FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21235

FusionGeneSummary for MBP_OSBPL1A

check button Fusion gene summary
Fusion gene informationFusion gene name: MBP_OSBPL1A
Fusion gene ID: 21235
HgeneTgene
Gene symbol

MBP

OSBPL1A

Gene ID

5553

114876

Gene nameproteoglycan 2, pro eosinophil major basic proteinoxysterol binding protein like 1A
SynonymsBMPG|MBP|MBP1|proMBPORP-1|ORP1|OSBPL1B
Cytomap

11q12.1

18q11.2

Type of geneprotein-codingprotein-coding
Descriptionbone marrow proteoglycaneosinophil granule major basic proteineosinophil major basic proteinnatural killer cell activatorproteoglycan 2 preproproteinproteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)oxysterol-binding protein-related protein 1OSBP-related protein 1oxysterol binding protein-like 1Boxysterol-binding protein-related protein 1 variant 1oxysterol-binding protein-related protein 1 variant 2
Modification date2018051920180523
UniProtAcc

P02686

Q9BXW6

Ensembl transtripts involved in fusion geneENST00000382582, ENST00000355994, 
ENST00000397875, ENST00000397866, 
ENST00000397865, ENST00000527041, 
ENST00000359645, ENST00000528160, 
ENST00000397869, ENST00000354542, 
ENST00000526111, ENST00000580402, 
ENST00000579129, ENST00000578193, 
ENST00000397863, ENST00000397860, 
ENST00000487778, 
ENST00000319481, 
ENST00000399443, ENST00000357041, 
ENST00000399441, ENST00000582618, 
Fusion gene scores* DoF score13 X 13 X 3=50711 X 9 X 9=891
# samples 1512
** MAII scorelog2(15/507*10)=-1.75702324650746
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/891*10)=-2.8923910259134
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MBP [Title/Abstract] AND OSBPL1A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DA198061MBPchr18

74728783

-OSBPL1Achr18

21819348

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000382582ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000382582ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000382582ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000382582ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000382582ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
Frame-shitENST00000355994ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000355994ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000355994ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000355994ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000355994ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000397875ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397875ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397875ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397875ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397875ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000397866ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397866ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397866ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397866ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397866ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000397865ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397865ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397865ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397865ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397865ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000527041ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000527041ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000527041ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000527041ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000527041ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000359645ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000359645ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000359645ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000359645ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000359645ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-3CDSENST00000528160ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000528160ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000528160ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000528160ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000528160ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000397869ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397869ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000397869ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397869ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000397869ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000354542ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000354542ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000354542ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000354542ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000354542ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000526111ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000526111ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000526111ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000526111ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000526111ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000580402ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000580402ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000580402ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000580402ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000580402ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
Frame-shitENST00000579129ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000579129ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000579129ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000579129ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000579129ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
In-frameENST00000578193ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000578193ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-5UTRENST00000578193ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000578193ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
5CDS-intronENST00000578193ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-3CDSENST00000397863ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000397863ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000397863ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000397863ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000397863ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-3CDSENST00000397860ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000397860ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000397860ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000397860ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000397860ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-3CDSENST00000487778ENST00000319481MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000487778ENST00000399443MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-5UTRENST00000487778ENST00000357041MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000487778ENST00000399441MBPchr18

74728783

-OSBPL1Achr18

21819348

-
intron-intronENST00000487778ENST00000582618MBPchr18

74728783

-OSBPL1Achr18

21819348

-

Top

FusionProtFeatures for MBP_OSBPL1A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MBP

