCTTGCCCCAGCATTGAAGCTCAGCTCTCAGAACATGT
CATCTGGAGGCTGGTTTCAGGATCCTTGAATGAGTACGGTGCTCAAGTATTGCTGAGCTGCAGTCCTGGTTACTACTTAGAAGGCTGGAG
GCTCCTGCGGTGCCAGGCCAATGGGACGTGGAACATAGGAGATGAGAGGCCAAGCTGTCGAGCTGGCCACTGCGGTTCCCCAGACCCGAT
TGTGAACGGTCACATTAGTGGAGATGGCTTCAGTTACAGAGACACGGTGGTTTACCAGTGCAATCCTGGTTTCCGGCTTGTGGGAACTTC
CGTGAGGATATGCCTGCAAGACCACAAGTGGTCTGGACAAACGCCTGTCTGTGTCCCCATCACATGTGGTCACCCTGGAAACCCTGCCCA
CGGATTCACTAATGGCAGTGAGTTCAACCTGAATGATGTCGTGAATTTCACCTGCAACACGGGCTATTTGCTGCAGGGCGTGTCTCGAGC
CCAGTGTCGGAGCAACGGCCAGTGGAGTAGCCCTCTGCCCACGTGTCGAGTGGTGAACTGTTCTGATCCAGGCTTTGTGGAAAATGCCAT
TCGTCACGGGCAACAGAACTTCCCTGAGAGTTTTGAGTATGGAATGAGTATCCTGTACCATTGCAAGAAGGGATTTTACTTGCTGGGATC
TTCAGCCTTGACCTGTATGGCAAATGGCTTATGGGACCGATCCCTGCCCAAGTGTTTGGCTATATCGTGTGGACACCCAGGGGTCCCTGC
CAACGCCGTCCTCACTGGAGAGCTGTTTACCTATGGCGCCGTCGTGCACTACTCCTGCAGAGGGAGCGAGAGCCTCATAGGCAACGACAC
GAGAGTGTGCCAGGAAGACAGTCACTGGAGCGGGGCACTGCCCCACTGCACAGGAAATAATCCTGGATTCTGTGGTGATCCGGGGACCCC
AGCACATGGGTCTCGGCTTGGTGATGACTTTAAGACAAAGAGTCTTCTCCGCTTCTCCTGTGAAATGGGGCACCAGCTGAGGGGCTCCCC
TGAACGCACGTGTTTGCTCAATGGGTCATGGTCAGGACTGCAGCCGGTGTGTGAGGCCGTGCTGTGTCCTCAGCCGCCGCCGGTGCAGAA
TGGAACAGTGGAGGGAAGTGATTTCCGCTGGGGCTCCAGCATAAGTTACAGCTGCATGGACGGTTACCAGCTCTCTCACTCCGCCATCCT
CTCCTGTGAAGGTCGCGGGGTGTGGAAAGGAGAGATCCCCCAGTGTCTCCCTGTGTTCTGCGGAGACCCTGGCATCCCCGCAGAAGGGCG
ACTTAGTGGGAAAAGTTTCACCTATAAGTCCGAAGTCTTCTTCCAGTGCAAATCTCCATTTATACTCGTGGGATCCTCCAGAAGAGTCTG
CCAAGCTGACGGCACGTGGAGCGGCATACAACCCACCTGCATTGATCCTGCTCATAACACCTGCCCAGACCCTGGTACGCCACACTTTGG
AATACAGAATAGCTCCAGAGGCTATGAGGTTGGAAGCACGGTTTTTTTCAGGTGCAGAAAAGGCTACCATATTCAAGGTTCCACGACTCG
CACCTGCCTTGCCAATTTAACATGGAGTGGGATACAGACCGAATGTATACCTCATGCCTGCAGACAGCCAGAAACCCCGGCACACGCGGA
TGTGAGAGCCATCGATCTTCCTACTTTCGGCTACACCTTAGTGTACACCTGCCATCCAGGCTTTTTCCTCGCAGGGGGATCTGAGCACAG
