FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21210

FusionGeneSummary for MBOAT1_DCDC2

check button Fusion gene summary
Fusion gene informationFusion gene name: MBOAT1_DCDC2
Fusion gene ID: 21210
HgeneTgene
Gene symbol

MBOAT1

DCDC2

Gene ID

154141

51473

Gene namemembrane bound O-acyltransferase domain containing 1doublecortin domain containing 2
SynonymsLPEAT1|LPLAT|LPLAT 1|LPSAT|OACT1|dJ434O11.1DCDC2A|DFNB66|NPHP19|NSC|RU2|RU2S
Cytomap

6p22.3

6p22.3

Type of geneprotein-codingprotein-coding
Descriptionlysophospholipid acyltransferase 11-acylglycerophosphoserine O-acyltransferaseO-acyltransferase (membrane bound) domain containing 1O-acyltransferase domain-containing protein 1lyso-PS acyltransferaselysophosphatidylethanolamine acyltransferase 1lysdoublecortin domain-containing protein 2
Modification date2018051920180523
UniProtAcc

Q6ZNC8

Q9UHG0

Ensembl transtripts involved in fusion geneENST00000541730, ENST00000324607, 
ENST00000536798, 
ENST00000378454, 
ENST00000378450, 
Fusion gene scores* DoF score8 X 5 X 6=2409 X 5 X 8=360
# samples 811
** MAII scorelog2(8/240*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/360*10)=-1.71049338280502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MBOAT1 [Title/Abstract] AND DCDC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-GV-A3QH-01AMBOAT1chr6

20126748

-DCDC2chr6

24302272

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000541730ENST00000378454MBOAT1chr6

20126748

-DCDC2chr6

24302272

-
5CDS-intronENST00000541730ENST00000378450MBOAT1chr6

20126748

-DCDC2chr6

24302272

-
In-frameENST00000324607ENST00000378454MBOAT1chr6

20126748

-DCDC2chr6

24302272

-
5CDS-intronENST00000324607ENST00000378450MBOAT1chr6

20126748

-DCDC2chr6

24302272

-
In-frameENST00000536798ENST00000378454MBOAT1chr6

20126748

-DCDC2chr6

24302272

-
5CDS-intronENST00000536798ENST00000378450MBOAT1chr6

20126748

-DCDC2chr6

24302272

-

Top

FusionProtFeatures for MBOAT1_DCDC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MBOAT1

Q6ZNC8

DCDC2

Q9UHG0

Acyltransferase which mediates the conversion oflysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Prefers oleoyl-CoA asthe acyl donor. Lysophospholipid acyltransferases (LPLATs)catalyze the reacylation step of the phospholipid remodelingpathway also known as the Lands cycle.{ECO:0000269|PubMed:18772128}. Protein that plays a role in the inhibition of canonicalWnt signaling pathway (PubMed:25557784). May be involved inneuronal migration during development of the cerebral neocortex(By similarity). Involved in the control of ciliogenesis andciliary length (PubMed:25601850, PubMed:27319779).{ECO:0000250|UniProtKB:D3ZR10, ECO:0000269|PubMed:25557784,ECO:0000269|PubMed:25601850, ECO:0000269|PubMed:27319779}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713126_146238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713180_200238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-71334_54238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-71370_90238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78126_146238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78180_200238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-7834_54238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-7870_90238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-61234_5489347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-61270_9089347TransmembraneHelical
TgeneDCDC2chr6:20126748chr6:24302272ENST00000378450-03139_221-7230DomainDoublecortin 2
TgeneDCDC2chr6:20126748chr6:24302272ENST00000378450-0317_100-7230DomainDoublecortin 1
TgeneDCDC2chr6:20126748chr6:24302272ENST00000378454-110139_221116477DomainDoublecortin 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713238_258238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713297_317238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713371_391238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713426_446238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000324607-713450_470238496TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78238_258238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78297_317238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78371_391238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78426_446238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000536798-78450_470238242TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612126_14689347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612180_20089347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612238_25889347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612297_31789347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612371_39189347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612426_44689347TransmembraneHelical
HgeneMBOAT1chr6:20126748chr6:24302272ENST00000541730-612450_47089347TransmembraneHelical
TgeneDCDC2chr6:20126748chr6:24302272ENST00000378454-11017_100116477DomainDoublecortin 1


Top

FusionGeneSequence for MBOAT1_DCDC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MBOAT1_ENST00000541730_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_450aa
MEFSLRIFLGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTV
KPVIHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFY
VAVGRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKL
KNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQ
VEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVAX

>In-frame_MBOAT1_ENST00000324607_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_599aa
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVL
VLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKP
SFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTVKPVIHSRINVSARFRKPLQEPCTIFLIANGD
LINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKA
SSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQ
EDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQ

>In-frame_MBOAT1_ENST00000536798_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_599aa
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVL
VLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKP
SFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTVKPVIHSRINVSARFRKPLQEPCTIFLIANGD
LINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKA
SSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQ
EDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MBOAT1_ENST00000541730_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_1350nt
ATGGAATTCTCACTACGGATTTTTCTGGGATTAGGTCGAAGAGCTGAAGACCTTTCTGCTGAACAACATCGACTTGCTATCAAAGTGAAA
CCCTCTTTTTTGGAATACTTAAGTTACCTTCTCAATTTCATGAGTGTCATAGCTGGTCCTTGTAACAATTTCAAGGACTACATAGCCTTC
ATTGAGGGGAAGCATATACACATGAAGTTGCTGGAGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTTGCCAGAACCTTCTCCCACAGTA
AAACCAGTAATCCATAGCAGGATCAACGTGTCAGCTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCACTATCTTCTTGATTGCAAATGGA
GACCTCATAAACCCAGCTTCTCGCCTCCTTATCCCCAGAAAAACCTTGAATCAGTGGGATCATGTACTACAAATGGTCACAGAAAAAATC
ACTCTGAGGAGCGGGGCTGTTCACAGGCTTTATACTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGAGTTGGAGAATGGGCAGTTTTAT
GTGGCTGTTGGCAGAGATAAGTTTAAGAAACTGCCTTACAGTGAGTTACTTTTTGACAAGTCAACGATGAGAAGGCCTTTTGGTCAGAAA
GCTTCTTCACTACCTCCTATTGTAGGATCCAGAAAGTCTAAAGGGAGTGGAAATGATCGCCACTCTAAGTCAACAGTTGGATCCAGTGAC
AACTCATCTCCTCAGCCCCTGAAGAGGAAAGGGAAAAAAGAAGACGTGAATTCAGAAAAACTGACGAAATTGAAACAAAATGTAAAATTA
AAGAATTCACAAGAAACCATTCCAAATAGTGATGAAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGAAACACGGGGGGCAGCAGAAGTC
CAAGAAGATGAAGATACTCAGGTTGAGGTTCCAGTCGATCAGAGGCCAGCAGAAATAGTAGACGAGGAAGAAGATGGAGAGAAGGCAAAC
AAGGATGCAGAACAGAAAGAAGACTTTTCAGGAATGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGAGGCTACAGATGCCCCTGAGCAA
GTCGAGGAGATTCTGGATCACAGTGAGCAGCAGGCACGCCCTGCTCGTGTAAATGGAGGCACCGATGAGGAGAATGGTGAGGAGCTGCAG
CAGGTTAATAATGAGCTTCAACTGGTCCTAGACAAGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACAAGATGAGGCTGATGTAGACCCT
CAAAGACCACCAAGGCCAGAAGTAAAAATTACCAGTCCAGAAGAAAATGAAAACAACCAACAAAACAAGGACTATGCTGCCGTGGCTTAG

>In-frame_MBOAT1_ENST00000324607_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_1797nt
ATGGCAGCAGAGCCGCAGCCGTCCAGCCTTTCCTACCGCACCACGGGCTCCACCTACCTGCACCCGCTCAGCGAGCTCCTGGGCATCCCG
CTGGACCAGGTGAATTTTGTGGTATGCCAGCTTGTTGCTCTGTTTGCTGCTTTCTGGTTTCGCATCTACTTACGTCCTGGTACAACCAGC
TCTGATGTCCGGCATGCGGTTGCCACCATTTTTGGCATCTATTTTGTCATCTTTTGTTTCGGCTGGTACTCTGTGCATCTTTTTGTGCTG
GTGTTAATGTGCTATGCAATCATGGTCACTGCTAGTGTATCCAATATTCACAGATATTCCTTTTTTGTAGCAATGGGATATCTTACAATA
TGCCACATCAGCCGAATATACATCTTCCACTATGGAATTCTCACTACGGATTTTTCTGGGCCTCTGATGATTGTCACTCAGAAGATCACA
ACCTTGGCATTCCAGGTTCATGATGGATTAGGTCGAAGAGCTGAAGACCTTTCTGCTGAACAACATCGACTTGCTATCAAAGTGAAACCC
TCTTTTTTGGAATACTTAAGTTACCTTCTCAATTTCATGAGTGTCATAGCTGGTCCTTGTAACAATTTCAAGGACTACATAGCCTTCATT
GAGGGGAAGCATATACACATGAAGTTGCTGGAGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTTGCCAGAACCTTCTCCCACAGTAAAA
CCAGTAATCCATAGCAGGATCAACGTGTCAGCTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCACTATCTTCTTGATTGCAAATGGAGAC
CTCATAAACCCAGCTTCTCGCCTCCTTATCCCCAGAAAAACCTTGAATCAGTGGGATCATGTACTACAAATGGTCACAGAAAAAATCACT
CTGAGGAGCGGGGCTGTTCACAGGCTTTATACTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGAGTTGGAGAATGGGCAGTTTTATGTG
GCTGTTGGCAGAGATAAGTTTAAGAAACTGCCTTACAGTGAGTTACTTTTTGACAAGTCAACGATGAGAAGGCCTTTTGGTCAGAAAGCT
TCTTCACTACCTCCTATTGTAGGATCCAGAAAGTCTAAAGGGAGTGGAAATGATCGCCACTCTAAGTCAACAGTTGGATCCAGTGACAAC
TCATCTCCTCAGCCCCTGAAGAGGAAAGGGAAAAAAGAAGACGTGAATTCAGAAAAACTGACGAAATTGAAACAAAATGTAAAATTAAAG
AATTCACAAGAAACCATTCCAAATAGTGATGAAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGAAACACGGGGGGCAGCAGAAGTCCAA
GAAGATGAAGATACTCAGGTTGAGGTTCCAGTCGATCAGAGGCCAGCAGAAATAGTAGACGAGGAAGAAGATGGAGAGAAGGCAAACAAG
GATGCAGAACAGAAAGAAGACTTTTCAGGAATGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGAGGCTACAGATGCCCCTGAGCAAGTC
GAGGAGATTCTGGATCACAGTGAGCAGCAGGCACGCCCTGCTCGTGTAAATGGAGGCACCGATGAGGAGAATGGTGAGGAGCTGCAGCAG
GTTAATAATGAGCTTCAACTGGTCCTAGACAAGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACAAGATGAGGCTGATGTAGACCCTCAA

