FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21204

FusionGeneSummary for MBNL2_MADD

check button Fusion gene summary
Fusion gene informationFusion gene name: MBNL2_MADD
Fusion gene ID: 21204
HgeneTgene
Gene symbol

MBNL2

MADD

Gene ID

10150

8567

Gene namemuscleblind like splicing regulator 2MAP kinase activating death domain
SynonymsMBLL|MBLL39|PRO2032DENN|IG20|RAB3GEP
Cytomap

13q32.1

11p11.2

Type of geneprotein-codingprotein-coding
Descriptionmuscleblind-like protein 2muscleblind-like 2muscleblind-like protein 1muscleblind-like protein-like 39MAP kinase-activating death domain proteinRab3 GDP/GTP exchange factordifferentially expressed in normal and neoplastic cellsinsulinoma glucagonoma clone 20
Modification date2018052320180523
UniProtAcc

Q5VZF2

Q8WXG6

Ensembl transtripts involved in fusion geneENST00000397601, ENST00000343600, 
ENST00000345429, ENST00000376673, 
ENST00000445661, 
ENST00000342922, 
ENST00000402799, ENST00000311027, 
ENST00000406482, ENST00000407859, 
ENST00000349238, ENST00000395344, 
ENST00000395336, ENST00000402192, 
ENST00000405573, ENST00000489415, 
Fusion gene scores* DoF score7 X 6 X 5=2104 X 5 X 3=60
# samples 75
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MBNL2 [Title/Abstract] AND MADD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMBNL2

GO:0043484

regulation of RNA splicing

15257297|16946708

TgeneMADD

GO:0032483

regulation of Rab protein signal transduction

20937701

TgeneMADD

GO:2001236

regulation of extrinsic apoptotic signaling pathway

11577081


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A6YS-01AMBNL2chr13

97928663

+MADDchr11

47330142

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000397601ENST00000342922MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000402799MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000311027MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000406482MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000407859MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000349238MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000395344MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000395336MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000402192MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000397601ENST00000405573MBNL2chr13

97928663

+MADDchr11

47330142

+
5CDS-intronENST00000397601ENST00000489415MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000342922MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000402799MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000311027MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000406482MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000407859MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000349238MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000395344MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000395336MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000402192MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000343600ENST00000405573MBNL2chr13

97928663

+MADDchr11

47330142

+
5CDS-intronENST00000343600ENST00000489415MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000342922MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000402799MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000311027MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000406482MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000407859MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000349238MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000395344MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000395336MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000402192MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000345429ENST00000405573MBNL2chr13

97928663

+MADDchr11

47330142

+
5CDS-intronENST00000345429ENST00000489415MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000342922MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000402799MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000311027MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000406482MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000407859MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000349238MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000395344MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000395336MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000402192MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000376673ENST00000405573MBNL2chr13

97928663

+MADDchr11

47330142

+
5CDS-intronENST00000376673ENST00000489415MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000342922MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000402799MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000311027MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000406482MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000407859MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000349238MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000395344MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000395336MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000402192MBNL2chr13

97928663

+MADDchr11

47330142

+
In-frameENST00000445661ENST00000405573MBNL2chr13

97928663

+MADDchr11

47330142

+
5CDS-intronENST00000445661ENST00000489415MBNL2chr13

97928663

+MADDchr11

47330142

+

Top

FusionProtFeatures for MBNL2_MADD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MBNL2