AACATGTAAAGCAGACATGAAATGGACAGGAAAGTCGCCTGTGTGTAAAAGTAAAGGAGTGAGAGAAGTTAATGAAACAGTTACTAAAAC
TCCAGTTCCTTCAGATGTCTTTTTCGTCAATTCACTGTGGAAGGGGTATTATGAATATTTAGGGAAAAGACAACCCGCCACTCTAACTGT
TGACTGGTTCAATGCAACAAGCAGTAAGGTGAATGCCACCTTCAGCGAAGCCTCGCCAGTGGAGCTGAAGTTGACAGGCATTTACAAGAA
GGAGGAGGCCCACTTACTCCTGAAAGCTTTTCAAATTAAAGGCCAGGCAGATATTTTTGTAAGCAAGTTCGAAAATGACAACTGGGGACT
AGATGGTTATGTGTCATCTGGACTTGAAAGAGGAGGATTTACTTTTCAAGGTGACATTCATGGAAAAGACTTTGGAAAATTTAAGCTAGA
AAGGCAAGATCCTTTAAACCCAGATCAAGACTCTTCCAGTCATTACCACGGCACCAGCAGTGGCTCTGTGGCGGCTGCCATTCTGGTTCC
TTTCTTTGCTCTAATTTTATCAGGGTTTGCATTTTACCTCTACAAACACAGAACGAGACCAAAAGTTCAATACAATGGCTATGCTGGGCA
TGAAAACAGCAATGGACAAGCATCGTTTGAAAACCCCATGTATGATACAAACTTAAAACCCACAGAAGCCAAGGCTGTGAGGTTTGACAC

>In-frame_MCPH1_ENST00000344683_chr8_6312773_+_CSMD1_ENST00000539096_chr8_3351248_-_6997nt
GCATGCCCAGTGCCCGCGCGCGCCGCCAGGCTCGCAAGCACCGCGTAGGCCAGCTGGCCGGATCCCGCCGTCTGTCATGGCGGCCCCCAT
CCTGAAAGATGTAGTGGCCTATGTTGAAGTGTGGTCATCCAATGGAACAGAAAATTATTCAAAGACATTTACAACACAGCTTGTGGATAT
GGGGGCAAAGGTTTCAAAAACTTTTAACAAACAAGTAACTCACGTTATCTTCAAAGATGGCTACCAGAGCACTTGGGACAAAGCTCAGAA
GAGAGGCGTAAAGCTCGTTTCGGTGCTCTGGGTGGAAAAATGCAGGACAGCTGGAGCACACATTGATGAATCATTGTTCCCTGCAGCTAA
TATGAATGAACACTTATCAAGCCTAATTAAAAAAAAACGTAAATGTATGCAGCCCAAAGATTTTAATTTTAAAACACCAGAAAATGATAA
GAGATTTCAGAAGAAATTTGAGAAAATGGCTAAAGAGCTACAAAGGCAAAAAACAAATCTAGATGATGATGTACCTATTCTCTTATTTGA
ATCTAATGGTTCATTAATATATACTCCCACAATTGAAATTAATAGTAGGCACCACAGCGCAATGGAGAAGAGATTACAAGAGATGAAGGA
GAAAAGGGAAAATCTTTCCCCCACCTCTTCCCAAATGATTCAGCAGTCTCATGATAATCCAAGTAACTCTCTGTGTGAAGCACCTTTGAA
CATTTCACGTGATACTTTGTGTTCAGATGAATACTTTGCTGGTGGCTTACACTCATCTTTTGATGATCTTTGTGGAAACTCAGGATGTGG
AAATCAGGAAAGGAAGTTGGAAGGATCCATTAATGACATTAAAAGTGATGTGTGTATTTCTTCACTTGTATTGAAAGCAAATAATATTCA
TTCATCACCATCTTTCACTCACCTCGATAAATCAAGTCCTCAGAAATTTCTGAGTAATCTTTCAAAGGAAGAAATAAACTTGCAAAGAAA