>In-frame_MBOAT1_ENST00000536798_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_1797nt
ATGGCAGCAGAGCCGCAGCCGTCCAGCCTTTCCTACCGCACCACGGGCTCCACCTACCTGCACCCGCTCAGCGAGCTCCTGGGCATCCCG
CTGGACCAGGTGAATTTTGTGGTATGCCAGCTTGTTGCTCTGTTTGCTGCTTTCTGGTTTCGCATCTACTTACGTCCTGGTACAACCAGC
TCTGATGTCCGGCATGCGGTTGCCACCATTTTTGGCATCTATTTTGTCATCTTTTGTTTCGGCTGGTACTCTGTGCATCTTTTTGTGCTG
GTGTTAATGTGCTATGCAATCATGGTCACTGCTAGTGTATCCAATATTCACAGATATTCCTTTTTTGTAGCAATGGGATATCTTACAATA
TGCCACATCAGCCGAATATACATCTTCCACTATGGAATTCTCACTACGGATTTTTCTGGGCCTCTGATGATTGTCACTCAGAAGATCACA
ACCTTGGCATTCCAGGTTCATGATGGATTAGGTCGAAGAGCTGAAGACCTTTCTGCTGAACAACATCGACTTGCTATCAAAGTGAAACCC
TCTTTTTTGGAATACTTAAGTTACCTTCTCAATTTCATGAGTGTCATAGCTGGTCCTTGTAACAATTTCAAGGACTACATAGCCTTCATT
GAGGGGAAGCATATACACATGAAGTTGCTGGAGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTTGCCAGAACCTTCTCCCACAGTAAAA
CCAGTAATCCATAGCAGGATCAACGTGTCAGCTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCACTATCTTCTTGATTGCAAATGGAGAC
CTCATAAACCCAGCTTCTCGCCTCCTTATCCCCAGAAAAACCTTGAATCAGTGGGATCATGTACTACAAATGGTCACAGAAAAAATCACT
CTGAGGAGCGGGGCTGTTCACAGGCTTTATACTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGAGTTGGAGAATGGGCAGTTTTATGTG
GCTGTTGGCAGAGATAAGTTTAAGAAACTGCCTTACAGTGAGTTACTTTTTGACAAGTCAACGATGAGAAGGCCTTTTGGTCAGAAAGCT
TCTTCACTACCTCCTATTGTAGGATCCAGAAAGTCTAAAGGGAGTGGAAATGATCGCCACTCTAAGTCAACAGTTGGATCCAGTGACAAC
TCATCTCCTCAGCCCCTGAAGAGGAAAGGGAAAAAAGAAGACGTGAATTCAGAAAAACTGACGAAATTGAAACAAAATGTAAAATTAAAG
AATTCACAAGAAACCATTCCAAATAGTGATGAAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGAAACACGGGGGGCAGCAGAAGTCCAA
GAAGATGAAGATACTCAGGTTGAGGTTCCAGTCGATCAGAGGCCAGCAGAAATAGTAGACGAGGAAGAAGATGGAGAGAAGGCAAACAAG
GATGCAGAACAGAAAGAAGACTTTTCAGGAATGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGAGGCTACAGATGCCCCTGAGCAAGTC
GAGGAGATTCTGGATCACAGTGAGCAGCAGGCACGCCCTGCTCGTGTAAATGGAGGCACCGATGAGGAGAATGGTGAGGAGCTGCAGCAG
GTTAATAATGAGCTTCAACTGGTCCTAGACAAGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACAAGATGAGGCTGATGTAGACCCTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MBOAT1_ENST00000541730_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_4920nt
AGCGCCAAAGCCAAGTTTGCGCCTCGAGAGTTTGCGCCTCGAGAGTTTGCGCCGGTTCGCATTCCCCGGCCTCCCGTTCGCTCCCCCGCG
AACCAGGCGGCCGTGCGCCTCTCGGGGCAACCACCCAAGAGCACCCGGGCGGGAGGACGCCGAGCAGGGGGTGTTGCGGGCTGGGACAGG
GGCAGCCACCTCCCGAAGATGCAGGATGGCAGCAGAGCCGCAGCCGTCCAGCCTTTCCTACCGCACCACGGGCTCCACCTACCTGCACCC
GCTCAGCGAGCTCCTGGGCATCCCGCTGGACCAGGTGAATTTTGTGGTATGCCAGCTTGTTGCTCTGTTTGCTGCTTTCTGGTTTCGCAT
CTACTTACGTCCTGGTACAACCAGCTCTGATGTCCGGCATGCGGTTGCCACCATTTTTGGCATCTATTTTGTCATCTTTTGTTTCGGCTG
GTACTCTGTGCATCTTTTTGTGCTGGTGTTAATGTGCTATGCAATCATGGTCACTGCTAGTGTATCCAATATTCACAGATATTCCTTTTT
TGTAGCAATGGGATATCTTACAATATGCCACATCAGCCGAATATACATCTTCCACTATGGAATTCTCACTACGGATTTTTCTGGGATTAG
GTCGAAGAGCTGAAGACCTTTCTGCTGAACAACATCGACTTGCTATCAAAGTGAAACCCTCTTTTTTGGAATACTTAAGTTACCTTCTCA
ATTTCATGAGTGTCATAGCTGGTCCTTGTAACAATTTCAAGGACTACATAGCCTTCATTGAGGGGAAGCATATACACATGAAGTTGCTGG
AGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTTGCCAGAACCTTCTCCCACAGTAAAACCAGTAATCCATAGCAGGATCAACGTGTCAG
CTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCACTATCTTCTTGATTGCAAATGGAGACCTCATAAACCCAGCTTCTCGCCTCCTTATCC
CCAGAAAAACCTTGAATCAGTGGGATCATGTACTACAAATGGTCACAGAAAAAATCACTCTGAGGAGCGGGGCTGTTCACAGGCTTTATA
CTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGAGTTGGAGAATGGGCAGTTTTATGTGGCTGTTGGCAGAGATAAGTTTAAGAAACTGC
CTTACAGTGAGTTACTTTTTGACAAGTCAACGATGAGAAGGCCTTTTGGTCAGAAAGCTTCTTCACTACCTCCTATTGTAGGATCCAGAA
AGTCTAAAGGGAGTGGAAATGATCGCCACTCTAAGTCAACAGTTGGATCCAGTGACAACTCATCTCCTCAGCCCCTGAAGAGGAAAGGGA
AAAAAGAAGACGTGAATTCAGAAAAACTGACGAAATTGAAACAAAATGTAAAATTAAAGAATTCACAAGAAACCATTCCAAATAGTGATG
AAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGAAACACGGGGGGCAGCAGAAGTCCAAGAAGATGAAGATACTCAGGTTGAGGTTCCAG
TCGATCAGAGGCCAGCAGAAATAGTAGACGAGGAAGAAGATGGAGAGAAGGCAAACAAGGATGCAGAACAGAAAGAAGACTTTTCAGGAA
TGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGAGGCTACAGATGCCCCTGAGCAAGTCGAGGAGATTCTGGATCACAGTGAGCAGCAGG
CACGCCCTGCTCGTGTAAATGGAGGCACCGATGAGGAGAATGGTGAGGAGCTGCAGCAGGTTAATAATGAGCTTCAACTGGTCCTAGACA
AGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACAAGATGAGGCTGATGTAGACCCTCAAAGACCACCAAGGCCAGAAGTAAAAATTACCA
GTCCAGAAGAAAATGAAAACAACCAACAAAACAAGGACTATGCTGCCGTGGCTTAGAACATTTTTAAAAAGAGAGTATATGGATCGCAAG
AAAAATGAAGGGTTATCATACTTGAAAGATAAGCACATAGTTATTGCTGAATATAATGTGACACTATGGTCGAATACTACCTACGAATTA
TAACATTAGAAGCCTAGTGGAAAGACCAGATAACTTTAAATGGCTACTAAAGGATAATTACTTACTTTTATTGCATGTGTTTTAAAAGTC
ATATAGAAATATTAAATAAGACGGACAGAGGAGAATTTGCACTGGAAGACAATTGCCACTTGTAAAGGATGAAAAATAGGATCACTCTTA
TTGTACGCTTTATTATAAGTTTAGAAGGCAGTTTATTCTAAATAATTTTTCTCTAGGAAGGCGTAGAATTTTAAAGAACTGGTAATAGGA
AAGCATGTACTATTTTCTTAAAGCAATAAACTCTTGAATGAACAGATTGCGATTTACTTTCAGACATAATTTGGAGATGGCAGTAGATCA
AAATGTGTCCATGACTTGTTAACATGCCTTTCTTTCTTCCTCCTTAGCCAAAATCCACCTTTGAACTACAAAGACAGAGCAAGGCGTTCA
TTTTGGTGGGAGGAAGCATTGGTTCAGAGTGTTAGTGACTAGTATCGCCATGCCGTCACTTAAATGCTTTCAGGCTTGCATGCTTGTGGC
TCCAATGGCGCACACTCAGGAAGGAATTGTAAAGGAGCACCCAGTTATATTATAAAGCCTGGATGTATGGTTTGCAGATAATGGAAATCC
TGTGGATTTTCACTGATCCAGTCTATCTTTACCAATAGTATCTCTCTCTTCTCCCTTATGTTATTAGAGAACCTGATATTGGCTATTCCA
AAGATTAAATTATTTTCAAATAGTTTTCAACAAAAATAAAAGTGTATTAGGAAGAAAAAAGTAGACTATATGAAGAGTTTGTGACTGCTC
AATTTAACTTGTTTTTTGCCTTATTTCTATTAAGACTGTTTTACTATGTTTTTGCCCTAGGGATATCAGCAAATATTTATTTTTCCTAGC
ATGATATAGTTAGAATTTCAAGCAGATTTCTTTGTAATTAGAAGGCATCTGATAGAAATTGTAAAACTTTAGAAGTTATTATAATGAAAC
CAATTCCTGAATCACAACTTCATGGACTGACTAAATTGATTTATAGTTGCCTTGTGAGGTATGTATGGGGAAAACATAAAAACATAATTA
AAACATAATTTCGTCCTTTTTATGAATTCTTAAGAGATGTTCTTCCATAAATATAGAAATAATATATTTTTCTTAAAGGATATATTTTTA
ATTATGTGGAAGTTGTAAGCTTGAAATTTTAACTTCTAGTGCTTTTCTAAAATTCACAATTACAAGTTTAAAACATTTTTTCTCTTCCAG
GTTTCATTTGGAATAAAGAGTTGGCAGTTATATAAAGCACTTAATAATACTATAGAAAATAGATGTGTTTTTTCTTAATATGATTTTGGT
ATTTTCCACAGATCAGAAGTGTAAACAGAGAGATAATGTAACAGTATTTGGAAGAGATAATGACACAAGGATATAGTGATCTGGGAGCAT
GAATTAGAAACAGGGTACTATGTTTCTGGTGTAAAATCTAAATTGTGCTTTCTACTAGCGTTACTTTTTCAAATGGGATGATATAAAGCA
CTGTGGGCTATAAGCAACAATCTTGGGTTGGTAGGCAAATAGACCAATTGATCTTTATTATTATTATTATTATTATTATTATTATTTTTT
GAGATGAAGTCTTGCTCTTGTCGCCCAGGCTGGGTGCAGTGGCATGATCTTGGCTTACTGCAACCTCTGCCTCCTGGGTTCAAGCACCTG
AGCCTCCCGAGTAGCTGGGATTACAGGCATCTGCCACCACACCTGGCTAATTTTTGTATTTTTTGTAGAGACAGATGTTTCACCATGTTG
GCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTTTGCATCCCAAAATGCTGGGATTACAGGTGTGAGCCACAGCACCC
GGTCCCAGTTGGTCTTTTAATATTAAATTTGTGCACTATTACTGGGTCTGGAGTTAATGATTTCAAATAGTTTCTAAAAATAACTGATTA
AATGTAAGAAATTATAACTAATTATCAAGGTGATTCTCTTTTGTTTCTTCAATGGAGAGTTTCTCTTTCTCTTTTCCTCCTCTAATAAAA
ATATTTCTTTTTTTCCTGTCCTTTTATTCATTATATTATGAAACTTAGGTTTTAGGAAACACCTTAAGCGTCATTTTAATGAAGCACAAC
ATTGATATTTTACATGAATAATAACGTTTGGTATTTTAAATATACTTCAAGGGGGTAATAAGCCACAATAACTGTACCAAAAAAACTTAA
AAATGGGGACATATTCATCCCTTGTGTGTGCATATTTTACCACTTGTTGACAAGATACAATTGTGACCTACTTTGAGGGGATGAATAACG
ACTTATCACTTTAAGACACTTTGCAAACATGTTACTAAAAAAAGGTGCCTAGCCAAGGAAAAAACCATTCACTTGGAATTAAAATTGTGG
ATGTCACTTCAGAGATGACTTTAACATAAATGCTGAAAGTTCATTCACCTCACAAATGTGGCAGTTTTCTCTGTGGAGAATGGTGGTCTC
CGTGGCAGACTGGCTCTCCAAATTAAATGAAACTCATTGACAGACCTGGGACCTTTTATGTGAGTGGACAGACAAGATCTTGGTTTGGCT
TCATGTACTGTTTTCTAGAGAGAGTGCTACGAAAAACTTATGATGCTTTTATGTGATAACCAATATAATGCTTTAATATGTTAATTCTTT
GTGATGCTATATACATAGTTTTTATAGTTTTATGAAACCACTTTGTTAAACTTATCTGGATTTTAAGACACTTGTAAACAAATGGTTTGT