Q5VZF2

MADD

Q8WXG6

Mediates pre-mRNA alternative splicing regulation. Actseither as activator or repressor of splicing on specific pre-mRNAtargets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exoninclusion but induces insulin receptor (IR) pre-mRNA exoninclusion in muscle. Antagonizes the alternative splicing activitypattern of CELF proteins. RNA-binding protein that binds to5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR ofITGA3. Binds to CUG triplet repeat expansion in myotonic dystrophymuscle cells by sequestering the target RNAs. Seems to regulateexpression and localization of ITGA3 by transporting it from thenucleus to cytoplasm at adhesion plaques. May play a role inmyotonic dystrophy pathophysiology (DM).{ECO:0000269|PubMed:15257297, ECO:0000269|PubMed:16273094,ECO:0000269|PubMed:16946708}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBNL2chr13:97928663chr11:47330142ENST00000343600+2713_4158362Zinc fingerC3H1-type 1
HgeneMBNL2chr13:97928663chr11:47330142ENST00000345429+2913_4158368Zinc fingerC3H1-type 1
HgeneMBNL2chr13:97928663chr11:47330142ENST00000376673+2813_4158374Zinc fingerC3H1-type 1
HgeneMBNL2chr13:97928663chr11:47330142ENST00000397601+2713_4158362Zinc fingerC3H1-type 1
TgeneMADDchr13:97928663chr11:47330142ENST00000311027+23361340_141512531648DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000342922+21331340_141512151589DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000349238+22341340_141512351609DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000395336+23351340_141512531877DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000395344+21331340_141511681542DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000402192+21331340_141512141588DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000402799+21331340_141511721546DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000406482+21321340_141511721783DomainDeath
TgeneMADDchr13:97928663chr11:47330142ENST00000407859+22341340_141511921566DomainDeath

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMBNL2chr13:97928663chr11:47330142ENST00000343600+27176_20458362Zinc fingerC3H1-type 3
HgeneMBNL2chr13:97928663chr11:47330142ENST00000343600+27212_23858362Zinc fingerC3H1-type 4
HgeneMBNL2chr13:97928663chr11:47330142ENST00000343600+2747_7358362Zinc fingerC3H1-type 2
HgeneMBNL2chr13:97928663chr11:47330142ENST00000345429+29176_20458368Zinc fingerC3H1-type 3
HgeneMBNL2chr13:97928663chr11:47330142ENST00000345429+29212_23858368Zinc fingerC3H1-type 4
HgeneMBNL2chr13:97928663chr11:47330142ENST00000345429+2947_7358368Zinc fingerC3H1-type 2
HgeneMBNL2chr13:97928663chr11:47330142ENST00000376673+28176_20458374Zinc fingerC3H1-type 3
HgeneMBNL2chr13:97928663chr11:47330142ENST00000376673+28212_23858374Zinc fingerC3H1-type 4
HgeneMBNL2chr13:97928663chr11:47330142ENST00000376673+2847_7358374Zinc fingerC3H1-type 2
HgeneMBNL2chr13:97928663chr11:47330142ENST00000397601+27176_20458362Zinc fingerC3H1-type 3
HgeneMBNL2chr13:97928663chr11:47330142ENST00000397601+27212_23858362Zinc fingerC3H1-type 4
HgeneMBNL2chr13:97928663chr11:47330142ENST00000397601+2747_7358362Zinc fingerC3H1-type 2
TgeneMADDchr13:97928663chr11:47330142ENST00000311027+23361157_125012531648Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000342922+21331157_125012151589Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000349238+22341157_125012351609Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000395336+23351157_125012531877Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000395344+21331157_125011681542Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000402192+21331157_125012141588Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000402799+21331157_125011721546Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000406482+21321157_125011721783Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000407859+22341157_125011921566Compositional biasSer-rich
TgeneMADDchr13:97928663chr11:47330142ENST00000311027+233614_26812531648DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000311027+2336289_42912531648DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000311027+2336431_56512531648DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000342922+213314_26812151589DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000342922+2133289_42912151589DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000342922+2133431_56512151589DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000349238+223414_26812351609DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000349238+2234289_42912351609DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000349238+2234431_56512351609DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395336+233514_26812531877DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395336+2335289_42912531877DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395336+2335431_56512531877DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395344+213314_26811681542DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395344+2133289_42911681542DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000395344+2133431_56511681542DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402192+213314_26812141588DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402192+2133289_42912141588DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402192+2133431_56512141588DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402799+213314_26811721546DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402799+2133289_42911721546DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000402799+2133431_56511721546DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000406482+213214_26811721783DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000406482+2132289_42911721783DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000406482+2132431_56511721783DomaindDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000407859+223414_26811921566DomainuDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000407859+2234289_42911921566DomaincDENN
TgeneMADDchr13:97928663chr11:47330142ENST00000407859+2234431_56511921566DomaindDENN


