FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21236

FusionGeneSummary for MBP_PAXIP1

check button Fusion gene summary
Fusion gene informationFusion gene name: MBP_PAXIP1
Fusion gene ID: 21236
HgeneTgene
Gene symbol

MBP

PAXIP1

Gene ID

5553

22976

Gene nameproteoglycan 2, pro eosinophil major basic proteinPAX interacting protein 1
SynonymsBMPG|MBP|MBP1|proMBPCAGF28|CAGF29|PACIP1|PAXIP1L|PTIP|TNRC2
Cytomap

11q12.1

7q36.2

Type of geneprotein-codingprotein-coding
Descriptionbone marrow proteoglycaneosinophil granule major basic proteineosinophil major basic proteinnatural killer cell activatorproteoglycan 2 preproproteinproteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)PAX-interacting protein 1PAX interacting (with transcription-activation domain) protein 1PAX transcription activation domain interacting protein 1 likeprotein encoded by CAG trinucleotide repeats
Modification date2018051920180522
UniProtAcc

P02686

Q6ZW49

Ensembl transtripts involved in fusion geneENST00000382582, ENST00000355994, 
ENST00000397875, ENST00000397866, 
ENST00000397865, ENST00000527041, 
ENST00000359645, ENST00000528160, 
ENST00000397869, ENST00000354542, 
ENST00000526111, ENST00000580402, 
ENST00000579129, ENST00000578193, 
ENST00000397863, ENST00000397860, 
ENST00000487778, 
ENST00000404141, 
ENST00000397192, ENST00000473219, 
Fusion gene scores* DoF score13 X 13 X 3=5073 X 3 X 1=9
# samples 153
** MAII scorelog2(15/507*10)=-1.75702324650746
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MBP [Title/Abstract] AND PAXIP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePAXIP1

GO:0010212

response to ionizing radiation

15456759

TgenePAXIP1

GO:0051568

histone H3-K4 methylation

17178841


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DA327424MBPchr18

74728786

-PAXIP1chr7

154790496

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000382582ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000382582ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000382582ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
Frame-shitENST00000355994ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
Frame-shitENST00000355994ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000355994ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397875ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397875ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000397875ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397866ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397866ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000397866ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397865ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397865ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000397865ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000527041ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000527041ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000527041ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000359645ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000359645ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000359645ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000528160ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000528160ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-5UTRENST00000528160ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397869ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000397869ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000397869ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000354542ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000354542ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000354542ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000526111ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000526111ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000526111ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000580402ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000580402ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000580402ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
Frame-shitENST00000579129ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
Frame-shitENST00000579129ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000579129ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000578193ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
In-frameENST00000578193ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
5CDS-5UTRENST00000578193ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000397863ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000397863ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-5UTRENST00000397863ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000397860ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000397860ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-5UTRENST00000397860ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000487778ENST00000404141MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-3CDSENST00000487778ENST00000397192MBPchr18

74728786

-PAXIP1chr7

154790496

-
intron-5UTRENST00000487778ENST00000473219MBPchr18

74728786

-PAXIP1chr7

154790496

-

Top

FusionProtFeatures for MBP_PAXIP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MBP

P02686

PAXIP1

Q6ZW49

Involved in DNA damage response and in transcriptionalregulation through histone methyltransferase (HMT) complexes.Plays a role in early development. In DNA damage response isrequired for cell survival after ionizing radiation. In vitroshown to be involved in the homologous recombination mechanism forthe repair of double-strand breaks (DSBs). Its localization to DNAdamage foci requires RNF8 and UBE2N. Recruits TP53BP1 to DNAdamage foci and, at least in particular repair processes,effective DNA damage response appears to require the associationwith TP53BP1 phosphorylated by ATM at 'Ser-25'. Together withTP53BP1 regulates ATM association. Proposed to recruit PAGR1 tosites of DNA damage and the PAGR1:PAXIP1 complex is required forcell survival in response to DNA damage; the function is probablyindependent of MLL-containing histone methyltransferase (HMT)complexes. However, this function has been questioned (Bysimilarity). Promotes ubiquitination of PCNA following UVirradiation and may regulate recruitment of polymerase eta andRAD51 to chromatin after DNA damage. Proposed to be involved intranscriptional regulation by linking MLL-containing histonemethyltransferase (HMT) complexes to gene promoters by interactingwith promoter-bound transcription factors such as PAX2. Associateswith gene promoters that are known to be regulated by KMT2D/MLL2.During immunoglobulin class switching in activated B-cells isinvolved in trimethylation of histone H3 at 'Lys-4' and intranscription initiation of downstream switch regions at theimmunoglobulin heavy-chain (Igh) locus; this function appears toinvolve the recruitment of MLL-containing HMT complexes.Conflictingly, its function in transcriptional regulation duringimmunoglobulin class switching is reported to be independent ofthe MLL2/MLL3 complex (By similarity).{ECO:0000250|UniProtKB:Q6NZQ4, ECO:0000269|PubMed:14576432,ECO:0000269|PubMed:15456759, ECO:0000269|PubMed:17690115,ECO:0000269|PubMed:17925232, ECO:0000269|PubMed:18353733,ECO:0000269|PubMed:20088963, ECO:0000269|PubMed:23727112}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021223_250271070Compositional biasNote=Glu-rich
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021406_624271070Compositional biasNote=Gln-rich
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021223_250271070Compositional biasNote=Glu-rich
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021406_624271070Compositional biasNote=Gln-rich
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021601_694271070DomainBRCT 3
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021703_779271070DomainBRCT 4
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021866_947271070DomainBRCT 5
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021970_1059271070DomainBRCT 6
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021601_694271070DomainBRCT 3
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021703_779271070DomainBRCT 4
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021866_947271070DomainBRCT 5
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021970_1059271070DomainBRCT 6
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021702_719271070MotifNuclear localization signal
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021702_719271070MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBPchr18:74728786chr7:154790496ENST00000355994-49179_222192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000355994-49246_256192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000359645-16179_22259187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000359645-16246_25659187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000382582-17179_22259198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000382582-17246_25659198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000397860-14179_222-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000397860-14246_256-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000397863-14179_222-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000397863-14246_256-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000397865-15179_22259161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000397865-15246_25659161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000397866-16179_22259172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000397866-16246_25659172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728786chr7:154790496ENST00000580402-38179_222192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728786chr7:154790496ENST00000580402-38246_256192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-0218_93271070DomainBRCT 1
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-0218_93271070DomainBRCT 1


Top

FusionGeneSequence for MBP_PAXIP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1043aa
VIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSAL
WALVTFTGGDCQLTLNKKCTHLIVPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQD
SQNEGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
PVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAV
LFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHP
PQQLHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQ
VPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQV
SSATAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLI
CKEPTGLKTEKAKEWRIPCVNAQWLGDILLGNFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQN
EVANVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTP
EWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQ

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1043aa
VIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSAL
WALVTFTGGDCQLTLNKKCTHLIVPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQD
SQNEGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
PVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAV
LFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHP
PQQLHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQ
VPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQV
SSATAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLI
CKEPTGLKTEKAKEWRIPCVNAQWLGDILLGNFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQN
EVANVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTP
EWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQ

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1043aa
VIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSAL
WALVTFTGGDCQLTLNKKCTHLIVPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQD
SQNEGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
PVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAV
LFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHP
PQQLHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQ
VPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQV
SSATAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLI
CKEPTGLKTEKAKEWRIPCVNAQWLGDILLGNFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQN
EVANVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTP
EWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQ

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1043aa
VIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSAL
WALVTFTGGDCQLTLNKKCTHLIVPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQD
SQNEGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
PVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAV
LFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHP
PQQLHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQ
VPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQV
SSATAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLI
CKEPTGLKTEKAKEWRIPCVNAQWLGDILLGNFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQN
EVANVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTP
EWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQ

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_1102aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVIQLLKAGKAKEVSYNALASHIISEDGDNPE
VGEAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFTGGDCQLTLNKKCTHLIVPEPKGEK
YECALKRASIKIVTPDWVLDCVSEKTKKDEAFTHPRLIITEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKS
NTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMI
ATWSPAVRTLRNITNNADIQQMNRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLH
LQPQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQPFQQQHALQQQFHQLQQHQ
LQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAV
EIPEEGFLLGCVFAIADTPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSATAQAIRERKRCVTAHWLNTVLKKKKMVP
PHRALHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMATLAGAKTTGTLCRSNTVLICKEPTGLKTEKAKEWRIPCVNAQWLGDILLG
NFEALRQIQTSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVANVQPSSKRARIEDVPPPTKKLTPELTPF
VLFTGFEPVQVQQTIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSF
SLEESLKRAHVSPLFKAKTFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCRETFARGIDVHN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3129nt
GTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCA
GAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCA
GTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTG
TGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAG
AAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGAC
GAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGAT
TCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAA
TCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACC
CCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCA
CCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATG
ATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCA
CATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTG
CTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTA
CACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCA
TTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCT
CCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCAC
CAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTC
CAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAG
GTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCA
GTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCC
ACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTC
AGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTA
CCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTT
GATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATC
TGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTG
GGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTT
TTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAAT
GAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCT
TTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCA
CAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCA
GAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCT
TTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGT
CTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAG
AACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCAC

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3129nt
GTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCA
GAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCA
GTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTG
TGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAG
AAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGAC
GAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGAT
TCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAA
TCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACC
CCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCA
CCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATG
ATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCA
CATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTG
CTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTA
CACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCA
TTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCT
CCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCAC
CAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTC
CAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAG
GTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCA
GTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCC
ACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTC
AGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTA
CCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTT
GATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATC
TGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTG
GGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTT
TTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAAT
GAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCT
TTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCA
CAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCA
GAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCT
TTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGT
CTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAG
AACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCAC

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3129nt
GTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCA
GAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCA
GTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTG
TGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAG
AAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGAC
GAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGAT
TCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAA
TCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACC
CCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCA
CCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATG
ATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCA
CATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTG
CTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTA
CACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCA
TTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCT
CCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCAC
CAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTC
CAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAG
GTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCA
GTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCC
ACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTC
AGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTA
CCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTT
GATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATC
TGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTG
GGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTT
TTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAAT
GAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCT
TTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCA
CAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCA
GAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCT
TTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGT
CTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAG
AACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCAC

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3129nt
GTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCA
GAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCA
GTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTG
TGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAG
AAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGAC
GAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGAT
TCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAA
TCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACC
CCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCA
CCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATG
ATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCA
CATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTG
CTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTA
CACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCA
TTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCT
CCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCAC
CAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTC
CAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAG
GTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCA
GTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCC
ACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTC
AGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTA
CCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTT
GATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATC
TGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTG
GGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTT
TTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAAT
GAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCT
TTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCA
CAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCA
GAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCT
TTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGT
CTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAG
AACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCAC

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3306nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTT
ATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAG
GTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTA
AATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGG
GCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAA
TACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAA
GCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCT
CAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCC
AACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCG
GCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCC
GTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATA
GCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACAT
ATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTG
TTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACAC
CTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTT
TCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCA
CAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAG
CTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAG
CGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTT
CCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTG
GAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACC
TGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGC
AGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCG
CCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGAT
AGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGT
AAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGA
AACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTA
AATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAA
GTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTT
GTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAG
AAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAG
TGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTC
AGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTT
TCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAAC
TCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3855nt
AACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATG
GCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCA
AGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATT
CAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTG
GGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAAT
GGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCT
TTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATAC
GAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCA
TTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAG
AATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAAC
ACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCC
GAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTC
CCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCT
ACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATC
TTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTT
AGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTT
CAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCA
CAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAG
CAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTC
CAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGC
ATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCA
CCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAG
ATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGG
AAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGC
GCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCG
CACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGT
GACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAA
GAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAAC
TTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAAT
CTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTA
GCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTG
CTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAG
TGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGG
CTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGC
TTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCC
ACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCG
AGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCA
GAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGA
CTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGA
TCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTT
TTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTC
AACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTT

>In-frame_MBP_ENST00000382582_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3851nt
AACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATG
GCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCA
AGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATT
CAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTG
GGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAAT
GGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCT
TTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATAC
GAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCA
TTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAG
AATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAAC
ACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCC
GAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTC
CCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCT
ACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATC
TTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTT
AGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTT
CAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCA
CAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAG
CAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTC
CAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGC
ATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCA
CCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAG
ATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGG
AAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGC
GCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCG
CACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGT
GACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAA
GAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAAC
TTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAAT
CTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTA
GCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTG
CTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAG
TGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGG
CTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGC
TTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCC
ACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCG
AGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCA
GAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGA
CTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGA
TCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTT
TTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTC
AACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTT

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3815nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC

>In-frame_MBP_ENST00000397875_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3811nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3822nt
GAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGA
TCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATC
GGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTT
TCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTT
GTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTT
GGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTA
ACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATT
GTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAG
GAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCT
GCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGAT
GATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGG
CTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGT
AATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAAT
ATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTA
GAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATG
CTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAG
CAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCG
CATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCC
TTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAG
CACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAA
AGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAG
CAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTG
TTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTT
GACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGA
TGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCA
CCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTG
GCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAA
GAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGC
TACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTG
TCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGA
ATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAA
CAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGC
ACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATT
GATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCT
CCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGA
AAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAA
AATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACG
CTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGC
GAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAA
ATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGG
TTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTT
GCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGAT

>In-frame_MBP_ENST00000397866_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3818nt
GAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGA
TCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATC
GGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTT
TCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTT
GTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTT
GGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTA
ACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATT
GTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAG
GAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCT
GCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGAT
GATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGG
CTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGT
AATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAAT
ATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTA
GAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATG
CTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAG
CAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCG
CATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCC
TTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAG
CACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAA
AGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAG
CAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTG
TTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTT
GACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGA
TGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCA
CCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTG
GCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAA
GAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGC
TACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTG
TCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGA
ATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAA
CAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGC
ACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATT
GATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCT
CCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGA
AAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAA
AATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACG
CTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGC
GAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAA
ATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGG
TTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTT
GCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGAT

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3846nt
AAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAG
AAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGA
GACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTC
AAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCT
CGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCT
CCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACG
TTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCT
TTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCAT
CCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGT
AGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAA
TCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCA
CAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAAC
ATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGT
CCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACT
CTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTG
AAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAG
CAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAG
CAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCAT
CGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAG
CAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAG
CAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAG
CCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAA
GAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATA
ATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCA
CAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCC
CTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGAT
GACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACT
GGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCA
CTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGAT
GCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTC
CAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACT
GGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACAC
CTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAA
TGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAA
TCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAG
GCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCG
GAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTT
CTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGG
TGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGT
GAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTAT
ATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAA
TAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTA

>In-frame_MBP_ENST00000397865_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3842nt
AAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAG
AAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGA
GACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTC
AAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCT
CGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCT
CCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACG
TTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCT
TTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCAT
CCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGT
AGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAA
TCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCA
CAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAAC
ATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGT
CCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACT
CTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTG
AAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAG
CAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAG
CAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCAT
CGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAG
CAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAG
CAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAG
CCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAA
GAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATA
ATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCA
CAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCC
CTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGAT
GACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACT
GGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCA
CTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGAT
GCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTC
CAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACT
GGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACAC
CTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAA
TGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAA
TCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAG
GCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCG
GAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTT
CTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGG
TGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGT
GAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTAT
ATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAA
TAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTA

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3825nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
GGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCC
ATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAA
GTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCT
GTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTT
TTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAG
CTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAA
ATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAA
GAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGC
CCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTT
GATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGC
AGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGG
GGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGG
AATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAAT
TTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACAC
ATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAG
CAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCAT
CCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAG
CCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAG
CAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATG
CAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAA
CAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGT
GTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACT
GTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAG
AGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTC
CCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTAT
TTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCC
AAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGT
CGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAA
GTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCC
AGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTT
CAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACT
CGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTC
ATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTT
TCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGA
GGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGT
GAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAA
ACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCT
GGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAA
TAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATT
AGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGAC
CTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATT

>In-frame_MBP_ENST00000527041_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3821nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
GGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCC
ATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAA
GTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCT
GTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTT
TTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAG
CTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAA
ATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAA
GAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGC
CCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTT
GATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGC
AGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGG
GGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGG
AATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAAT
TTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACAC
ATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAG
CAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCAT
CCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAG
CCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAG
CAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATG
CAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAA
CAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGT
GTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACT
GTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAG
AGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTC
CCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTAT
TTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCC
AAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGT
CGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAA
GTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCC
AGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTT
CAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACT
CGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTC
ATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTT
TCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGA
GGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGT
GAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAA
ACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCT
GGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAA
TAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATT
AGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGAC
CTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATT

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3802nt
AGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGC
AAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGA
CAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTC
ACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGAT
TCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTC
TCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCAC
GCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCT
GGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGA
GGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTC
TCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACC
GGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCC
TGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACA
AAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACAT
TCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAG
CCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGC
CCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCA
GCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACA
GCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCT
GCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCA
GCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTT
GAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCA
GCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCC
AGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCG
ATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTT
AAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTC
ACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGG
TTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGT
CAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCA
GGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAG
TATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCC
CACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTA
CATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGC
GATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCT
CCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATA
TTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCC
ATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCG
AGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAA
GTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCT
TCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAG
ATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAG
GTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGAT
GTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGCCCACATTTTAAAT

>In-frame_MBP_ENST00000359645_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3798nt
AGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGC
AAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGA
CAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTC
ACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGAT
TCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTC
TCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCAC
GCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCT
GGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGA
GGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTC
TCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACC
GGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCC
TGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACA
AAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACAT
TCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAG
CCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGC
CCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCA
GCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACA
GCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCT
GCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCA
GCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTT
GAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCA
GCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCC
AGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCG
ATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTT
AAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTC
ACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGG
TTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGT
CAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCA
GGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAG
TATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCC
CACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTA
CATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGC
GATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCT
CCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATA
TTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCC
ATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCG
AGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAA
GTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCT
TCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAG
ATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAG
GTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGAT
GTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGCCCACATTTTAAAT

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3815nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC

>In-frame_MBP_ENST00000397869_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3811nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_4021nt
AGATGCGAACCAGAACAATGGGACCTCCTCTCAGGACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGA
TGCCCACCCAGCTGACCCAGGGAGCCGCCCCCACTTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGA
CAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAG
ACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACAC
GGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGC
TGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGA
AGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGA
ATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTA
TGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAA
GCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCG
TCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTAC
AGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAA
AGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTT
AGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTT
GCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGC
TGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTC
AGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGT
GACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGAT
AATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCA
GCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCC
TCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCT
TGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCA
GCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCC
GCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGG
CTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCA
GGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGC
AATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCA
CTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCT
AAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTT
AAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAG
GCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTG
GAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCC
TTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATT
CGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCAT
TGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTT
CAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTT
AAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAAT
CGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAAT
AATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGAC
TGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGG
GGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGC
AGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGAC
TTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAA
TGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTC

>In-frame_MBP_ENST00000354542_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_4017nt
AGATGCGAACCAGAACAATGGGACCTCCTCTCAGGACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGA
TGCCCACCCAGCTGACCCAGGGAGCCGCCCCCACTTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGA
CAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAG
ACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACAC
GGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGC
TGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGA
AGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGA
ATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTA
TGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAA
GCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCG
TCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTAC
AGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAA
AGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTT
AGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTT
GCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGC
TGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTC
AGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGT
GACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGAT
AATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCA
GCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCC
TCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCT
TGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCA
GCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCC
GCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGG
CTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCA
GGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGC
AATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCA
CTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCT
AAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTT
AAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAG
GCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTG
GAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCC
TTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATT
CGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCAT
TGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTT
CAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTT
AAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAAT
CGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAAT
AATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGAC
TGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGG
GGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGC
AGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGAC
TTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAA
TGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTC

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3759nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
AGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTT
CTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAA
GCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTT
TCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTT
ACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGT
GCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTAT
CATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAG
GGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAA
AAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTC
CCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGT
AACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGG
AGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAG
ACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAA
GTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCC
CAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAA
CAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTG
CATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAG
CAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCAC
CAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAG
CAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCA
GAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGG
ATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTAT
GCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGA
GCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGA
GATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCA
ACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAG
GCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTA
GATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAAT
GTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTC
ACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACA
CACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAA
GAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAA
GAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATG
AAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTG
TCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTC
GTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTG
CGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGAC
TGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTAT
TATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAG
AAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTC

>In-frame_MBP_ENST00000526111_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3755nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
AGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTT
CTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAA
GCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTT
TCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTT
ACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGT
GCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTAT
CATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAG
GGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAA
AAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTC
CCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGT
AACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGG
AGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAG
ACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAA
GTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCC
CAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAA
CAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTG
CATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAG
CAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCAC
CAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAG
CAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCA
GAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGG
ATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTAT
GCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGA
GCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGA
GATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCA
ACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAG
GCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTA
GATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAAT
GTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTC
ACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACA
CACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAA
GAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAA
GAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATG
AAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTG
TCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTC
GTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTG
CGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGAC
TGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTAT
TATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAG
AAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTC

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_4167nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGAATAGTGAAACTAACAGAGGAGAATCTGAAAAAAAGAGA
AACCTGGGTGAACTTTCACGGACAACCTCAGAGGACAACGAAGTGTTCGGAGAGGCAGATGCGAACCAGAACAATGGGACCTCCTCTCAG
GACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGATGCCCACCCAGCTGACCCAGGGAGCCGCCCCCAC
TTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATC
CAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCC
ACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGC
GGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTA
GCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGG
GTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGC
CTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAA
TGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGG
GTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAG
GAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAA
GGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCA
TCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAG
GAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCT
GGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCT
GACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAAT
CACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAG
CAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATC
TCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAG
CAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCAT
GCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAG
CAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCA
CACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCG
CCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGAT
TATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACG
AGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACAC
TGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCA
TGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATAT
ACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCC
TGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGT
CTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTG
ATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCA
CCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAG
CTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTG
ACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTAC
ATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCA
AAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAG
CAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTA
TGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCA
TATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGC
TTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTT
TTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTT
GCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTA
TGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGCCCACATTT

>In-frame_MBP_ENST00000580402_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_4163nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGAATAGTGAAACTAACAGAGGAGAATCTGAAAAAAAGAGA
AACCTGGGTGAACTTTCACGGACAACCTCAGAGGACAACGAAGTGTTCGGAGAGGCAGATGCGAACCAGAACAATGGGACCTCCTCTCAG
GACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGATGCCCACCCAGCTGACCCAGGGAGCCGCCCCCAC
TTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATC
CAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCC
ACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGC
GGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACAATGCACTA
GCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGCCTTCTTGG
GTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCACTGCCTGC
CTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCAATAAGAAA
TGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTCCTGACTGG
GTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAGAGGAAGAG
GAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCTCTCAAGAA
GGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTTCAGATTCA
TCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTCAGGGAAAG
GAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAATGGCTGCT
GGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTAATAATGCT
GACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGCAGGTGAAT
CACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGCAGCAGCAG
CAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGCAGCAGATC
TCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGTTTTCACAG
CAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGCAGCAGCAT
GCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCCTGCTCCAG
CAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGACAGCGCCA
CACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCACCACCATCG
CCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAATTGCGGAT
TATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCACCTTCACG
AGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTACTGCACAC
TGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAGGAAAGCCA
TGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTGCCAAATAT
ACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGAGGATACCC
TGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGGCATTCAGT
CTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAGAGTTGTTG
ATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAGACGTACCA
CCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATATTAAGAAG
CTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGAAGTTCCTG
ACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGCAGAACTAC
ATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCTTTAAGGCA
AAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGTTATCCAAG
CAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACCTTCATTTA
TGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACTATGAATCA
TATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGCTGCTGCGC
TTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACTGCATCTTT
TTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATGATTCATTT
GCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCTCTAAATTA
TGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGCCCACATTT

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000404141_chr7_154790496_-_3815nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC

>In-frame_MBP_ENST00000578193_chr18_74728786_-_PAXIP1_ENST00000397192_chr7_154790496_-_3811nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTTATTCAGCTTCTCAAGGCTGGAAAAGCGAAGGAAGTTTCCTACA
ATGCACTAGCCTCACACATAATCTCAGAGGATGGGGACAATCCAGAGGTGGGAGAAGCTCGGGAAGTCTTTGACTTACCTGTTGTAAAGC
CTTCTTGGGTGATTCTGTCCGTTCAGTGTGGAACTCTTCTGCCAGTAAATGGTTTTTCTCCAGAATCATGTCAGATTTTTTTTGGAATCA
CTGCCTGCCTTTCTCAGGTGTCATCTGAAGACAGAAGTGCCCTGTGGGCTTTGGTTACGTTCTATGGGGGAGATTGCCAGCTAACCCTCA
ATAAGAAATGCACGCATTTGATTGTTCCAGAGCCAAAGGGGGAGAAATACGAATGTGCTTTAAAGCGAGCAAGTATTAAAATTGTGACTC
CTGACTGGGTTCTGGATTGCGTATCAGAGAAAACCAAAAAGGACGAAGCATTTTATCATCCTCGTCTGATTATTTATGAAGAGGAAGAAG
AGGAAGAGGAAGAGGAGGAGGAAGTAGAAAATGAGGAACAAGATTCTCAGAATGAGGGTAGTACAGATGAGAAGTCAAGCCCTGCCAGCT
CTCAAGAAGGGTCTCCTTCAGGTGACCAGCAGTTTTCACCTAAATCCAACACTGAAAAATCTAAAGGGGAATTAATGTTTGATGATTCTT
CAGATTCATCACCGGAAAAACAGGAGAGAAATTTAAACTGGACCCCGGCCGAAGTCCCACAGTTAGCTGCAGCAAAACGCAGGCTGCCTC
AGGGAAAGGAGCCTGGGTTGATTAACTTGTGTGCCAATGTCCCACCCGTCCCAGGTAACATTTTGCCCCCTGAGGTCCGGGGTAATTTAA
TGGCTGCTGGACAAAACCTCCAAAGTTCTGAAAGATCAGAAATGATAGCTACCTGGAGTCCAGCTGTACGGACACTGAGGAATATTACTA
ATAATGCTGACATTCAGCAGATGAACCGGCCATCAAATGTAGCACATATCTTACAGACTCTTTCAGCACCTACGAAAAATTTAGAACAGC
AGGTGAATCACAGCCAGCAGGGACATACAAATGCCAATGCAGTGCTGTTTAGCCAAGTGAAAGTGACTCCAGAGACACACATGCTACAGC
AGCAGCAGCAGGCCCAGCAGCAGCAGCAGCAGCACCCGGTTTTACACCTTCAGCCCCAGCAGATAATGCAGCTCCAGCAGCAGCAGCAGC
AGCAGATCTCTCAGCAACCTTACCCCCAGCAGCCGCCGCATCCATTTTCACAGCAACAGCAGCAGCAGCAGCAAGCCCATCCGCATCAGT
TTTCACAGCAACAGCTACAGTTTCCACAGCAACAGTTGCATCCTCCACAGCAGCTGCATCGCCCTCAGCAGCAGCTCCAGCCCTTTCAGC
AGCAGCATGCCCTGCAGCAGCAGTTCCATCAGCTGCAGCAGCACCAGCTCCAGCAGCAGCAGCTTGCCCAGCTCCAGCAGCAGCACAGCC
TGCTCCAGCAGCAGCAGCAACAGCAGATTCAGCAGCAGCAGCTCCAGCGCATGCACCAGCAGCAGCAGCAGCAGCAGATGCAAAGTCAGA
CAGCGCCACACTTGAGTCAGACGTCACAGGCGCTGCAGCATCAGGTTCCACCTCAGCAGCCCCCGCAGCAGCAGCAGCAACAGCAGCCAC
CACCATCGCCTCAGCAGCATCAGCTTTTTGGACATGATCCAGCAGTGGAGATTCCAGAAGAAGGCTTCTTATTGGGATGTGTGTTTGCAA
TTGCGGATTATCCAGAGCAGATGTCTGATAAGCAACTGCTGGCCACCTGGAAAAGGATAATCCAGGCACATGGCGGCACTGTTGACCCCA
CCTTCACGAGTCGATGCACGCACCTTCTCTGTGAGAGTCAAGTCAGCAGCGCGTATGCACAGGCAATAAGAGAAAGAAAGAGATGTGTTA
CTGCACACTGGTTAAACACAGTCTTAAAGAAGAAGAAAATGGTACCGCCGCACCGAGCCCTTCACTTCCCAGTGGCCTTCCCACCAGGAG
GAAAGCCATGTTCACAGCATATTATTTCTGTGACTGGATTTGTTGATAGTGACAGAGATGACCTAAAATTAATGGCTTATTTGGCAGGTG
CCAAATATACGGGTTATCTATGCCGCAGCAACACAGTCCTCATCTGTAAAGAACCAACTGGTTTAAAGTATGAAAAAGCCAAAGAGTGGA
GGATACCCTGTGTCAACGCCCAGTGGCTTGGCGACATTCTTCTGGGAAACTTTGAGGCACTGAGGCAGATTCAGTATAGTCGCTACACGG
CATTCAGTCTGCAGGATCCATTTGCCCCTACCCAGCATTTAGTTTTAAATCTTTTAGATGCTTGGAGAGTTCCCTTAAAAGTGTCTGCAG
AGTTGTTGATGAGTATAAGACTACCTCCCAAACTGAAACAGAATGAAGTAGCTAATGTCCAGCCTTCTTCCAAAAGAGCCAGAATTGAAG
ACGTACCACCTCCCACTAAAAAGCTAACTCCAGAATTGACCCCTTTTGTGCTTTTCACTGGATTCGAGCCTGTCCAGGTTCAACAGTATA
TTAAGAAGCTCTACATTCTTGGTGGAGAGGTTGCGGAGTCTGCACAGAAGTGCACACACCTCATTGCCAGCAAAGTGACTCGCACCGTGA
AGTTCCTGACGGCGATTTCTGTCGTGAAGCACATAGTGACGCCAGAGTGGCTGGAAGAATGCTTCAGGTGTCAGAAGTTCATTGATGAGC
AGAACTACATTCTCCGAGATGCTGAGGCAGAAGTACTTTTCTCTTTCAGCTTGGAAGAATCCTTAAAACGGGCACACGTTTCTCCACTCT
TTAAGGCAAAATATTTTTACATCACACCTGGAATCTGCCCAAGTCTTTCCACTATGAAGGCAATCGTAGAGTGTGCAGGAGGAAAGGTGT
TATCCAAGCAGCCATCTTTCCGGAAGCTCATGGAGCACAAGCAGAACTCGAGTTTGTCGGAAATAATTTTAATATCCTGTGAAAATGACC
TTCATTTATGCCGAGAATATTTTGCCAGAGGCATAGATGTTCACAATGCAGAGTTCGTTCTGACTGGAGTGCTCACTCAAACGCTGGACT
ATGAATCATATAAGTTTAACTGATGGCGTCTAGGCTGCCGTGCATGTCGACTCCTGCGGTGCGGGGCTGGCTGTCTGGCTGGCGAGGAGC
TGCTGCGCTTCCTTCACATGCTCTTGTTTTCCAGCTGCTTTCCTGGGGGATCAGACTGTGAAGCAGGAAGACAGATATAATAAATATACT
GCATCTTTTTAAGATGTGCAATTTTATTCTGAGGAAACATAAATTATGTTTTGTATTATATGACTTTAAGAGCCCACATTAGGTTTTATG
ATTCATTTGCCAGGTTTTTAAATGTTTTCACAAAACTGTTACGGGACTTCAACTAGAAATAAAATGGTGTAAATAAAGACCTTGCTATCT
CTAAATTATGGATGTTAAAGATTTGAAATGTTTTGTACTTTGATTATTTTTATTTCTTATACTCTGTTTTCTTTTATATTGATATCTTGC


Top

FusionGenePPI for MBP_PAXIP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MBPTRPM7, PRMT5, STK39, HLA-DRA, PLP1, TSSK6, IRAK4, PRKCA, PRKCI, PRKCZ, PPP2R5C, LIMK1, LIMK2, TBK1, IKBKE, STK3, APTX, ATN1, ATXN1, MAPK14, LRRK2, PRKDC, MAPK12, MAPK11, MAPK13, MAPK3, MAPK1, CDK1, CDK5, MAP3K5, TLK1, RPS6KA6, DDX58, MELK, CDK7, CDK8, CDK9, HIPK2, SQSTM1, PKN1, ULK1, PRKCB, MAP3K3, CTDSP1, ABL1, MUS81, RPS6KA5, MYH6, MAP3K1, MAPK8, CTDSPL, NLN, IDE, PTPRA, PRKCDPAXIP1ZBTB8A, TP53BP1, PAX2, KDM6A, PAGR1, NCOA6, SRRM1, KMT2D, KMT2C, SMC1A, SMC3, RAD50, ASH2L, RBBP5, PRMT5, WDR5, HIST1H3A, KMT2B, BLM, MRE11A, DPY30, NBN, KDM1B, WDR82, EP300, ELAVL1, H2AFX, A2M, ECSIT, MAST1, APP, NOS3, RNF32, TCN2, SH3GL2, UMPS, CLU, EPB41L3, PCYT1B, RPS27A, SCAMP5, TECR, NOP14, ATP1B1, ATP1B3, FUCA1, DNAJA1, LDHA, LGALS3, MT2A, ND1, PCBP2, PER1, PGM1, PLCD1, PPIA, PPP2R5C, PSMA6, RPA1, RPL12, RPS20, SRSF2, SPAG4, TADA2A, PKP4, PIAS1, EIF3I, SNX3, PIAS2, XAGE1E, MRPL33, PRDX6, EIF5B, FBLN5, NPC2, CCT6B, SUGT1, KIF2C, SOX30, HSPA4L, TRAPPC8, SUZ12, CCNDBP1, INTS7, CABYR, SCCPDH, CYB5R4, HSPA14, PPHLN1, FAM96B, DNAJB11, C2orf42, DCP1A, CBX8, WDR48, CATSPERG, DYNC2H1, ATHL1, TM2D3, FAHD1, TMEM120A, BTBD6, ZNF251, HNRNPLL, LACTB, DIS3L, BTBD16, COMTD1, SPATA18, ZNF280B, MTIF3, CRIPAK, SELV, LOC653602, AAMP, CAPZA1, CAPZB, CDC5L, CDC20, CDC27, CDK9, CIRBP, CLTC, CSNK2A1, CSNK2B, DKC1, EMD, ERF, ERH, FEN1, XRCC6, GCLC, LDHB, MCM6, MYO1D, PPP1R12A, DRG1, NME4, NOP2, YBX1, PPP1CC, PPP2CA, PRPSAP1, RBBP7, RFC2, RFC4, S100A8, SRSF1, SRSF4, SRSF5, SRSF7, TRA2B, SLC1A5, SNRNP70, SNRPD3, SRP9, SRPK1, SSB, STAU1, STRN, TMPO, TPM3, WEE1, YBX3, EIF3H, SRSF9, CDC23, CCNK, CDC16, DDX18, EIF2S2, H1FX, GTF3C5, DDX23, MAP4K4, BRE, MDC1, BCLAF1, NCAPD2, THRAP3, G3BP1, ALYREF, GNB2L1, CD2BP2, PPIH, SMC2, MYL12A, MGEA5, SRSF10, EBNA1BP2, MAPRE2, DDX52, KRR1, WDHD1, STRAP, COPE, PHB2, RAB3GAP1, PDCD11, NCAPD3, U2SURP, LARP1, TARDBP, SRRM2, RAB3GAP2, MOB4, DCAF13, GPKOW, BABAM1, STRN4, TRA2A, ANAPC4, STOML2, HP1BP3, NOL7, ANAPC5, ANAPC7, LIMA1, C9orf114, LARP7, LUC7L2, CPSF3, UIMC1, CDK12, PHAX, PELO, GPATCH4, RNMTL1, LYAR, PRPF40A, CCDC88A, WDR18, RBM25, AASDHPPT, NCAPG, POLR1E, NOM1, ANAPC1, KRI1, BRCC3, CENPU, FAM175A, C7orf50, ZNF622, RLTPR, NOP9, PGAM5, SKA3, SMAD2, PPARG, POM121, NXT1, MED23, XPO1, CCNB2, NANOG, POU5F1, CCDC97, MTNR1A, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-02194_183271070PAGR1
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-02194_183271070PAGR1
TgenePAXIP1chr18:74728786chr7:154790496ENST00000397192-021590_1069271070TP53BP1
TgenePAXIP1chr18:74728786chr7:154790496ENST00000404141-021590_1069271070TP53BP1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MBP_PAXIP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MBP_PAXIP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMBPC0036341Schizophrenia4PSYGENET
HgeneMBPC0014072Experimental Autoimmune Encephalomyelitis3CTD_human
HgeneMBPC0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneMBPC0011303Demyelinating Diseases1CTD_human
HgeneMBPC0027873Neuromyelitis Optica1CTD_human