P02686

OSBPL1A

Q9BXW6

Binds phospholipids; exhibits strong binding tophosphatidic acid and weak binding to phosphatidylinositol 3-phosphate (By similarity). Stabilizes GTP-bound RAB7A on lateendosomes/lysosomes and alters functional properties of lateendocytic compartments via its interaction with RAB7A(PubMed:16176980). Binds 25-hydroxycholesterol and cholesterol(PubMed:17428193). {ECO:0000250, ECO:0000269|PubMed:16176980,ECO:0000269|PubMed:17428193}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-1428430_463427951Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-1428877_913427951Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-216430_46345569Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-216877_91345569Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-014430_463-86438Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-014877_913-86438Coiled coilOntology_term=ECO:0000255
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-216235_33445569DomainPH
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-014235_334-86438DomainPH
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-216175_20445569RepeatNote=ANK 3
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-21647_7645569RepeatNote=ANK 1
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-21680_10945569RepeatNote=ANK 2
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-014175_204-86438RepeatNote=ANK 3
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-01447_76-86438RepeatNote=ANK 1
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-01480_109-86438RepeatNote=ANK 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBPchr18:74728783chr18:21819348ENST00000355994-49179_222192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000355994-49246_256192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000359645-16179_22259187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000359645-16246_25659187RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000382582-17179_22259198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000382582-17246_25659198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000397860-14179_222-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000397860-14246_256-72198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000397863-14179_222-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000397863-14246_256-57198RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000397865-15179_22259161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000397865-15246_25659161RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000397866-16179_22259172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000397866-16246_25659172RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
HgeneMBPchr18:74728783chr18:21819348ENST00000580402-38179_222192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 1
HgeneMBPchr18:74728783chr18:21819348ENST00000580402-38246_256192305RegionNote=Induces experimental autoimmune encephalomyelitis (EAE) 2
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-1428235_334427951DomainPH
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-1428175_204427951RepeatNote=ANK 3
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-142847_76427951RepeatNote=ANK 1
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-142880_109427951RepeatNote=ANK 2


Top

FusionGeneSequence for MBP_OSBPL1A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MBP_ENST00000382582_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000397875_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000397866_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000397865_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000527041_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000359645_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000397869_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000354542_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS

>In-frame_MBP_ENST00000526111_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_524aa
VRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEE
KDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVA
AFAVSAVASQWERTGKPFNPLLGETTELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELL
EHNEATTWTNPTCCVHNIIVGKLWIEQTGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATF
DAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPD

>In-frame_MBP_ENST00000580402_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_524aa
VRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEE
KDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVA
AFAVSAVASQWERTGKPFNPLLGETTELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELL
EHNEATTWTNPTCCVHNIIVGKLWIEQTGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATF
DAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPD

>In-frame_MBP_ENST00000578193_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_583aa
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVRNFKLEQEQEKNKILSEALETLATEHHELE
QSLVKGSPPASILSEDEFTDALSDSESERSLSRLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFS
IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETTELVRD
DLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSITPKLKFWGKSVEAEPKGTITLELLEHNEATTWTNPTCCVHNIIVGKLWIEQTGNV
EIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALTGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPV
PDSESVFIIPGSVLLWRIAPRPPNSAQMTNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MBP_ENST00000382582_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000397875_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000397866_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000397865_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000527041_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000359645_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000397869_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000354542_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC

>In-frame_MBP_ENST00000526111_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1572nt
GTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTA
GAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGG
TCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAA
AAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTC
AGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTA
CAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCT
GCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGA
GATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTC
ATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTT
GAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAAT
GTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAA
GGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTT
GACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCA
GTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTAT
AATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGAC
ATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGG
TCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGC

>In-frame_MBP_ENST00000580402_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1572nt
GTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTA
GAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGG
TCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAA
AAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTC
AGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTA
CAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCT
GCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGA
GATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTC
ATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTT
GAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAAT
GTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAA
GGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTT
GACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCA
GTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTAT
AATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGAC
ATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGG
TCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGC

>In-frame_MBP_ENST00000578193_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_1749nt
ATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTC
CCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTG
AGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAG
CAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCC
CTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAA
GACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGT
ATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAG
CGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCG
TTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGAT
GACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATC
TTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAA
CACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTG
GAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGC
TACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGAC
GCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTG
CCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAAT
TTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATC
AGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCC
AAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MBP_ENST00000382582_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2971nt
AACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATG
GCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCA
AGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGG
AATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAG
TCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTG
AGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGAC
TGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATC
TGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGC
CTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTT
GCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGAC
CTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTT
CATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACAC
AATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAA
ATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTAC
ATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCT
TACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCG
GATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTT
ACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGA
GCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAG
TCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGG
GACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATG
TTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAA
AGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTAT
ATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAG
CTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACA
TATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTAT
TCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAA
TTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGG
TTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAA
TGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAA
GGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATT
GGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCC
GTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAATGAAATAATCTACCTGATGCTAAATAAAGGCTTTAGAATGTTCCCCAAAA

>In-frame_MBP_ENST00000397875_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2931nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCT
TGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCG
AGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGG
AAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAAC
ACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCA
AGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGG
CCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAA
AACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACC
CACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGA
GTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGC
ATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATT
TTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATG
GGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGA
ACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTC
TATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACA
TGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAA
AAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTC
CTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATG
CATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAA
AAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGA
AAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTAT
GGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTT
GAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGAT
ATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAA
GAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAG
TGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAG
CAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAAT
GCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTA
CTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCC
AAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAA

>In-frame_MBP_ENST00000397866_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2938nt
GAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGA
TCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATC
GGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAAC
AAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATC
CTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTT
GAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATC
AAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAA
CTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATC
CACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGG
ACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGC
CATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGG
GGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGC
TGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTG
TTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCC
CTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAG
AAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGC
GTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGAC
AAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGT
GAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCAT
CAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTAT
TAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTAT
CTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGT
CTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGC
TTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAG
TTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATT
CTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCAT
CTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATT
TACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAA
AATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGT
GGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTAC
CTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTA
TCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGT

>In-frame_MBP_ENST00000397865_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2962nt
AAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAG
AAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGA
GACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAA
TTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTG
AAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTG
GAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGC
GGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATC
CTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAA
TACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCT
GCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTT
AGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCT
ATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCA
TATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAAC
CACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGAT
AAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAA
AATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAA
AGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTT
GCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAA
AATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAG
GACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAAT
TACTTCAATTTGCCTGACATTTATTAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAAT
TTTTTTCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTA
TAAGGCGATATTGGTGATGAAAGTCTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTA
AGAGAACACTGCTGGGGAATATGCTTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGA
ACTATATAGTAATCCCAAATCAAGTTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAA
CTCTCCTCCTATACAATGTTTATTCTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAA
TCCTCCCAATGTTACCCCTTCCATCTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGA
ATTAAACTGGAAAAGTATTTCATTTACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTA
CATTTGAACTGAAAATATGTATAAAATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACC
TTGTTAAATGCTTCCACTTCCAGTGGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTT
GTGCATTTCAAGTTTGCAAAGTACCTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACAT
TCATCTTAAATCTTATAGTATTTATCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTA

>In-frame_MBP_ENST00000527041_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2941nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
GGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCC
ATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAA
AACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGC
ATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCC
TTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGC
ATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATG
GAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTC
ATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAA
CGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTC
AGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTC
TGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACC
TGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGT
GTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGT
GCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAA
GAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGA
AGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTA
GACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCT
AGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTC
CATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATT
TATTAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACT
TATCTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAA
AGTCTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATA
TGCTTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATC
AAGTTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTT
ATTCTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTC
CATCTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTC
ATTTACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTA
TAAAATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCC
AGTGGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAG
TACCTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTAT
TTATCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACA

>In-frame_MBP_ENST00000359645_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2918nt
AGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGC
AAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGA
CAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACT
GGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTA
TGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTT
GGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTT
GCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCC
AGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTC
TGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCC
ACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGC
ATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGA
ACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGT
GGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGG
CCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGA
ATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGAT
GAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGC
CCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGAT
TCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGA
GGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAA
TGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATGCATACAAGTCAGG
GTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAAATGAA
AAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGAAAAATGCATAATT
TTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTATGGTTGCTGTTGCC
ATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTTGAATATTTTTATG
CTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGATATAGAGGTTATGT
CATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAAGAAGAAAAAAAAT
GCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAGTGCTCTGAATTTA
CTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAGCAATTCACAAAAA
TGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAATGCCACTAGGGAAA
GTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTACTTAAAATATGTG
TGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCCAAACCCCAGACTG
AGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAATGAAATAATCTAC

>In-frame_MBP_ENST00000397869_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2931nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCT
TGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCG
AGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGG
AAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAAC
ACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCA
AGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGG
CCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAA
AACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACC
CACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGA
GTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGC
ATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATT
TTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATG
GGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGA
ACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTC
TATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACA
TGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAA
AAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTC
CTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATG
CATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAA
AAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGA
AAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTAT
GGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTT
GAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGAT
ATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAA
GAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAG
TGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAG
CAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAAT
GCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTA
CTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCC
AAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAA

>In-frame_MBP_ENST00000354542_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_3137nt
AGATGCGAACCAGAACAATGGGACCTCCTCTCAGGACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGA
TGCCCACCCAGCTGACCCAGGGAGCCGCCCCCACTTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGA
CAGGCCCTCTGAGTCCGACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAG
ACCCTCCCAGAGGCACGGATCCAAGTACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACAC
GGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGA
ACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGG
CTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGC
AGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGA
TGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAG
AAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACAT
GGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGT
TGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACT
CATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTA
TCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATAC
ATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAA
GACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAG
CAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGA
TAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGT
ATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAAT
GGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGG
AGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTG
GAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTT
CAATTTGCCTGACATTTATTAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTT
TCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGG
CGATATTGGTGATGAAAGTCTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGA
ACACTGCTGGGGAATATGCTTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTAT
ATAGTAATCCCAAATCAAGTTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTC
CTCCTATACAATGTTTATTCTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTC
CCAATGTTACCCCTTCCATCTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAA
ACTGGAAAAGTATTTCATTTACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTT
GAACTGAAAATATGTATAAAATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTT
AAATGCTTCCACTTCCAGTGGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCA
TTTCAAGTTTGCAAAGTACCTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATC
TTAAATCTTATAGTATTTATCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGC

>In-frame_MBP_ENST00000526111_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2875nt
GACGAGCTCCAGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCAC
AGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTT
AAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTG
GTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGA
TTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGT
GGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGC
ATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACT
GAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTA
TCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGA
TTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGC
TCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAG
GCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATA
AACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAA
GATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAA
AAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCT
GAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGT
TTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATG
GAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAA
GAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGA
AATTACTTCAATTTGCCTGACATTTATTAAAATGCATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTA
AATTTTTTTCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGG
GTATAAGGCGATATTGGTGATGAAAGTCTTAGGAAAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAG
GTAAGAGAACACTGCTGGGGAATATGCTTTTTATGGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTAT
GGAACTATATAGTAATCCCAAATCAAGTTATTTTGAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTA
GAACTCTCCTCCTATACAATGTTTATTCTCAGATATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATAC
TAATCCTCCCAATGTTACCCCTTCCATCTTCCAAGAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAA
AGAATTAAACTGGAAAAGTATTTCATTTACTTAGTGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGT
TTACATTTGAACTGAAAATATGTATAAAATCTAGCAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAA
ACCTTGTTAAATGCTTCCACTTCCAGTGGCAAATGCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGC
CTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTACTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCA
CATTCATCTTAAATCTTATAGTATTTATCCACCCAAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATT

>In-frame_MBP_ENST00000580402_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_3283nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGAATAGTGAAACTAACAGAGGAGAATCTGAAAAAAAGAGA
AACCTGGGTGAACTTTCACGGACAACCTCAGAGGACAACGAAGTGTTCGGAGAGGCAGATGCGAACCAGAACAATGGGACCTCCTCTCAG
GACACAGCGGTGACTGACTCCAAGCGCACAGCGGACCCGAAGAATGCCTGGCAGGATGCCCACCCAGCTGACCCAGGGAGCCGCCCCCAC
TTGATCCGCCTCTTTTCCCGAGATGCCCCGGGGAGGGAGGACAACACCTTCAAAGACAGGCCCTCTGAGTCCGACGAGCTCCAGACCATC
CAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGTACCTGGCC
ACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTGGC
GGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCTTGTCAGAA
GCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCGAGGACGAG
TTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGGAAGGAGAG
CATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAACACAGAACA
AGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCAAGATCACG
ATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGGCCAGTTCA
CTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAAAACCTTTC
AACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACCCACCAATC
AGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGAGTGTAGAA
GCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGCATAATATC
ATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATTTTAAGCCA
TGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATGGGAAGTGG
ACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGAACAGCAAA
CAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTCTATGGCGA
ATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACATGGAGAGT
GTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAAAAAAACGA
CTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTCCTAATCCC
TACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATGCATACAAG
TCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAAAAAAAAAA
ATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGAAAAATGCA
TAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTATGGTTGCTG
TTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTTGAATATTT
TTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGATATAGAGGT
TATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAAGAAGAAAA
AAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAGTGCTCTGA
ATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAGCAATTCAC
AAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAATGCCACTAG
GGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTACTTAAAAT
ATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCCAAACCCCA
GACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAATGAAATAA

>In-frame_MBP_ENST00000578193_chr18_74728783_-_OSBPL1A_ENST00000319481_chr18_21819348_-_2931nt
AGACCATCCAAGAAGACAGTGCAGCCACCTCCGAGAGCCTGGATGTGATGGCGTCACAGAAGAGACCCTCCCAGAGGCACGGATCCAAGT
ACCTGGCCACAGCAAGTACCATGGACCATGCCAGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCT
TCTTTGGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGTGAGGAATTTTAAATTGGAACAAGAGCAAGAAAAAAACAAAATCT
TGTCAGAAGCACTGGAGACGCTGGCCACTGAACATCATGAATTAGAGCAGTCTCTGGTGAAAGGCTCTCCACCCGCCAGCATCCTTAGCG
AGGACGAGTTCTATGATGCGCTGTCAGATTCCGAGTCCGAAAGGTCCCTGAGTAGATTGGAAGCAGTGACAGCACGCTCCTTTGAAGAGG
AAGGAGAGCATTTGGGCAGTAGAAAACACAGAATGTCCGAAGAAAAAGACTGTGGTGGCGGAGATGCTCTCTCCAATGGCATCAAGAAAC
ACAGAACAAGTTTGCCTTCTCCTATGTTTTCCAGAAATGACTTCAGTATCTGGAGCATCCTCAGAAAATGTATTGGAATGGAACTATCCA
AGATCACGATGCCAGTTATATTTAATGAGCCTCTGAGCTTCCTACAGCGCCTAACTGAATACATGGAGCATACTTACCTCATCCACAAGG
CCAGTTCACTCTCTGATCCTGTGGAAAGGATGCAGTGTGTAGCTGCGTTTGCTGTATCTGCTGTTGCTTCTCAGTGGGAACGGACTGGAA
AACCTTTCAACCCACTGCTGGGAGAGACTTATGAATTAGTGCGAGATGACCTTGGATTTAGACTCATCTCCGAACAGGTCAGCCATCACC
CACCAATCAGTGCATTTCATGCTGAAGGATTAAACAATGACTTCATCTTTCATGGCTCTATCTATCCCAAACTGAAATTCTGGGGGAAGA
GTGTAGAAGCAGAACCCAAAGGAACCATCACCTTGGAGCTCCTTGAACACAATGAGGCATATACATGGACAAATCCCACCTGCTGTGTGC
ATAATATCATTGTGGGTAAACTGTGGATCGAACAGTATGGCAATGTGGAAATTATAAACCACAAGACTGGGGACAAATGTGTGTTGAATT
TTAAGCCATGTGGCCTTTTTGGTAAGGAATTACACAAAGTTGAAGGCTACATTCAAGATAAAAGCAAAAAGAAGCTCTGTGCCCTCTATG
GGAAGTGGACTGAATGTTTATACAGTGTTGACCCTGCCACGTTTGACGCTTACAAAAAAAATGATAAGAAAAATACAGAAGAGAAGAAGA
ACAGCAAACAGATGAGCACCTCTGAGGAGTTGGATGAAATGCCAGTGCCGGATTCTGAAAGTGTATTCATTATCCCTGGAAGCGTTCTTC
TATGGCGAATAGCCCCACGGCCTCCAAATTCTGCCCAGATGTATAATTTTACTAGTTTTGCAATGGTTTTGAATGAAGTAGACAAAGACA
TGGAGAGTGTGATTCCCAAGACAGACTGCAGGTTACGGCCTGACATCAGAGCCATGGAAAATGGAGAGATAGATCAAGCTAGTGAAGAAA
AAAAACGACTTGAGGAAAAACAAAGAGCAGCCCGCAAAAACAGGTCCAAGTCAGAAGAGGACTGGAAGACGAGGTGGTTCCATCAAGGTC
CTAATCCCTACAATGGAGCACAGGACTGGATTTACTCTGGCAGCTACTGGGACAGAAATTACTTCAATTTGCCTGACATTTATTAAAATG
CATACAAGTCAGGGTGTTTGGCTAATCTACAAATAAGTCTTAAACCTATGTTTTTAAATTTTTTTCCCTTGGTTTCTACTTATCTTTTAA
AAAAAAAAATGAAAAAACACTCATGAGATAACTGCATTTCACCCAACAAAAGCAGGGTATAAGGCGATATTGGTGATGAAAGTCTTAGGA
AAAATGCATAATTTTGCTATAAAATGTACTTATTTGGAATACTATTTTATATAGAGGTAAGAGAACACTGCTGGGGAATATGCTTTTTAT
GGTTGCTGTTGCCATATTTACTGAAGGTTTATACCTAAATGTAACTTTAGCTTTATGGAACTATATAGTAATCCCAAATCAAGTTATTTT
GAATATTTTTATGCTGTCATGCTTGAATGTTTTAGATGTAACCTTTGACATATTTAGAACTCTCCTCCTATACAATGTTTATTCTCAGAT
ATAGAGGTTATGTCATTTTATAAAGACTTCATTGATAAGATGGCTTTTATTCATACTAATCCTCCCAATGTTACCCCTTCCATCTTCCAA
GAAGAAAAAAAATGCCTGAATATTCAGAATAGATATTTCTGATTTGAAAATTCTAAAGAATTAAACTGGAAAAGTATTTCATTTACTTAG
TGCTCTGAATTTACTTTTACAGTTTTCTGCAGTCAGTATCATTAAAATGGTTAAGTTTACATTTGAACTGAAAATATGTATAAAATCTAG
CAATTCACAAAAATGCCCTAGAAATATAGATTTTAATCACCATTACATAATGACAAACCTTGTTAAATGCTTCCACTTCCAGTGGCAAAT
GCCACTAGGGAAAGTAAGTTGCACTCATGTAAGTATCAAACTATATAAAAGGAGGCCTTGTGCATTTCAAGTTTGCAAAGTACCTGTGTA
CTTAAAATATGTGTGGAGACCTACTGTACAGTAGTTTTGCCCCTTTAATTGGGGCACATTCATCTTAAATCTTATAGTATTTATCCACCC
AAACCCCAGACTGAGATACTGCTCCCAGGGGCCTAGGTAGCTGCCAGTCCGTGATTTTAATTGCTGTCTTGAAGTTAACAAGTGTTATAA


Top

FusionGenePPI for MBP_OSBPL1A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MBPTRPM7, PRMT5, STK39, HLA-DRA, PLP1, TSSK6, IRAK4, PRKCA, PRKCI, PRKCZ, PPP2R5C, LIMK1, LIMK2, TBK1, IKBKE, STK3, APTX, ATN1, ATXN1, MAPK14, LRRK2, PRKDC, MAPK12, MAPK11, MAPK13, MAPK3, MAPK1, CDK1, CDK5, MAP3K5, TLK1, RPS6KA6, DDX58, MELK, CDK7, CDK8, CDK9, HIPK2, SQSTM1, PKN1, ULK1, PRKCB, MAP3K3, CTDSP1, ABL1, MUS81, RPS6KA5, MYH6, MAP3K1, MAPK8, CTDSPL, NLN, IDE, PTPRA, PRKCDOSBPL1ABCL6, NPM1, BIN3, HEXIM1, C9orf41, VAPB, POLG2, KIFAP3, TSC22D2, VAPA, HIF1AN, DMD, CTNNA3, ZNF331, BSPRY, PRPF31, TRIM25, BAALC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000399443-0141_237-86438RAB7A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000319481-14281_237427951RAB7A
TgeneOSBPL1Achr18:74728783chr18:21819348ENST00000357041-2161_23745569RAB7A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MBP_OSBPL1A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MBP_OSBPL1A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMBPC0036341Schizophrenia4PSYGENET
HgeneMBPC0014072Experimental Autoimmune Encephalomyelitis3CTD_human
HgeneMBPC0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneMBPC0011303Demyelinating Diseases1CTD_human
HgeneMBPC0027873Neuromyelitis Optica1CTD_human