>In-frame_MBOAT1_ENST00000324607_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_4936nt
GAGAGTTTGCGCCGGTTCGCATTCCCCGGCCTCCCGTTCGCTCCCCCGCGAACCAGGCGGCCGTGCGCCTCTCGGGGCAACCACCCAAGA
GCACCCGGGCGGGAGGACGCCGAGCAGGGGGTGTTGCGGGCTGGGACAGGGGCAGCCACCTCCCGAAGATGCAGGATGGCAGCAGAGCCG
CAGCCGTCCAGCCTTTCCTACCGCACCACGGGCTCCACCTACCTGCACCCGCTCAGCGAGCTCCTGGGCATCCCGCTGGACCAGGTGAAT
TTTGTGGTATGCCAGCTTGTTGCTCTGTTTGCTGCTTTCTGGTTTCGCATCTACTTACGTCCTGGTACAACCAGCTCTGATGTCCGGCAT
GCGGTTGCCACCATTTTTGGCATCTATTTTGTCATCTTTTGTTTCGGCTGGTACTCTGTGCATCTTTTTGTGCTGGTGTTAATGTGCTAT
GCAATCATGGTCACTGCTAGTGTATCCAATATTCACAGATATTCCTTTTTTGTAGCAATGGGATATCTTACAATATGCCACATCAGCCGA
ATATACATCTTCCACTATGGAATTCTCACTACGGATTTTTCTGGGCCTCTGATGATTGTCACTCAGAAGATCACAACCTTGGCATTCCAG
GTTCATGATGGATTAGGTCGAAGAGCTGAAGACCTTTCTGCTGAACAACATCGACTTGCTATCAAAGTGAAACCCTCTTTTTTGGAATAC
TTAAGTTACCTTCTCAATTTCATGAGTGTCATAGCTGGTCCTTGTAACAATTTCAAGGACTACATAGCCTTCATTGAGGGGAAGCATATA
CACATGAAGTTGCTGGAGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTTGCCAGAACCTTCTCCCACAGTAAAACCAGTAATCCATAGC
AGGATCAACGTGTCAGCTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCACTATCTTCTTGATTGCAAATGGAGACCTCATAAACCCAGCT
TCTCGCCTCCTTATCCCCAGAAAAACCTTGAATCAGTGGGATCATGTACTACAAATGGTCACAGAAAAAATCACTCTGAGGAGCGGGGCT
GTTCACAGGCTTTATACTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGAGTTGGAGAATGGGCAGTTTTATGTGGCTGTTGGCAGAGAT
AAGTTTAAGAAACTGCCTTACAGTGAGTTACTTTTTGACAAGTCAACGATGAGAAGGCCTTTTGGTCAGAAAGCTTCTTCACTACCTCCT
ATTGTAGGATCCAGAAAGTCTAAAGGGAGTGGAAATGATCGCCACTCTAAGTCAACAGTTGGATCCAGTGACAACTCATCTCCTCAGCCC
CTGAAGAGGAAAGGGAAAAAAGAAGACGTGAATTCAGAAAAACTGACGAAATTGAAACAAAATGTAAAATTAAAGAATTCACAAGAAACC
ATTCCAAATAGTGATGAAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGAAACACGGGGGGCAGCAGAAGTCCAAGAAGATGAAGATACT
CAGGTTGAGGTTCCAGTCGATCAGAGGCCAGCAGAAATAGTAGACGAGGAAGAAGATGGAGAGAAGGCAAACAAGGATGCAGAACAGAAA
GAAGACTTTTCAGGAATGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGAGGCTACAGATGCCCCTGAGCAAGTCGAGGAGATTCTGGAT
CACAGTGAGCAGCAGGCACGCCCTGCTCGTGTAAATGGAGGCACCGATGAGGAGAATGGTGAGGAGCTGCAGCAGGTTAATAATGAGCTT
CAACTGGTCCTAGACAAGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACAAGATGAGGCTGATGTAGACCCTCAAAGACCACCAAGGCCA
GAAGTAAAAATTACCAGTCCAGAAGAAAATGAAAACAACCAACAAAACAAGGACTATGCTGCCGTGGCTTAGAACATTTTTAAAAAGAGA
GTATATGGATCGCAAGAAAAATGAAGGGTTATCATACTTGAAAGATAAGCACATAGTTATTGCTGAATATAATGTGACACTATGGTCGAA
TACTACCTACGAATTATAACATTAGAAGCCTAGTGGAAAGACCAGATAACTTTAAATGGCTACTAAAGGATAATTACTTACTTTTATTGC
ATGTGTTTTAAAAGTCATATAGAAATATTAAATAAGACGGACAGAGGAGAATTTGCACTGGAAGACAATTGCCACTTGTAAAGGATGAAA
AATAGGATCACTCTTATTGTACGCTTTATTATAAGTTTAGAAGGCAGTTTATTCTAAATAATTTTTCTCTAGGAAGGCGTAGAATTTTAA