Top

FusionGeneSequence for MBNL2_MADD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_453aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE
GGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPV

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_366aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQFL

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_387aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_435aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_453aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE
GGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPV

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_366aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQFL

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_387aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_435aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_453aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE
GGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPV

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_366aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQFL

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_387aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_435aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_453aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE
GGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPV

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_366aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQFL

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_387aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_435aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_453aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE
GGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPV

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_366aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQFL

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_387aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_432aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKV
RRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINM
TYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVF

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_435aa
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGKAHSLKPSIKEKLAGSPIRTSEDVSQRVYLY
EGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLL
HNLISYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCV
VLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_1359nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGC
AATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCAC
GAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTC

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_1098nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_1161nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1305nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTC
GTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_1359nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGC
AATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCAC
GAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTC

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_1098nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_1161nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1305nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTC
GTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_1359nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGC
AATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCAC
GAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTC

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_1098nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_1161nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1305nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTC
GTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_1359nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGC
AATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCAC
GAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTC

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_1098nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_1161nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1305nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTC
GTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTG

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_1359nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGC
AATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCAC
GAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTC

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_1098nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTG

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_1161nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_1296nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGA
GAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGAT
GAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTG
AGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGC
GATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTT
TTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATG
ACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGG
GAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTC
CCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTC
ATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGC
CACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1305nt
ATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCT
GATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAA
GCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTAT
GAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCT
ACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCC
CAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTG
CACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATT
GGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGC
CGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTG
GTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTG
TGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGC
ATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAG
GGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTC
GTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_2907nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG
GTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCC
TCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCT
TGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTC
TGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGG
CAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGAC
TGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCT
GGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGT
GTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_2907nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG
GTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCC
TCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCT
TGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTC
TGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGG
CAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGAC
TGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCT
GGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGT
GTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_2970nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAA
AGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGA
CCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGC
CACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAA
GTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTC
CAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGA
TGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGAC
GAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGT
GAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAA
GACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACAT
TAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACC
AATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCC
CCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGAT
GCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTG
AGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTG
TGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTG
CAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCT
CACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCC
CAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGG
CCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGG
GGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTAT
GGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGTGAAATAAATGTCCTCAACTCCC

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_2837nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCG
TACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCC
CAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGC
AAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAG
AAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTT
GTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGG
CGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGG
GGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTG
CCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTA
GTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGC
TGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTAT

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_2907nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG
GTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCC
TCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCT
TGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTC
TGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGG
CAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGAC
TGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCT
GGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGT
GTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_2907nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG
GTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCC
TCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCT
TGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTC
TGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGG
CAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGAC
TGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCT
GGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGT
GTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_2233nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_2900nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAA
AGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGA
CCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGC
CACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAA
GTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTC
CAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGA
TGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGAC
GAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGT
GAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAA
GACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTG
AGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAG
GAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTT
GCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTT
ACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGC
TCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCT
GGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGG
AGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTC
CCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTG
GAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCT
CTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGA
GGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGTGA

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_2906nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGAT
GTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCT
GGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCG
CAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCT
GAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGG
AGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCT
CATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAA
AAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGG
TGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAA
TCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGA
AGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAG
CAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTG
GCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTG
GTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCC
TCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCT
TGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTC
TGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGG
CAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGAC
TGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCT
GGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGT
GTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTG

>In-frame_MBNL2_ENST00000397601_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_2325nt
CAGGAAACTCCAGCACCTCCTAGAACATCTTTTGTGGAATGGCACCTCATGGGGGCCCTTGGATCATGTACCCCTTGTATTCAACAGTAA
ACATCTTCCTATAATCATTGCTTCATTAACGATAATGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCT
TGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTG
ACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAAC
ATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGC
AAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTG
ATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGAC
TTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTA
CTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATG
CTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCT
AAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGT
CTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAA
AGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGA
CCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGC
CACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAA
GTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTC
CAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGA
TGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGAC
GAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGT
GAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAA
GACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAG
GCTCCCTGTCGTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGA
GGGAGAACTGGAGCAGCTGGACCCAGGAAAGAAACCCCAGGGGAGGGCACAGTGACGTTGGCGACCACCTGGCGCTGTGAAGGTGCACCA
GGGAGCCCGTGGGGGAGGCTGGGCAGGAGCGAGGCCAGGTGGCCACGCTGCCCCATCCGTTGGACTCCACACAGTGTGAGTGGGAGCGTC
TCACTTGGCCCTTCCCCTGCAGTGTCTCTGCCTTCCTCTATTCCCAGGATATGCTTCTGCTTGGTGGTTTTGCTTTGAGAGTCTAGACTG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_2993nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG
GTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAG
GGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTC
CCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTG
AGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGC
CTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCA
GTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCT
GCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCA
GGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_2993nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG
GTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAG
GGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTC
CCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTG
AGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGC
CTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCA
GTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCT
GCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCA
GGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_3056nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAG
CGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAG
GGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACA
CTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCG
CACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGT
GGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGAC
TGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAG
GTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAG
GACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACT
GGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAA
AAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATG
GCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGG
CCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTG
CTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTG
TGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGG
GCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAG
AGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACC
CTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAG
CCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTG
CCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGC
AGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGC

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_2923nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
TTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACG
TGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGC
CCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGC
CCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGA
CCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGT
TGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCC
TGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGG
CAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTG
CCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGG
AGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTC
TCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_2993nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG
GTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAG
GGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTC
CCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTG
AGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGC
CTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCA
GTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCT
GCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCA
GGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_2993nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG
GTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAG
GGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTC
CCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTG
AGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGC
CTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCA
GTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCT
GCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCA
GGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_2319nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_2986nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAG
CGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAG
GGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACA
CTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCG
CACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGT
GGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGAC
TGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAG
GTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAG
GACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACT
GGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCC
ACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAG
ATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTG
TTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCG
GTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAA
GAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCG
TTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTG
AGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTG
CTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGC
GGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGC
CTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGA
GAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGTGAAATA

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_2992nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTG
GAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAA
GATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAG
AAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAAT
GGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGAT
ATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATC
AACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAG
TGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGC
GAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAG
GTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTG
GTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGT
GAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCC
CTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTG
GTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAG
GGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTC
CCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTG
AGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGC
CTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCA
GTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCT
GCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCA
GGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATG

>In-frame_MBNL2_ENST00000343600_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_2411nt
AGCAACAGAGTTTAGACTGTCTTTGCTTCATCATCTGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGG
AATGAGAACTATTTACATGGAAGTTTCTTTCTCATGATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACT
GTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTTTATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGG
AGCTTTCTTTGTATTCACATCCCACTCTTCTGTCAAGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTT
TGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGAAAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCG
TCAATAGCTGTGAGCGTCAGCATTAAATATTCTCCCAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAA
CAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATGACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTG
ATGAGTGATTGCCTGTCCATACACTCTCTCATCATCCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTAC
ATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCATTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTT
ATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCA
CGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAG
GGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTAT
CTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAG
CGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAG
GGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACA
CTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCG
CACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGT
GGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGAC
TGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAG
GTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAG
GACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACT
GGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTC
CCTGTCGTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGA
GAACTGGAGCAGCTGGACCCAGGAAAGAAACCCCAGGGGAGGGCACAGTGACGTTGGCGACCACCTGGCGCTGTGAAGGTGCACCAGGGA
GCCCGTGGGGGAGGCTGGGCAGGAGCGAGGCCAGGTGGCCACGCTGCCCCATCCGTTGGACTCCACACAGTGTGAGTGGGAGCGTCTCAC
TTGGCCCTTCCCCTGCAGTGTCTCTGCCTTCCTCTATTCCCAGGATATGCTTCTGCTTGGTGGTTTTGCTTTGAGAGTCTAGACTGGCCG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_3021nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGA
GGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTT
CTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCT
GCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCT
CTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTC
CCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGAC
ATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGAC
TGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAA
TTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCT
GCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAG
GCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGC
AGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTAT

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_2888nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTAC
AAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGA
ACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAG
TGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTG
TCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGT
ACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACT
GTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACC
CTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTC
TGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATT
CCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCAT
CAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGC
CTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGTGAAATAAATGTCCT

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_2284nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_2951nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGC
TACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGA
TGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGT
GGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTC
CACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCA
CTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCT
TCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGG
CACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCC
CAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCAT
CAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCT
GGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAA

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_2957nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000345429_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_2376nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTCGTTCCATCTGTAAGAAGGACCAATGTCCA
AGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTGGAGCAGCTGGACCCAGGAAAGAAACCCCA
GGGGAGGGCACAGTGACGTTGGCGACCACCTGGCGCTGTGAAGGTGCACCAGGGAGCCCGTGGGGGAGGCTGGGCAGGAGCGAGGCCAGG
TGGCCACGCTGCCCCATCCGTTGGACTCCACACAGTGTGAGTGGGAGCGTCTCACTTGGCCCTTCCCCTGCAGTGTCTCTGCCTTCCTCT
ATTCCCAGGATATGCTTCTGCTTGGTGGTTTTGCTTTGAGAGTCTAGACTGGCCGATCTCCTTGTGTCTTTCTGGTGTGCGTGCAGCTTG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_3021nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGA
GGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTT
CTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCT
GCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCT
CTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTC
CCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGAC
ATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGAC
TGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAA
TTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCT
GCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAG
GCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGC
AGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTAT

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_2888nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTAC
AAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGA
ACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAG
TGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTG
TCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGT
ACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACT
GTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACC
CTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTC
TGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATT
CCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCAT
CAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGC
CTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGTGAAATAAATGTCCT

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_2958nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_2284nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_2951nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGC
TACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGA
TGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGT
GGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTC
CACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCA
CTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCT
TCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGG
CACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCC
CAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCAT
CAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCT
GGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAA

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_2957nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTAC
TTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCA
GGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCA
CAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGG
GCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCG
GCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGT
GTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTG
CTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCAT
GGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGG
TGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAA
TACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGA
AATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTC
TAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACT
GAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGA
GCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGT
GAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGC
TCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGA
GGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGC
TACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCT
TCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGA
CCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATG

>In-frame_MBNL2_ENST00000376673_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_2376nt
TGAAGGTAAAATTTTCCAGATACGGCAGACGGCTTTCAGAGTACAATAAACAGGGAATGAGAACTATTTACATGGAAGTTTCTTTCTCAT
GATGCGGTGGAGAAGCCTCGGCCACTTGGTTCTGCCAGATGTTCCTGGGGTTACTGTAAATGGGAAGGACAGGCAGAGCTAAACAAGGTT
TATCATTTAAAAGTGCCTGTGTGAAGTCACTTTTGCTGGAAAACTGCAGCTTGGGAGCTTTCTTTGTATTCACATCCCACTCTTCTGTCA
AGTACACTTTACCCTGACCTTATGAGTGGATGAAGATACCTCAGTTGTCTGACTTTGCCAATTGCTTAATTTCAGAATTTAAAAAGGGGA
AAGAAAAACATCCTGCTAAAATATGAACATCTGAGTGTCTTATTTTCCAACATCGTCAATAGCTGTGAGCGTCAGCATTAAATATTCTCC
CAAGGAGTGCCATGATATTGAAGTCACTTTATTAATAACAGCTGTATCTGCAAAACAGTCAAGAGACTCGGACGTTGAAAGCCAGAGATG
ACACTGAGCATGCTTTTATTGCGGCCTACCATCTTTAAGTGGGACATATTGATTGATGAGTGATTGCCTGTCCATACACTCTCTCATCAT
CCTGTTCCTTGGATTGGACTTCACTAAGCAATTTATCACTCACCTTCAGACTTACATGTGGGAGTTTTCACAACAGTAGTTTTGGAATCA
TTAGAACTTGGATTGATTTCATCATTTAACAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGA
TACAAAATGGCTGACATTAGAAGTCTGCAGACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCC
CAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGA
GAAGCTGGCAGGCAGCCCCATTCGTACTTCTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATC
CATGTGGGACCAGTTAGAGGATGCAGCTATGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGA
AGATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCT
TGGAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGAT
GAAGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGA
GGTGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGT
ACATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTA
TGAGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGAC
CCAGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAG
CATCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGG
GATCAACCTCAAATTCATGCACAATCAGGTAGGTGCGAGCGGCAGCACGAGGCTCCCTGTCGTTCCATCTGTAAGAAGGACCAATGTCCA
AGCCCCCAGTACTTCCCCAGCAAGCATGAGAGAGGGCCCTCTGGAGCTAGAGGGAGAACTGGAGCAGCTGGACCCAGGAAAGAAACCCCA
GGGGAGGGCACAGTGACGTTGGCGACCACCTGGCGCTGTGAAGGTGCACCAGGGAGCCCGTGGGGGAGGCTGGGCAGGAGCGAGGCCAGG
TGGCCACGCTGCCCCATCCGTTGGACTCCACACAGTGTGAGTGGGAGCGTCTCACTTGGCCCTTCCCCTGCAGTGTCTCTGCCTTCCTCT
ATTCCCAGGATATGCTTCTGCTTGGTGGTTTTGCTTTGAGAGTCTAGACTGGCCGATCTCCTTGTGTCTTTCTGGTGTGCGTGCAGCTTG

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000342922_chr11_47330142_+_2209nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC
AGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACAT
TTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTG
GGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATT
GGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGC
TGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGC
TAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAG
GCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402799_chr11_47330142_+_2209nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC
AGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACAT
TTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTG
GGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATT
GGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGC
TGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGC
TAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAG
GCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000311027_chr11_47330142_+_2272nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTA
TGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGG
AGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAG
ATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGA
AGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATG
GACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATA
TCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCA
ACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGT
GTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCG
AGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGG
TTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGGAATTTGTTCCTGAAATTAAAGAAGTGG
TGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTG
AGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCC
TTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGG
TTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGG
GCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCC
CTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGA
GGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCC
TCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAG
TGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTG
CTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAG
GAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAAATGTACAGTTGTGTGAATGT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000406482_chr11_47330142_+_2139nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTA
CTCCGTATTATGTCTCTTCTCGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATG
GAGAGGGGCTACGCAGCTGCCCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGG
ATGATGCTCGTGTGTCCTCTGCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCA
CCTTCTCCCTCTCCACTCCCAGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACT
ATTTTGTGTCCTTGAGACATTTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTC
TCTGTGACCCGGCATGACTGGGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCA
CAGAGAGGAAGGGAAGAATTGGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCA
GGGCCCGCAGTGTTGGCTGCTGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCA
GAGGATGGAGTGGTCGAGGCTAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGG
GTTTGCACATCTGTCTGCAGGCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAAT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000407859_chr11_47330142_+_2209nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC
AGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACAT
TTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTG
GGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATT
GGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGC
TGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGC
TAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAG
GCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000349238_chr11_47330142_+_2209nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC
AGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACAT
TTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTG
GGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATT
GGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGC
TGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGC
TAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAG
GCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395344_chr11_47330142_+_1535nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000395336_chr11_47330142_+_2202nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTA
TGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGG
AGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAG
ATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGA
AGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATG
GACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATA
TCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCA
ACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGT
GTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCG
AGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGT
TCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCTCGTACGT
GGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGCCCCAGCC
CAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCTGCAAGCC
CCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCCAGAAGAC
CAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACATTTGTGTT
GTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTGGGCGCCT
GGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATTGGGGGGC
AGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGCTGCCTGC
CACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGCTAGTGGA
GTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAGGCTGTCT
CTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTTATAGAAA

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000402192_chr11_47330142_+_2208nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAG
ATGCCTTCTTAGATGCTGTGATGTTGGAGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTG
GAGAACATGACCGGAAGCGCCTGGAAGATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGA
AGGTAAATAAGAATGACATCCGCAAGAAGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGG
TGCTTGATCAGCTGGCGAACCTGAATGGACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTAC
ATGCAGGGACAGATACAAACGGAGATATCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATG
AGCGCTGGTGGTACGAGAAGCTCATCAACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCC
AGCTCAACAAGTTCTATACTAAAAAGTGTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCA
TCAAACCCGGACCTGAATTGGGTGGCGAGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGA
TCAACCTCAAATTCATGCACAATCAGGTTTTCATAGAGCTGAATCACATTAAAAAGTGCAATACAGTTCGAGGCGTCTTTGTCCTGGAGG
AATTTGTTCCTGAAATTAAAGAAGTGGTGAGCCACAAGTACAAGACACCAATGGCCCACGAAATCTGCTACTCCGTATTATGTCTCTTCT
CGTACGTGGCTGCAGTTCATAGCAGTGAGGAAGATCTCAGAACCCCGCCCCGGCCTGTCTCTAGCTGATGGAGAGGGGCTACGCAGCTGC
CCCAGCCCAGGGCACGCCCCTGGCCCCTTGCTGTTCCCAAGTGCACGATGCTGCTGTGACTGAGGAGTGGATGATGCTCGTGTGTCCTCT
GCAAGCCCCCTGCTGTGGCTTGGTTGGTTACCGGTTATGTGTCCCTCTGAGTGTGTCTTGAGCGTGTCCACCTTCTCCCTCTCCACTCCC
AGAAGACCAAACTGCCTTCCCCTCAGGGCTCAAGAATGTGTACAGTCTGTGGGGCCGGTGTGAACCCACTATTTTGTGTCCTTGAGACAT
TTGTGTTGTGGTTCCTTGTCCTTGTCCCTGGCGTTATAACTGTCCACTGCAAGAGTCTGGCTCTCCCTTCTCTGTGACCCGGCATGACTG
GGCGCCTGGAGCAGTTTCACTCTGTGAGGAGTGAGGGAACCCTGGGGCTCACCCTCTCAGAGGAAGGGCACAGAGAGGAAGGGAAGAATT
GGGGGGCAGCCGGAGTGAGTGGCAGCCTCCCTGCTTCCTTCTGCATTCCCAAGCCGGCAGCTACTGCCCAGGGCCCGCAGTGTTGGCTGC
TGCCTGCCACAGCCTCTGTGACTGCAGTGGAGCGGCGAATTCCCTGTGGCCTGCCATGCCTTCGGCATCAGAGGATGGAGTGGTCGAGGC
TAGTGGAGTCCCAGGGACCGCTGGCTGCTCTGCCTGAGCATCAGGGAGGGGGCAGGAAAGACCAAGCTGGGTTTGCACATCTGTCTGCAG
GCTGTCTCTCCAGGCACGGGGTGTCAGGAGGGAGAGACAGCCTGGGTATGGGCAAGAAATGACTGTAAATATTTCAGCCCCACATTATTT