TATTGCAGGTAAAGTAGTCACCCCTGACCAAAAGCAGGCTGCAGGTATGTCTCAGGAGACGTTTGAAGAGAAGTATCGTTTGTCTCCTAC
CTTATCTTCAACAAAAGGCCACCTTTTGATACATTCAAGACCCAGGAGTTCCTCAGTAAAGAGAAAAAGAGTATCACATGGCTCCCATTC
ACCTCCGAAGGAAAAATGCAAGAGAAAGAGGAGCACCAGGAGATCTATCATGCCGAGGCTGCAGCTGTGCAGGTCGGAAGACAGGCTGCA
GCACGTGGCGGGACCTGCCCTGGAGGCTCTTAGCTGTGGGGAGTCTTCATATGATGACTATTTTTCACCTGATAATCTTAAGGAAAGGTA
TTCAGAGAATCTTCCTCCTGAATCTCAGCTGCCATCAAGCCCTGCTCAGTTGAGCTGCAGAAGTCTTTCTAAGAAGGAGAGAACAAGCAT
ATTTGAAATGTCTGATTTTTCCTGCGTTGGCAAAAAAACCAGAACAGTTGACATTACCAATTTCACAGCAAAAACCATCTCCAGTCCTCG
GAAAACTGGAAATGGTGAAGGCCGTGCAACTTCGAGTTGCGTGACTTCTGCCCCTGAAGAAGCCCTAAGGTGTTGTAGACAGGCTGGGAA
AGAAGACGCATGCCCAGAGGGAAATGGCTTTTCTTACACCATTGAGGACCCTGCTCTTCCAAAAGGACATGATGATGATTTAACTCCTTT
GGAAGGAAGCCTTGAAGAAATGAAAGAAGCGGTTGGTCTGAAAAGCACACAGAACAAAGGTACCACTTCCAAAATATCAAACTCCTCTGA
AGGCGAAGCCCAGAGTGAACATGAGCCATGTTTTATAGTTGACTGTAACATGGAGACGTCTACAGAAGAGAAGGAAAACTTACCCGGAGG
ATACAGTGGAAGTGTTAAAAATAGACCAACAAGGCATGATGTTTTAGATGACTCATGTGACGGCTTTAAGGACCTCATCAAACCTCATGA
GGAATTGAAGAAAAGTGGGAGAGGCAAAAAGGTCATCAAGCTTGCCTTTGAAGAGTTTGAGCTGGAGCGAGGCTATGACACCCTGACGGT
TGGTGATGCTGGGAAGGTGGGAGACACCAGATCGGTCTTGTACGTGCTCACGGGATCCAGTGTTCCTGACCTCATTGTGAGCATGAGCAA
CCAGATGTGGCTACATCTGCAGTCGGATGATAGCATTGGCTCACCTGGGTTTAAAGCTGTTTACCAAGAAATTGAAAAGGGAGGGTGTGG
GGATCCTGGAATCCCCGCCTATGGGAAGCGGACGGGCAGCAGTTTCCTCCATGGAGATACACTCACCTTTGAATGCCCGGCGGCCTTTGA
GCTGGTGGGGGAGAGAGTTATCACCTGTCAGCAGAACAATCAGTGGTCTGGCAACAAGCCCAGCTGTGTATTTTCATGTTTCTTCAACTT
TACGGCATCATCTGGGATTATTCTGTCACCAAATTATCCAGAGGAATATGGGAACAACATGAACTGTGTCTGGTTGATTATCTCGGAGCC
AGGAAGTCGAATTCACCTAATCTTTAATGATTTTGATGTTGAGCCTCAGTTTGACTTTCTCGCGGTCAAGGATGATGGCATTTCTGACAT
AACTGTCCTGGGTACTTTTTCTGGCAATGAAGTGCCTTCCCAGCTGGCCAGCAGTGGGCATATAGTTCGCTTGGAATTTCAGTCTGACCA
TTCCACTACTGGCAGAGGGTTCAACATCACTTACACCACATTTGGTCAGAATGAGTGCCATGATCCTGGCATTCCTATAAACGGACGACG
TTTTGGTGACAGGTTTCTACTCGGGAGCTCGGTTTCTTTCCACTGTGATGATGGCTTTGTCAAGACCCAGGGATCCGAGTCCATTACCTG
CATACTGCAAGACGGGAACGTGGTCTGGAGCTCCACCGTGCCCCGCTGTGAAGCTCCATGTGGTGGACATCTGACAGCGTCCAGCGGAGT
CATTTTGCCTCCTGGATGGCCAGGATATTATAAGGATTCTTTACATTGTGAATGGATAATTGAAGCAAAACCAGGCCACTCTATCAAAAT
AACTTTTGACAGATTTCAGACAGAGGTCAATTATGACACCTTGGAGGTCAGAGATGGGCCAGCCAGTTCGTCCCCACTGATCGGCGAGTA
CCACGGCACCCAGGCACCCCAGTTCCTCATCAGCACCGGGAACTTCATGTACCTGCTGTTCACCACTGACAACAGCCGCTCCAGCATCGG
CTTCCTCATCCACTATGAGAGTGTGACGCTTGAGTCGGATTCCTGCCTGGACCCGGGCATCCCTGTGAACGGCCATCGCCACGGTGGAGA
CTTTGGCATCAGGTCCACAGTGACTTTCAGCTGTGACCCGGGGTACACACTAAGTGACGACGAGCCCCTCGTCTGTGAGAGGAACCACCA
GTGGAACCACGCCTTGCCCAGCTGCGACGCTCTATGTGGAGGCTACATCCAAGGGAAGAGTGGAACAGTCCTTTCTCCTGGGTTTCCAGA
TTTTTATCCAAACTCTCTAAACTGCACGTGGACCATTGAAGTGTCTCATGGGAAAGGAGTTCAAATGATCTTTCACACCTTTCATCTTGA
GAGTTCCCACGACTATTTACTGATCACAGAGGATGGAAGTTTTTCCGAGCCCGTTGCCAGGCTCACCGGGTCGGTGTTGCCTCATACGAT
CAAGGCAGGCCTGTTTGGAAACTTCACTGCCCAGCTTCGGTTTATATCAGACTTCTCAATTTCGTACGAGGGCTTCAATATCACATTTTC
AGAATATGACCTGGAGCCATGTGATGATCCTGGAGTCCCTGCCTTCAGCCGAAGAATTGGTTTTCACTTTGGTGTGGGAGACTCTCTGAC
GTTTTCCTGCTTCCTGGGATATCGTTTAGAAGGTGCCACCAAGCTTACCTGCCTGGGTGGGGGCCGCCGTGTGTGGAGTGCACCTCTGCC
AAGGTGTGTGGCCGAATGTGGAGCAAGTGTCAAAGGAAATGAAGGAACATTACTGTCTCCAAATTTTCCATCCAATTATGATAATAACCA
TGAGTGTATCTATAAAATAGAAACAGAAGCCGGCAAGGGCATCCACCTTAGAACACGAAGCTTCCAGCTGTTTGAAGGAGATACTCTAAA
GGTATATGATGGAAAAGACAGTTCCTCACGTCCACTGGGCACGTTCACTAAAAATGAACTTCTGGGGCTGATCCTAAACAGCACATCCAA
TCACCTGTGGCTAGAGTTCAACACCAATGGATCTGACACCGACCAAGGTTTTCAACTCACCTATACCAGTTTTGATCTGGTAAAATGTGA
GGATCCGGGCATCCCTAACTACGGCTATAGGATCCGTGATGAAGGCCACTTTACCGACACTGTAGTTCTGTACAGTTGCAACCCGGGGTA
CGCCATGCATGGCAGCAACACCCTGACCTGTTTGAGTGGAGACAGGAGAGTGTGGGACAAACCACTACCTTCGTGCATAGCGGAATGTGG
TGGTCAGATCCATGCAGCCACATCAGGACGAATATTGTCCCCTGGCTATCCAGCTCCGTATGACAACAACCTCCACTGCACCTGGATTAT
AGAGGCAGACCCAGGAAAGACCATTAGCCTCCATTTCATTGTTTTCGACACGGAGATGGCTCACGACATCCTCAAGGTCTGGGACGGGCC
GGTGGACAGTGACATCCTGCTGAAGGAGTGGAGTGGCTCCGCCCTTCCGGAGGACATCCACAGCACCTTCAACTCACTCACCCTGCAGTT
CGACAGCGACTTCTTCATCAGCAAGTCTGGCTTCTCCATCCAGTTCTCCACCTCAATTGCAGCCACCTGTAACGATCCAGGTATGCCCCA
AAATGGCACCCGCTATGGAGACAGCAGAGAGGCTGGAGACACCGTCACATTCCAGTGTGACCCTGGCTATCAGCTCCAAGGACAAGCCAA
AATCACCTGTGTGCAGCTGAATAACCGGTTCTTTTGGCAACCAGACCCTCCTACATGCATAGCTGCTTGTGGAGGGAATCTGACGGGCCC
AGCAGGTGTTATTTTGTCACCCAACTACCCACAGCCGTATCCTCCTGGGAAGGAATGTGACTGGAGAGTAAAAGTGAACCCGGACTTTGT
CATCGCCTTGATATTCAAAAGTTTCAACATGGAGCCCAGCTATGACTTCCTACACATCTATGAAGGGGAAGATTCCAACAGCCCCCTCAT
TGGGAGTTACCAGGGCTCTCAGGCCCCAGAAAGAATAGAGAGTAGCGGAAACAGCCTGTTTCTGGCATTTCGGAGTGATGCCTCCGTGGG
CCTTTCAGGGTTCGCCATTGAATTTAAAGAGAAACCACGGGAAGCTTGTTTTGACCCAGGAAATATAATGAATGGGACAAGAGTTGGAAC
AGACTTCAAGCTTGGCTCCACCATCACCTACCAGTGTGACTCTGGCTATAAGATTCTTGACCCCTCATCCATCACCTGTGTGATTGGGGC
TGATGGGAAACCCTCCTGGGACCAAGTGCTGCCCTCCTGCAATGCTCCCTGTGGAGGCCAGTACACGGGATCAGAAGGGGTAGTTTTATC
ACCAAACTACCCCCATAATTACACAGCTGGTCAAATATGCCTCTATTCCATCACGGTACCAAAGGAATTCGTGGTCTTTGGACAGTTTGC
CTATTTCCAGACAGCCCTGAATGATTTGGCAGAATTATTTGATGGAACCCATGCACAGGCCAGACTTCTCAGCTCACTCTCGGGGTCTCA
CTCAGGGGAAACATTGCCCTTGGCTACGTCAAATCAAATTCTGCTCCGATTCAGTGCAAAGAGCGGTGCCTCTGCCCGCGGCTTCCACTT
CGTGTATCAAGCTGTTCCTCGTACCAGTGACACCCAATGCAGCTCTGTCCCCGAGCCCAGATACGGAAGGAGAATTGGTTCTGAGTTTTC
TGCCGGCTCCATCGTCCGATTCGAGTGCAACCCGGGATACCTGCTTCAGGGTTCCACGGCGCTCCACTGCCAGTCCGTGCCCAACGCCTT
GGCACAGTGGAACGACACGATCCCCAGCTGTGTGGTACCCTGCAGTGGCAATTTCACTCAACGAAGAGGTACAATCCTGTCCCCCGGCTA
CCCTGAGCCATACGGAAACAACTTGAACTGTATATGGAAGATCATAGTTACGGAGGGCTCGGGAATTCAGATCCAAGTGATCAGTTTTGC
CACGGAGCAGAACTGGGACTCCCTTGAGATCCACGATGGTGGGGATGTGACCGCACCCAGACTGGGAAGCTTCTCAGGCACCACAGTACC
GGCACTGCTGAACAGTACTTCCAACCAACTCTACCTGCATTTCCAGTCTGACATTAGTGTGGCAGCTGCTGGTTTCCACCTGGAATACAA
AACTGTAGGTCTTGCTGCATGCCAAGAACCAGCCCTCCCCAGCAACAGCATCAAAATCGGAGATCGGTACATGGTGAACGACGTGCTCTC
CTTCCAGTGCGAGCCCGGGTACACCCTGCAGGGCCGTTCCCACATTTCCTGTATGCCAGGGACCGTTCGCCGTTGGAACTATCCGTCTCC
CCTGTGCATTGCAACCTGTGGAGGGACGCTGAGCACCTTGGGTGGTGTGATCCTGAGCCCCGGCTTCCCAGGTTCTTACCCCAACAACTT
AGACTGCACCTGGAGGATCTCATTACCCATCGGCTATGGTGCACATATTCAGTTTCTGAATTTTTCTACCGAAGCTAATCATGACTTCCT
TGAAATTCAAAATGGACCTTACCACACCAGCCCCATGATTGGACAATTTAGCGGCACGGATCTCCCCGCGGCCCTGCTGAGCACAACGCA
TGAAACCCTCATCCACTTTTATAGTGACCATTCGCAAAACCGGCAAGGATTTAAACTTGCTTACCAAGGAGGATCTGGAAACATTGGTCC


Top

FusionGenePPI for MCPH1_CSMD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MCPH1RAD51, BRCA2, SMARCA4, SMARCC2, SMARCC1, SMARCB1, SMARCA2, MCM2, MDC1, ATM, TP53BP1, NBN, ATR, RPA1, CHEK1, E2F1, H2AFX, CHD4, CDC27, ABCC2, PHF11, TADA2A, KDM1A, CRACR2A, BIRC6, USP8, KRAS, POLR2G, UXT, AKIP1, COL1A1, ENO1, GNB2L1, LAMTOR5, MT2A, OBSL1, THAP11, ACTG1, AKR7A2, B3GALT6, CCDC77, CCT5, COL27A1, COPB2, COPS3, CTSL, DNAJA3, DNAJC19, EIF3F, EIF4A2, EMG1, FBLN1, FBXW11, FLNA, GABARAPL2, HNRNPA2B1, HSPD1, KAT5, LGALS3, MCM5, MITD1, MRPL46, NCCRP1, NMI, NR2F1, PMVK, POLD1, PPA1, PPRC1, RBM39, RSL24D1, RUVBL2, S100A16, SMOX, SUPT6H, TAF1D, TPT1, TRAP1, TSEN54, VIM, WDR53, WDR61, WDR73, WDR75, WNT10B, ZMIZ2, FZR1, ZNF827CSMD1BCL6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MCPH1_CSMD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MCPH1_CSMD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMCPH1C1855081MICROCEPHALY, PRIMARY AUTOSOMAL RECESSIVE, 11CTD_human;ORPHANET;UNIPROT
TgeneCSMD1C0036341Schizophrenia5PSYGENET
TgeneCSMD1C0005586Bipolar Disorder1PSYGENET
TgeneCSMD1C0033860Psoriasis1CTD_human
TgeneCSMD1C0236733Amphetamine-Related Disorders1CTD_human
TgeneCSMD1C0236969Substance-Related Disorders1CTD_human