AGAACTGGTAATAGGAAAGCATGTACTATTTTCTTAAAGCAATAAACTCTTGAATGAACAGATTGCGATTTACTTTCAGACATAATTTGG
AGATGGCAGTAGATCAAAATGTGTCCATGACTTGTTAACATGCCTTTCTTTCTTCCTCCTTAGCCAAAATCCACCTTTGAACTACAAAGA
CAGAGCAAGGCGTTCATTTTGGTGGGAGGAAGCATTGGTTCAGAGTGTTAGTGACTAGTATCGCCATGCCGTCACTTAAATGCTTTCAGG
CTTGCATGCTTGTGGCTCCAATGGCGCACACTCAGGAAGGAATTGTAAAGGAGCACCCAGTTATATTATAAAGCCTGGATGTATGGTTTG
CAGATAATGGAAATCCTGTGGATTTTCACTGATCCAGTCTATCTTTACCAATAGTATCTCTCTCTTCTCCCTTATGTTATTAGAGAACCT
GATATTGGCTATTCCAAAGATTAAATTATTTTCAAATAGTTTTCAACAAAAATAAAAGTGTATTAGGAAGAAAAAAGTAGACTATATGAA
GAGTTTGTGACTGCTCAATTTAACTTGTTTTTTGCCTTATTTCTATTAAGACTGTTTTACTATGTTTTTGCCCTAGGGATATCAGCAAAT
ATTTATTTTTCCTAGCATGATATAGTTAGAATTTCAAGCAGATTTCTTTGTAATTAGAAGGCATCTGATAGAAATTGTAAAACTTTAGAA
GTTATTATAATGAAACCAATTCCTGAATCACAACTTCATGGACTGACTAAATTGATTTATAGTTGCCTTGTGAGGTATGTATGGGGAAAA
CATAAAAACATAATTAAAACATAATTTCGTCCTTTTTATGAATTCTTAAGAGATGTTCTTCCATAAATATAGAAATAATATATTTTTCTT
AAAGGATATATTTTTAATTATGTGGAAGTTGTAAGCTTGAAATTTTAACTTCTAGTGCTTTTCTAAAATTCACAATTACAAGTTTAAAAC
ATTTTTTCTCTTCCAGGTTTCATTTGGAATAAAGAGTTGGCAGTTATATAAAGCACTTAATAATACTATAGAAAATAGATGTGTTTTTTC
TTAATATGATTTTGGTATTTTCCACAGATCAGAAGTGTAAACAGAGAGATAATGTAACAGTATTTGGAAGAGATAATGACACAAGGATAT
AGTGATCTGGGAGCATGAATTAGAAACAGGGTACTATGTTTCTGGTGTAAAATCTAAATTGTGCTTTCTACTAGCGTTACTTTTTCAAAT
GGGATGATATAAAGCACTGTGGGCTATAAGCAACAATCTTGGGTTGGTAGGCAAATAGACCAATTGATCTTTATTATTATTATTATTATT
ATTATTATTATTTTTTGAGATGAAGTCTTGCTCTTGTCGCCCAGGCTGGGTGCAGTGGCATGATCTTGGCTTACTGCAACCTCTGCCTCC
TGGGTTCAAGCACCTGAGCCTCCCGAGTAGCTGGGATTACAGGCATCTGCCACCACACCTGGCTAATTTTTGTATTTTTTGTAGAGACAG
ATGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTTTGCATCCCAAAATGCTGGGATTACAGGT
GTGAGCCACAGCACCCGGTCCCAGTTGGTCTTTTAATATTAAATTTGTGCACTATTACTGGGTCTGGAGTTAATGATTTCAAATAGTTTC
TAAAAATAACTGATTAAATGTAAGAAATTATAACTAATTATCAAGGTGATTCTCTTTTGTTTCTTCAATGGAGAGTTTCTCTTTCTCTTT
TCCTCCTCTAATAAAAATATTTCTTTTTTTCCTGTCCTTTTATTCATTATATTATGAAACTTAGGTTTTAGGAAACACCTTAAGCGTCAT
TTTAATGAAGCACAACATTGATATTTTACATGAATAATAACGTTTGGTATTTTAAATATACTTCAAGGGGGTAATAAGCCACAATAACTG
TACCAAAAAAACTTAAAAATGGGGACATATTCATCCCTTGTGTGTGCATATTTTACCACTTGTTGACAAGATACAATTGTGACCTACTTT
GAGGGGATGAATAACGACTTATCACTTTAAGACACTTTGCAAACATGTTACTAAAAAAAGGTGCCTAGCCAAGGAAAAAACCATTCACTT
GGAATTAAAATTGTGGATGTCACTTCAGAGATGACTTTAACATAAATGCTGAAAGTTCATTCACCTCACAAATGTGGCAGTTTTCTCTGT
GGAGAATGGTGGTCTCCGTGGCAGACTGGCTCTCCAAATTAAATGAAACTCATTGACAGACCTGGGACCTTTTATGTGAGTGGACAGACA
AGATCTTGGTTTGGCTTCATGTACTGTTTTCTAGAGAGAGTGCTACGAAAAACTTATGATGCTTTTATGTGATAACCAATATAATGCTTT
AATATGTTAATTCTTTGTGATGCTATATACATAGTTTTTATAGTTTTATGAAACCACTTTGTTAAACTTATCTGGATTTTAAGACACTTG

>In-frame_MBOAT1_ENST00000536798_chr6_20126748_-_DCDC2_ENST00000378454_chr6_24302272_-_4976nt
AGCGCCAAAGCCAAGTTTGCGCCTCGAGAGTTTGCGCCTCGAGAGTTTGCGCCGGTTCGCATTCCCCGGCCTCCCGTTCGCTCCCCCGCG
AACCAGGCGGCCGTGCGCCTCTCGGGGCAACCACCCAAGAGCACCCGGGCGGGAGGACGCCGAGCAGGGGGTGTTGCGGGCTGGGACAGG
GGCAGCCACCTCCCGAAGATGCAGGATGGCAGCAGAGCCGCAGCCGTCCAGCCTTTCCTACCGCACCACGGGCTCCACCTACCTGCACCC
GCTCAGCGAGCTCCTGGGCATCCCGCTGGACCAGGTGAATTTTGTGGTATGCCAGCTTGTTGCTCTGTTTGCTGCTTTCTGGTTTCGCAT
CTACTTACGTCCTGGTACAACCAGCTCTGATGTCCGGCATGCGGTTGCCACCATTTTTGGCATCTATTTTGTCATCTTTTGTTTCGGCTG
GTACTCTGTGCATCTTTTTGTGCTGGTGTTAATGTGCTATGCAATCATGGTCACTGCTAGTGTATCCAATATTCACAGATATTCCTTTTT
TGTAGCAATGGGATATCTTACAATATGCCACATCAGCCGAATATACATCTTCCACTATGGAATTCTCACTACGGATTTTTCTGGGCCTCT
GATGATTGTCACTCAGAAGATCACAACCTTGGCATTCCAGGTTCATGATGGATTAGGTCGAAGAGCTGAAGACCTTTCTGCTGAACAACA
TCGACTTGCTATCAAAGTGAAACCCTCTTTTTTGGAATACTTAAGTTACCTTCTCAATTTCATGAGTGTCATAGCTGGTCCTTGTAACAA
TTTCAAGGACTACATAGCCTTCATTGAGGGGAAGCATATACACATGAAGTTGCTGGAGGTGAACTGGAAGCGAAAAGGTTTCCACAGCTT
GCCAGAACCTTCTCCCACAGTAAAACCAGTAATCCATAGCAGGATCAACGTGTCAGCTCGCTTTAGAAAACCGCTTCAGGAGCCGTGCAC
TATCTTCTTGATTGCAAATGGAGACCTCATAAACCCAGCTTCTCGCCTCCTTATCCCCAGAAAAACCTTGAATCAGTGGGATCATGTACT
ACAAATGGTCACAGAAAAAATCACTCTGAGGAGCGGGGCTGTTCACAGGCTTTATACTTTAGAAGGAAAACTTGTTGAGAGTGGAGCAGA
GTTGGAGAATGGGCAGTTTTATGTGGCTGTTGGCAGAGATAAGTTTAAGAAACTGCCTTACAGTGAGTTACTTTTTGACAAGTCAACGAT
GAGAAGGCCTTTTGGTCAGAAAGCTTCTTCACTACCTCCTATTGTAGGATCCAGAAAGTCTAAAGGGAGTGGAAATGATCGCCACTCTAA
GTCAACAGTTGGATCCAGTGACAACTCATCTCCTCAGCCCCTGAAGAGGAAAGGGAAAAAAGAAGACGTGAATTCAGAAAAACTGACGAA
ATTGAAACAAAATGTAAAATTAAAGAATTCACAAGAAACCATTCCAAATAGTGATGAAGGCATTTTCAAAGCTGGAGCAGAGAGGTCTGA
AACACGGGGGGCAGCAGAAGTCCAAGAAGATGAAGATACTCAGGTTGAGGTTCCAGTCGATCAGAGGCCAGCAGAAATAGTAGACGAGGA
AGAAGATGGAGAGAAGGCAAACAAGGATGCAGAACAGAAAGAAGACTTTTCAGGAATGAATGGTGACCTTGAAGAGGAAGGAGGTAGGGA
GGCTACAGATGCCCCTGAGCAAGTCGAGGAGATTCTGGATCACAGTGAGCAGCAGGCACGCCCTGCTCGTGTAAATGGAGGCACCGATGA
GGAGAATGGTGAGGAGCTGCAGCAGGTTAATAATGAGCTTCAACTGGTCCTAGACAAGGAAAGAAAGTCTCAAGGAGCTGGCAGTGGACA
AGATGAGGCTGATGTAGACCCTCAAAGACCACCAAGGCCAGAAGTAAAAATTACCAGTCCAGAAGAAAATGAAAACAACCAACAAAACAA
GGACTATGCTGCCGTGGCTTAGAACATTTTTAAAAAGAGAGTATATGGATCGCAAGAAAAATGAAGGGTTATCATACTTGAAAGATAAGC
ACATAGTTATTGCTGAATATAATGTGACACTATGGTCGAATACTACCTACGAATTATAACATTAGAAGCCTAGTGGAAAGACCAGATAAC
TTTAAATGGCTACTAAAGGATAATTACTTACTTTTATTGCATGTGTTTTAAAAGTCATATAGAAATATTAAATAAGACGGACAGAGGAGA
ATTTGCACTGGAAGACAATTGCCACTTGTAAAGGATGAAAAATAGGATCACTCTTATTGTACGCTTTATTATAAGTTTAGAAGGCAGTTT
ATTCTAAATAATTTTTCTCTAGGAAGGCGTAGAATTTTAAAGAACTGGTAATAGGAAAGCATGTACTATTTTCTTAAAGCAATAAACTCT
TGAATGAACAGATTGCGATTTACTTTCAGACATAATTTGGAGATGGCAGTAGATCAAAATGTGTCCATGACTTGTTAACATGCCTTTCTT
TCTTCCTCCTTAGCCAAAATCCACCTTTGAACTACAAAGACAGAGCAAGGCGTTCATTTTGGTGGGAGGAAGCATTGGTTCAGAGTGTTA
GTGACTAGTATCGCCATGCCGTCACTTAAATGCTTTCAGGCTTGCATGCTTGTGGCTCCAATGGCGCACACTCAGGAAGGAATTGTAAAG
GAGCACCCAGTTATATTATAAAGCCTGGATGTATGGTTTGCAGATAATGGAAATCCTGTGGATTTTCACTGATCCAGTCTATCTTTACCA
ATAGTATCTCTCTCTTCTCCCTTATGTTATTAGAGAACCTGATATTGGCTATTCCAAAGATTAAATTATTTTCAAATAGTTTTCAACAAA
AATAAAAGTGTATTAGGAAGAAAAAAGTAGACTATATGAAGAGTTTGTGACTGCTCAATTTAACTTGTTTTTTGCCTTATTTCTATTAAG
ACTGTTTTACTATGTTTTTGCCCTAGGGATATCAGCAAATATTTATTTTTCCTAGCATGATATAGTTAGAATTTCAAGCAGATTTCTTTG
TAATTAGAAGGCATCTGATAGAAATTGTAAAACTTTAGAAGTTATTATAATGAAACCAATTCCTGAATCACAACTTCATGGACTGACTAA
ATTGATTTATAGTTGCCTTGTGAGGTATGTATGGGGAAAACATAAAAACATAATTAAAACATAATTTCGTCCTTTTTATGAATTCTTAAG
AGATGTTCTTCCATAAATATAGAAATAATATATTTTTCTTAAAGGATATATTTTTAATTATGTGGAAGTTGTAAGCTTGAAATTTTAACT
TCTAGTGCTTTTCTAAAATTCACAATTACAAGTTTAAAACATTTTTTCTCTTCCAGGTTTCATTTGGAATAAAGAGTTGGCAGTTATATA
AAGCACTTAATAATACTATAGAAAATAGATGTGTTTTTTCTTAATATGATTTTGGTATTTTCCACAGATCAGAAGTGTAAACAGAGAGAT
AATGTAACAGTATTTGGAAGAGATAATGACACAAGGATATAGTGATCTGGGAGCATGAATTAGAAACAGGGTACTATGTTTCTGGTGTAA
AATCTAAATTGTGCTTTCTACTAGCGTTACTTTTTCAAATGGGATGATATAAAGCACTGTGGGCTATAAGCAACAATCTTGGGTTGGTAG
GCAAATAGACCAATTGATCTTTATTATTATTATTATTATTATTATTATTATTTTTTGAGATGAAGTCTTGCTCTTGTCGCCCAGGCTGGG
TGCAGTGGCATGATCTTGGCTTACTGCAACCTCTGCCTCCTGGGTTCAAGCACCTGAGCCTCCCGAGTAGCTGGGATTACAGGCATCTGC
CACCACACCTGGCTAATTTTTGTATTTTTTGTAGAGACAGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGA
TCCGCCCGCCTTTGCATCCCAAAATGCTGGGATTACAGGTGTGAGCCACAGCACCCGGTCCCAGTTGGTCTTTTAATATTAAATTTGTGC
ACTATTACTGGGTCTGGAGTTAATGATTTCAAATAGTTTCTAAAAATAACTGATTAAATGTAAGAAATTATAACTAATTATCAAGGTGAT
TCTCTTTTGTTTCTTCAATGGAGAGTTTCTCTTTCTCTTTTCCTCCTCTAATAAAAATATTTCTTTTTTTCCTGTCCTTTTATTCATTAT
ATTATGAAACTTAGGTTTTAGGAAACACCTTAAGCGTCATTTTAATGAAGCACAACATTGATATTTTACATGAATAATAACGTTTGGTAT
TTTAAATATACTTCAAGGGGGTAATAAGCCACAATAACTGTACCAAAAAAACTTAAAAATGGGGACATATTCATCCCTTGTGTGTGCATA
TTTTACCACTTGTTGACAAGATACAATTGTGACCTACTTTGAGGGGATGAATAACGACTTATCACTTTAAGACACTTTGCAAACATGTTA
CTAAAAAAAGGTGCCTAGCCAAGGAAAAAACCATTCACTTGGAATTAAAATTGTGGATGTCACTTCAGAGATGACTTTAACATAAATGCT
GAAAGTTCATTCACCTCACAAATGTGGCAGTTTTCTCTGTGGAGAATGGTGGTCTCCGTGGCAGACTGGCTCTCCAAATTAAATGAAACT
CATTGACAGACCTGGGACCTTTTATGTGAGTGGACAGACAAGATCTTGGTTTGGCTTCATGTACTGTTTTCTAGAGAGAGTGCTACGAAA
AACTTATGATGCTTTTATGTGATAACCAATATAATGCTTTAATATGTTAATTCTTTGTGATGCTATATACATAGTTTTTATAGTTTTATG
AAACCACTTTGTTAAACTTATCTGGATTTTAAGACACTTGTAAACAAATGGTTTGTTAGTAAAATTGGGGCATTAAGAGTTTTACAGAGC


Top

FusionGenePPI for MBOAT1_DCDC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MBOAT1ATP1A1, ATP2A2, ATP5A1, ATP5B, CAV1, EMD, NR3C1, HSPA4, TNPO1, SLC1A5, SLC3A2, TAP1, SLC39A7, SLC7A5, TECR, CLINT1, TBC1D4, LPGAT1, SCAMP3, PRSS21, TMEM194A, TRAM1, LTN1, SLC43A3, SLC35F6, DERL1, SLC35E1, PTDSS2, YIPF5, TMEM126A, PTRFDCDC2APP, NIF3L1, MRFAP1, DCTN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MBOAT1_DCDC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MBOAT1_DCDC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDCDC2C0036341Schizophrenia1PSYGENET
TgeneDCDC2C1857750DEAFNESS, AUTOSOMAL RECESSIVE 661UNIPROT