>In-frame_MBNL2_ENST00000445661_chr13_97928663_+_MADD_ENST00000405573_chr11_47330142_+_1627nt
CAGAAACAAACAGCCCAAATTACTTTATCACCATGGCTTTGAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA
GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTTGCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAG
TAATTGCCTGCTTTGATTCCCTAAAGGGTAAAGCCCACAGCTTGAAGCCAAGCATAAAGGAGAAGCTGGCAGGCAGCCCCATTCGTACTT
CTGAAGATGTGAGCCAGCGAGTCTATCTCTATGAGGGACTCCTAGGAAGGGACAAAGGATCCATGTGGGACCAGTTAGAGGATGCAGCTA
TGGAGACCTTTTCTATAAGCAAAGAGCGTTCTACTTTATGGGACCAAATGCAATTCTGGGAAGATGCCTTCTTAGATGCTGTGATGTTGG
AGAGAGAAGGGATGGGTATGGACCAGGGTCCCCAGGAAATGATCGACAGGTACCTGTCCCTTGGAGAACATGACCGGAAGCGCCTGGAAG
ATGATGAAGATCGCTTGTTGGCCACACTTCTGCACAACCTCATCTCCTACATGCTGCTGATGAAGGTAAATAAGAATGACATCCGCAAGA
AGGTGAGGCGCCTAATGGGAAAGTCGCACATTGGGCTTGTGTACAGCCAGCAAATCAATGAGGTGCTTGATCAGCTGGCGAACCTGAATG
GACGCGATCTCTCTATCTGGTCCAGTGGCAGCCGGCACATGAAGAAGCAGACATTTGTGGTACATGCAGGGACAGATACAAACGGAGATA
TCTTTTTCATGGAGGTGTGCGATGACTGTGTGGTGTTGCGTAGTAACATCGGAACAGTGTATGAGCGCTGGTGGTACGAGAAGCTCATCA
ACATGACCTACTGTCCCAAGACGAAGGTGTTGTGCTTGTGGCGTAGAAATGGCTCTGAGACCCAGCTCAACAAGTTCTATACTAAAAAGT
GTCGGGAGCTGTACTACTGTGTGAAGGACAGCATGGAGCGCGCTGCCGCCCGACAGCAAAGCATCAAACCCGGACCTGAATTGGGTGGCG
AGTTCCCTGTGCAGGACCTGAAGACTGGTGAGGGTGGCCTGCTGCAGGTGACCCTGGAAGGGATCAACCTCAAATTCATGCACAATCAGG
TAGGTGCGAGCGGCAGCACGAGGCTCCCTGTCGTTCCATCTGTAAGAAGGACCAATGTCCAAGCCCCCAGTACTTCCCCAGCAAGCATGA
GAGAGGGCCCTCTGGAGCTAGAGGGAGAACTGGAGCAGCTGGACCCAGGAAAGAAACCCCAGGGGAGGGCACAGTGACGTTGGCGACCAC
CTGGCGCTGTGAAGGTGCACCAGGGAGCCCGTGGGGGAGGCTGGGCAGGAGCGAGGCCAGGTGGCCACGCTGCCCCATCCGTTGGACTCC
ACACAGTGTGAGTGGGAGCGTCTCACTTGGCCCTTCCCCTGCAGTGTCTCTGCCTTCCTCTATTCCCAGGATATGCTTCTGCTTGGTGGT
TTTGCTTTGAGAGTCTAGACTGGCCGATCTCCTTGTGTCTTTCTGGTGTGCGTGCAGCTTGCGTGTGCGTGCGTGCGTGCCTGCGTGCTT


Top

FusionGenePPI for MBNL2_MADD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MBNL2ELAVL1, ENO1, NXF1, BMI1, MBNL1, HSD17B2, ACOX1, HNRNPLLMADDPIDD1, TNFRSF1A, YWHAZ, VPS13D, POT1, GRK5, SHMT2, SOCS6, NXPH2, PRMT6, SDF4, HLA-E, SYT6, NTRK1, RB1CC1, XPO1, MTMR8, SYT12, BBS7, SYT3, DOCK5, SNX21, TSPYL6, ALOX5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MBNL2_MADD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MBNL2_MADD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource