FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21171

FusionGeneSummary for MAX_TEX10

check button Fusion gene summary
Fusion gene informationFusion gene name: MAX_TEX10
Fusion gene ID: 21171
HgeneTgene
Gene symbol

MAX

TEX10

Gene ID

4149

54881

Gene nameMYC associated factor Xtestis expressed 10
SynonymsbHLHd4Ipi1|bA208F1.2
Cytomap

14q23.3

9q31.1

Type of geneprotein-codingprotein-coding
Descriptionprotein maxclass D basic helix-loop-helix protein 4testis-expressed protein 10testis expressed gene 10testis-expressed sequence 10 protein
Modification date2018052320180523
UniProtAcc

P61244

Q9NXF1

Ensembl transtripts involved in fusion geneENST00000341653, ENST00000358402, 
ENST00000555932, ENST00000284165, 
ENST00000358664, ENST00000555419, 
ENST00000557277, ENST00000556979, 
ENST00000555667, ENST00000557746, 
ENST00000556443, ENST00000246163, 
ENST00000535814, ENST00000374902, 
ENST00000477648, ENST00000537512, 
Fusion gene scores* DoF score4 X 2 X 4=322 X 1 X 2=4
# samples 42
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/4*10)=2.32192809488736
Context

PubMed: MAX [Title/Abstract] AND TEX10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAX

GO:0000122

negative regulation of transcription by RNA polymerase II

8521822


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-86-7953-01AMAXchr14

65560426

-TEX10chr9

103111654

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341653ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000341653ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000341653ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000341653ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000358402ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000358402ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000358402ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000358402ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
intron-3CDSENST00000555932ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
intron-5UTRENST00000555932ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
intron-intronENST00000555932ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
intron-intronENST00000555932ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000284165ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000284165ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000284165ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000284165ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000358664ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000358664ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000358664ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000358664ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
intron-3CDSENST00000555419ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
intron-5UTRENST00000555419ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
intron-intronENST00000555419ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
intron-intronENST00000555419ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
5UTR-3CDSENST00000557277ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5UTR-5UTRENST00000557277ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5UTR-intronENST00000557277ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5UTR-intronENST00000557277ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000556979ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000556979ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000556979ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000556979ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000555667ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000555667ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000555667ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000555667ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000557746ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000557746ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000557746ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000557746ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000556443ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000556443ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000556443ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000556443ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-
In-frameENST00000246163ENST00000535814MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-5UTRENST00000246163ENST00000374902MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000246163ENST00000477648MAXchr14

65560426

-TEX10chr9

103111654

-
5CDS-intronENST00000246163ENST00000537512MAXchr14

65560426

-TEX10chr9

103111654

-

Top

FusionProtFeatures for MAX_TEX10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAX

P61244

TEX10

Q9NXF1

Functions as a component of the Five Friends ofMethylated CHTOP (5FMC) complex; the 5FMC complex is recruited toZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 andsubsequent transactivation of ZNF148 target genes(PubMed:22872859). Component of the PELP1 complex involved in thenucleolar steps of 28S rRNA maturation and the subsequentnucleoplasmic transit of the pre-60S ribosomal subunit(PubMed:21326211). {ECO:0000269|PubMed:21326211,ECO:0000269|PubMed:22872859}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTEX10chr14:65560426chr9:103111654ENST00000374902-01599_137-3930RepeatNote=HEAT
TgeneTEX10chr14:65560426chr9:103111654ENST00000535814-01599_1371914RepeatNote=HEAT

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAXchr14:65560426chr9:103111654ENST00000246163-3423_745797DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000284165-3423_7457135DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000341653-3423_745784DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000358402-2423_7448152DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000358664-3523_7457161DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000556979-3523_7457104DomainbHLH
HgeneMAXchr14:65560426chr9:103111654ENST00000246163-34152_1565797MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000284165-34152_15657135MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000341653-34152_1565784MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000358402-24152_15648152MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000358664-35152_15657161MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000556979-35152_15657104MotifNote=Nuclear localization signal
HgeneMAXchr14:65560426chr9:103111654ENST00000246163-3481_1025797RegionNote=Leucine-zipper
HgeneMAXchr14:65560426chr9:103111654ENST00000284165-3481_10257135RegionNote=Leucine-zipper
HgeneMAXchr14:65560426chr9:103111654ENST00000341653-3481_1025784RegionNote=Leucine-zipper
HgeneMAXchr14:65560426chr9:103111654ENST00000358402-2481_10248152RegionNote=Leucine-zipper
HgeneMAXchr14:65560426chr9:103111654ENST00000358664-3581_10257161RegionNote=Leucine-zipper
HgeneMAXchr14:65560426chr9:103111654ENST00000556979-3581_10257104RegionNote=Leucine-zipper


Top

FusionGeneSequence for MAX_TEX10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAX_ENST00000341653_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_970aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPT
NFKTKTIHLPEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQL
LQFLAPKIRAEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILS
VNPNRRLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLV
GGLSGVDEGLSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDF
KHHFMSRFPYVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNR
LLGVSWRLMQIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELST
QLIDIIHTAAARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRS
SFSGWKYSAKDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFD
ILQSAISKHLVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVV

>In-frame_MAX_ENST00000358402_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_961aa
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPTNFKTKTIHL
PEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQLLQFLAPKIR
AEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILSVNPNRRLTS
QQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLVGGLSGVDEG
LSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDFKHHFMSRFP
YVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNRLLGVSWRLM
QIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELSTQLIDIIHTA
AARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRSSFSGWKYSA
KDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFDILQSAISKH
LVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVVGQLLRLLLQ

>In-frame_MAX_ENST00000284165_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_970aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPT
NFKTKTIHLPEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQL
LQFLAPKIRAEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILS
VNPNRRLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLV
GGLSGVDEGLSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDF
KHHFMSRFPYVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNR
LLGVSWRLMQIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELST
QLIDIIHTAAARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRS
SFSGWKYSAKDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFD
ILQSAISKHLVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVV

>In-frame_MAX_ENST00000358664_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_970aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPT
NFKTKTIHLPEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQL
LQFLAPKIRAEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILS
VNPNRRLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLV
GGLSGVDEGLSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDF
KHHFMSRFPYVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNR
LLGVSWRLMQIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELST
QLIDIIHTAAARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRS
SFSGWKYSAKDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFD
ILQSAISKHLVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVV

>In-frame_MAX_ENST00000556979_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_970aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPT
NFKTKTIHLPEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQL
LQFLAPKIRAEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILS
VNPNRRLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLV
GGLSGVDEGLSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDF
KHHFMSRFPYVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNR
LLGVSWRLMQIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELST
QLIDIIHTAAARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRS
SFSGWKYSAKDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFD
ILQSAISKHLVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVV

>In-frame_MAX_ENST00000555667_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_961aa
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPTNFKTKTIHL
PEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQLLQFLAPKIR
AEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILSVNPNRRLTS
QQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLVGGLSGVDEG
LSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDFKHHFMSRFP
YVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNRLLGVSWRLM
QIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELSTQLIDIIHTA
AARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRSSFSGWKYSA
KDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFDILQSAISKH
LVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVVGQLLRLLLQ

>In-frame_MAX_ENST00000557746_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_961aa
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPTNFKTKTIHL
PEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQLLQFLAPKIR
AEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILSVNPNRRLTS
QQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLVGGLSGVDEG
LSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDFKHHFMSRFP
YVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNRLLGVSWRLM
QIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELSTQLIDIIHTA
AARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRSSFSGWKYSA
KDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFDILQSAISKH
LVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVVGQLLRLLLQ

>In-frame_MAX_ENST00000556443_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_961aa
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPTNFKTKTIHL
PEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQLLQFLAPKIR
AEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILSVNPNRRLTS
QQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLVGGLSGVDEG
LSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDFKHHFMSRFP
YVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNRLLGVSWRLM
QIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELSTQLIDIIHTA
AARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRSSFSGWKYSA
KDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFDILQSAISKH
LVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVVGQLLRLLLQ

>In-frame_MAX_ENST00000246163_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_970aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKSRMTKKRKRQHDFQKVKLKVGKKKPKLQNATPT
NFKTKTIHLPEQLKEDGTLPTNNRKLNIKDLLSQMHHYNAGVKQSALLGLKDLLSQYPFIIDAHLSNILSEVTAVFTDKDANVRLAAVQL
LQFLAPKIRAEQISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEQYPALITGRSSILLKNFVELISHQQLSKGLINRDRSQSWILS
VNPNRRLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIFINWKEHANDQQHIQVYENGGSQPNVSSQFRLRYLV
GGLSGVDEGLSSTENLKGFIEIIIPLLIECWVEAVPPQLATPVGNGIEREPLQVMQQVLNIISLLWKLSKQQDETHKLESWLRKNYLIDF
KHHFMSRFPYVLKEITKHKRKEPNKSIKHCTVLSNNIDHLLLNLTLSDIMVSLANASTLQKDCSWIEMIRKFVTETLEDGSRLNSKQLNR
LLGVSWRLMQIQPNREDTETLIKAVYTLYQQRGLILPVRTLLLKFFSKIYQTEELRSCRFRYRSKVLSRWLAGLPLQLAHLGSRNPELST
QLIDIIHTAAARANKELLKSLQATALRIYDPQEGAVVVLPADSQQRLVQLVYFLPSLPADLLSRLSRCCIMGRLSSSLAAMLIGILHMRS
SFSGWKYSAKDWLMSDVDYFSFLFSTLTGFSKEELTWLQSLRGVPHVIQTQLSPVLLYLTDLDQFLHHWDVTEAVFHSLLVIPARSQNFD
ILQSAISKHLVGLTVIPDSTAGCVFGVICKLLDHTCVVSETLLPFLASCCYSLLYFLLTIEKGEAEHLRKRLMLQSLRVNRVGPEELPVV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAX_ENST00000341653_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2910nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCA
CTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATG
ACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACA
AACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGAT
TTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATA
ATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTT
CTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCAC
ATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATA
TTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCT
GTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGA
TCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAA
CATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTT
GGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGC
TGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAAT
ATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTT
AAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGC
ACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAG
AAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGA
TTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAG
CAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTC
AGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACA
CAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGAT
CCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGAT
TTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCA
TCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTT
TCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACA
GATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGAC
ATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAG
CTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATA
GAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTG
GGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAAT
ATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAA

>In-frame_MAX_ENST00000358402_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2883nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATC
AAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGAT
TTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTG
CCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAAT
GCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTA
AGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGA
GCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCT
TTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATT
TCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCT
CAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGA
CTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAG
GTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGC
CTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTA
GCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCT
AAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCA
TATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCAT
CTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATA
AGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATG
CAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGG
ACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGT
TGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCT
GCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTC
CCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGT
ATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCT
AAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAG
AGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGG
GATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCAT
TTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGT
GAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGA
AAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAG
CATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTT
CAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTAT

>In-frame_MAX_ENST00000284165_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2910nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCA
CTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATG
ACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACA
AACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGAT
TTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATA
ATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTT
CTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCAC
ATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATA
TTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCT
GTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGA
TCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAA
CATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTT
GGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGC
TGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAAT
ATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTT
AAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGC
ACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAG
AAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGA
TTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAG
CAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTC
AGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACA
CAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGAT
CCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGAT
TTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCA
TCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTT
TCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACA
GATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGAC
ATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAG
CTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATA
GAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTG
GGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAAT
ATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAA

>In-frame_MAX_ENST00000358664_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2910nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCA
CTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATG
ACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACA
AACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGAT
TTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATA
ATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTT
CTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCAC
ATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATA
TTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCT
GTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGA
TCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAA
CATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTT
GGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGC
TGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAAT
ATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTT
AAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGC
ACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAG
AAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGA
TTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAG
CAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTC
AGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACA
CAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGAT
CCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGAT
TTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCA
TCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTT
TCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACA
GATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGAC
ATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAG
CTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATA
GAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTG
GGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAAT
ATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAA

>In-frame_MAX_ENST00000556979_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2910nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCA
CTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATG
ACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACA
AACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGAT
TTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATA
ATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTT
CTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCAC
ATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATA
TTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCT
GTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGA
TCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAA
CATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTT
GGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGC
TGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAAT
ATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTT
AAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGC
ACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAG
AAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGA
TTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAG
CAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTC
AGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACA
CAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGAT
CCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGAT
TTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCA
TCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTT
TCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACA
GATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGAC
ATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAG
CTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATA
GAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTG
GGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAAT
ATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAA

>In-frame_MAX_ENST00000555667_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2883nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATC
AAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGAT
TTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTG
CCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAAT
GCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTA
AGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGA
GCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCT
TTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATT
TCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCT
CAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGA
CTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAG
GTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGC
CTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTA
GCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCT
AAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCA
TATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCAT
CTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATA
AGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATG
CAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGG
ACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGT
TGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCT
GCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTC
CCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGT
ATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCT
AAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAG
AGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGG
GATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCAT
TTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGT
GAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGA
AAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAG
CATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTT
CAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTAT

>In-frame_MAX_ENST00000557746_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2883nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATC
AAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGAT
TTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTG
CCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAAT
GCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTA
AGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGA
GCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCT
TTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATT
TCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCT
CAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGA
CTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAG
GTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGC
CTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTA
GCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCT
AAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCA
TATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCAT
CTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATA
AGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATG
CAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGG
ACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGT
TGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCT
GCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTC
CCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGT
ATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCT
AAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAG
AGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGG
GATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCAT
TTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGT
GAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGA
AAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAG
CATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTT
CAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTAT

>In-frame_MAX_ENST00000556443_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2883nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATC
AAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGAT
TTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTG
CCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAAT
GCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTA
AGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGA
GCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCT
TTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATT
TCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCT
CAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGA
CTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAG
GTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGC
CTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTA
GCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCT
AAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCA
TATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCAT
CTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATA
AGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATG
CAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGG
ACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGT
TGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCT
GCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTC
CCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGT
ATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCT
AAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAG
AGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGG
GATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCAT
TTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGT
GAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGA
AAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAG
CATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTT
CAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTAT

>In-frame_MAX_ENST00000246163_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_2910nt
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCA
CTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATG
ACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACA
AACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGAT
TTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATA
ATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTT
CTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCAC
ATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATA
TTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCT
GTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGA
TCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAA
CATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTT
GGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGC
TGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAAT
ATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTT
AAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGC
ACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAG
AAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGA
TTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAG
CAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTC
AGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACA
CAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGAT
CCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGAT
TTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCA
TCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTT
TCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACA
GATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGAC
ATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAG
CTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATA
GAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTG
GGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAAT
ATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAX_ENST00000341653_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3072nt
TTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAG
CAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCAC
AGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAA
TTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAA
GAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAA
AGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCT
GTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCT
CCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGAC
ATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTG
TCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTG
AAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAA
GAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGG
GGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAA
AACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGG
AATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAA
ACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAA
ATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTA
ACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACA
GAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAAC
AGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAG
TTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTA
CCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAAT
AAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAG
CAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTC
AGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATG
AGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTT
CCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCA
GTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACT
GTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCA
TTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTG
CAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGG
ACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTC
ACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTGAAGAGGCCATAGT
ACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAAAGCTGAACTTTTA

>In-frame_MAX_ENST00000358402_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3162nt
TTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTCGGCTTGTTGTTGT
CGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGAT
GACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCAC
AGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAA
TTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAA
GAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAA
AGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCT
GTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCT
CCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGAC
ATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTG
TCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTG
AAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAA
GAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGG
GGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAA
AACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGG
AATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAA
ACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAA
ATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTA
ACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACA
GAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAAC
AGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAG
TTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTA
CCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAAT
AAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAG
CAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTC
AGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATG
AGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTT
CCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCA
GTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACT
GTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCA
TTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTG
CAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGG
ACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTC
ACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTGAAGAGGCCATAGT
ACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAAAGCTGAACTTTTA

>In-frame_MAX_ENST00000284165_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3173nt
GTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTCGGCTTGTTGTTGTCGGTGACTTCCCCCTC
CCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGATGACATCGAGGTGGAGA
GCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAG
ACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTTTC
AAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCCTG
AGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGCTG
GGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAGTG
AAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGCTG
AACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTTAA
AAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTCTC
ATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCAGC
AATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACTTC
AGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGTTT
ATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCTGT
CATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGCTA
CTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAAAC
AACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATATG
TCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCTCT
TACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAGGA
AATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCAAA
TACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGACTT
TGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTGGC
TGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGCAG
CACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCCTG
CAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTATTA
TGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAAAG
ACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAGCC
TTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGATG
TAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTTGG
TTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGAGA
CTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAAGA
GGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCATG
CACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCAGG
AACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTGAA
GAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAAAG

>In-frame_MAX_ENST00000358664_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3155nt
GAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTCGGCTTGTTGTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCT
CCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGA
GGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGC
GGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAG
TTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATG
GAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTC
TTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTA
CAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTT
TTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGC
TGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAG
GACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCT
TAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATC
CCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCAC
AGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGA
AAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTA
TAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATA
AATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCA
AGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGT
CTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCC
TTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGG
ACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCA
GTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGC
AACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAAT
TACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTT
TGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAA
GTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATG
TAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATG
TCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTC
ACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTC
CTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGG
CTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCC
TGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATA
TGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACT
TACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTGAAGAGGCCATAGTACCTCCT
GTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAAAGCTGAACTTTTAAAGAAGT

>In-frame_MAX_ENST00000556979_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3202nt
AGTGAGGAGGTGGTTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTC
GGCTTGTTGTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAAT
GAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACT
GGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGAC
TAAAAAAAGAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAA
CTTTAAAACAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTT
GCTGTCACAGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAAT
TGATGCACACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCT
TCAATTCCTGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACAT
TACTGAAGGAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATT
GCTTAAGAATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGT
AAATCCTAATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATC
CAGTAGGTTGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACA
TGCCAACGACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGG
AGGACTGAGTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTG
GGTTGAAGCTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATAT
TATTTCCCTTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAA
ACACCATTTTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCAC
AGTTCTCTCCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAA
GGATTGCAGTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATT
GCTGGGAGTATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCA
GAGGGGCCTTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAG
ATATCGTAGTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACA
GCTTATCGATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCC
ACAAGAAGGTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTT
GCTTTCTCGGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATC
ATTTTCTGGGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTC
GAAAGAGGAGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGA
TTTGGATCAATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACAT
CTTGCAAAGTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCT
CCTGGATCATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGA
GAAAGGGGAAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGG
CCAGCTGCTTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATAT
CACGACATTGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGG
GCCCAGTGCACTGGCTACAGTGTATTGAAGAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAG

>In-frame_MAX_ENST00000555667_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3175nt
AGTGAGGAGGTGGTTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTC
GGCTTGTTGTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAAT
GAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAA
AGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTT
TCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCC
TGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGC
TGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAG
TGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGC
TGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTT
AAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTC
TCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCA
GCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACT
TCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGT
TTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCT
GTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGC
TACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAA
ACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATA
TGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCT
CTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAG
GAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCA
AATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGAC
TTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTG
GCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGC
AGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCC
TGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTAT
TATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAA
AGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAG
CCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGA
TGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTT
GGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGA
GACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAA
GAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCA
TGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCA
GGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTG
AAGAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAA

>In-frame_MAX_ENST00000557746_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3175nt
AGTGAGGAGGTGGTTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTC
GGCTTGTTGTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAAT
GAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAA
AGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTT
TCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCC
TGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGC
TGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAG
TGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGC
TGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTT
AAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTC
TCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCA
GCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACT
TCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGT
TTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCT
GTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGC
TACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAA
ACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATA
TGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCT
CTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAG
GAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCA
AATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGAC
TTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTG
GCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGC
AGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCC
TGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTAT
TATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAA
AGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAG
CCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGA
TGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTT
GGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGA
GACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAA
GAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCA
TGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCA
GGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTG
AAGAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAA

>In-frame_MAX_ENST00000556443_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3175nt
AGTGAGGAGGTGGTTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTC
GGCTTGTTGTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAAT
GAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAA
AGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAAGAAAACGCCAACATGATTT
TCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAACAAAGACTATACATCTGCC
TGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCACAGATGCATCACTACAATGC
TGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCACACCTTTCAAACATATTAAG
TGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCCTGGCCCCCAAAATACGAGC
TGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAGGAATTCAGGAGGACTCTTT
AAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGAATTTTGTAGAACTTATTTC
TCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTAATCGGAGACTCACTTCTCA
GCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGTTGAGAGAAAGTGAAGGACT
TCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACGACCAGCAACACATCCAGGT
TTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGAGTGGTGTGGATGAAGGCCT
GTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAGCTGTACCTCCACAACTAGC
TACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCCTTCTGTGGAAACTCTCTAA
ACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATTTTATGAGTCGTTTTCCATA
TGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCTCCAATAACATAGATCATCT
CTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCAGTTGGATAGAAATGATAAG
GAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAGTATCCTGGAGGTTAATGCA
AATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCCTTATCCTTCCAGTTCGGAC
TTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTAGTAAAGTGTTATCCCGTTG
GCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCGATATCATTCATACCGCTGC
AGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAGGTGCTGTGGTGGTTCTCCC
TGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTCGGTTAAGTCGTTGCTGTAT
TATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTGGGTGGAAGTATTCAGCTAA
AGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGGAGTTGACTTGGCTTCAGAG
CCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATCAATTTTTACACCACTGGGA
TGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAAGTGCCATCAGTAAGCATTT
GGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATCATACTTGTGTAGTTAGTGA
GACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGGAAGCAGAACATCTAAGAAA
GAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGCTTCGACTGCTGCTTCAGCA
TGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACATTGAAGAGTGGAAGTGTTCA
GGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTGCACTGGCTACAGTGTATTG
AAGAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGTAATAGATCTTTGTCATTAA

>In-frame_MAX_ENST00000246163_chr14_65560426_-_TEX10_ENST00000535814_chr9_103111654_-_3194nt
GGTGGTTCTTGCCCGTGTTGTGTGTGTGTGTGAGTGAGAGAGCGAGTGAGTGAGTGAGTGAGTGTGTGTGTGGGGGGGACTCGGCTTGTT
GTTGTCGGTGACTTCCCCCTCCCCTTCACCCCTTCCCCTCCCCGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATA
ACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCATCATAATGCACTGGAACGAA
AACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGTCGAGAATGACTAAAAAAA
GAAAACGCCAACATGATTTTCAAAAAGTAAAATTGAAAGTTGGTAAAAAGAAGCCCAAGTTACAAAATGCTACTCCTACAAACTTTAAAA
CAAAGACTATACATCTGCCTGAGCAACTCAAAGAGGATGGAACACTTCCAACAAACAATAGAAAACTTAACATAAAGGATTTGCTGTCAC
AGATGCATCACTACAATGCTGGGGTTAAACAAAGTGCTCTTCTTGGACTTAAAGACCTTTTGTCTCAATACCCATTTATAATTGATGCAC
ACCTTTCAAACATATTAAGTGAAGTGACTGCTGTGTTTACAGATAAAGATGCTAATGTACGATTAGCAGCAGTTCAACTTCTTCAATTCC
TGGCCCCCAAAATACGAGCTGAACAAATTTCTCCATTTTTTCCTTTGGTAAGTGCCCATCTCTCTAGTGCCATGACTCACATTACTGAAG
GAATTCAGGAGGACTCTTTAAAAGTTTTGGACATTCTGCTGGAACAGTACCCAGCTCTAATTACTGGCCGTAGCAGCATATTGCTTAAGA
ATTTTGTAGAACTTATTTCTCATCAGCAGCTGTCCAAAGGACTGATAAATAGAGACAGATCCCAGTCCTGGATACTTTCTGTAAATCCTA
ATCGGAGACTCACTTCTCAGCAATGGAGGCTGAAAGTCTTAGTGAGACTCAGTAAATTCCTTCAGGCCTTGGCAGATGGATCCAGTAGGT
TGAGAGAAAGTGAAGGACTTCAGGAACAGAAAGAAAATCCCCATGCCACTAGCAACTCCATTTTTATCAACTGGAAGGAACATGCCAACG
ACCAGCAACACATCCAGGTTTATGAAAATGGGGGTTCACAGCCAAATGTCAGTTCACAGTTCAGGCTACGGTATCTGGTTGGAGGACTGA
GTGGTGTGGATGAAGGCCTGTCATCTACTGAAAACCTGAAAGGATTTATTGAGATAATAATTCCATTGCTAATTGAATGCTGGGTTGAAG
CTGTACCTCCACAACTAGCTACTCCTGTTGGGAATGGTATAGAACGAGAACCTCTACAGGTTATGCAGCAAGTTCTTAATATTATTTCCC
TTCTGTGGAAACTCTCTAAACAACAGGATGAAACCCATAAATTGGAGTCATGGCTTCGAAAGAACTACCTTATTGATTTTAAACACCATT
TTATGAGTCGTTTTCCATATGTCTTAAAAGAAATAACCAAGCACAAAAGGAAAGAGCCAAATAAAAGCATCAAGCATTGCACAGTTCTCT
CCAATAACATAGATCATCTCTTACTGAATTTAACACTGTCTGATATCATGGTCTCCCTGGCAAATGCGTCAACTTTGCAGAAGGATTGCA
GTTGGATAGAAATGATAAGGAAATTTGTAACAGAGACCCTTGAAGATGGCTCTAGGCTAAATAGTAAGCAACTGAACAGATTGCTGGGAG
TATCCTGGAGGTTAATGCAAATACAGCCAAACAGAGAGGACACAGAGACTCTTATTAAGGCAGTTTATACATTATATCAGCAGAGGGGCC
TTATCCTTCCAGTTCGGACTTTGTTATTGAAGTTTTTCAGTAAAATCTATCAGACAGAAGAACTGAGATCTTGTAGATTCAGATATCGTA
GTAAAGTGTTATCCCGTTGGCTGGCTGGCTTACCATTGCAACTTGCTCATCTTGGCTCCCGAAATCCTGAGCTCTCTACACAGCTTATCG
ATATCATTCATACCGCTGCAGCACGAGCAAATAAAGAATTACTAAAAAGTTTACAAGCTACTGCCCTCCGAATTTATGATCCACAAGAAG
GTGCTGTGGTGGTTCTCCCTGCAGACTCTCAGCAGCGTTTGGTTCAGCTTGTATATTTCCTACCCAGTCTGCCGGCTGATTTGCTTTCTC
GGTTAAGTCGTTGCTGTATTATGGGAAGACTCAGTTCAAGTTTGGCTGCCATGCTTATCGGGATACTGCACATGAGATCATCATTTTCTG
GGTGGAAGTATTCAGCTAAAGACTGGTTGATGAGTGATGTAGACTATTTCAGCTTCTTATTTTCCACACTTACAGGGTTTTCGAAAGAGG
AGTTGACTTGGCTTCAGAGCCTTCGAGGAGTTCCTCATGTCATCCAGACACAGCTTTCCCCTGTGCTTCTCTACCTTACAGATTTGGATC
AATTTTTACACCACTGGGATGTAACAGAGGCAGTTTTTCACAGTTTATTGGTTATTCCTGCCCGAAGTCAGAACTTTGACATCTTGCAAA
GTGCCATCAGTAAGCATTTGGTTGGGTTGACTGTAATTCCTGACAGCACGGCTGGCTGTGTTTTTGGTGTTATCTGTAAGCTCCTGGATC
ATACTTGTGTAGTTAGTGAGACTCTACTGCCATTTCTGGCTTCTTGTTGCTACAGTCTTCTTTATTTTCTGCTCACTATAGAGAAAGGGG
AAGCAGAACATCTAAGAAAGAGGTTGATGCTGCAGAGCCTGCGGGTGAACAGAGTTGGGCCTGAGGAGCTGCCTGTTGTGGGCCAGCTGC
TTCGACTGCTGCTTCAGCATGCACCCCTCAGGACTCATATGTTGACCAATGCGATCTTGGTGCAGCAGATCATCAAGAATATCACGACAT
TGAAGAGTGGAAGTGTTCAGGAACAGTGGCTCACAGACTTACATTACTGCTTCAACGTGTATATCACTGGGCATCCCCAAGGGCCCAGTG
CACTGGCTACAGTGTATTGAAGAGGCCATAGTACCTCCTGTTTGAAGTTGTTTATTCACATCTATCTTATTTGAAGAAAAAGACTGATGT


Top

FusionGenePPI for MAX_TEX10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAXPLEKHF2, MXI1, MYC, KAT2A, TRRAP, EP400, MSH2, MYCN, MYCL, SPAG9, MXD1, ZBTB17, MXD3, MXD4, SMAD3, SMAD4, TEAD1, MNT, MAX, KDM5C, EP300, CUX1, TAF1, CLIP2, COPS5, MGA, PLEKHA5, TXLNG, CEBPA, HNRNPU, YY1, HIF1A, EPAS1, CCNT1, PIM1, DMAP1, WDR5, KAT5, BRD8, PCGF6, HSPA1A, USF1, PPP1CA, PPP1CB, PPP1CC, SNIP1, DYNC1H1, CSTF2, HNRNPH2, ARL6IP5, CPSF6, KMT2D, HSP90AA1, PLIN3, GABBR1, FTH1, RPL35, FUS, RPL34, TUBA1A, USP37, FBXW11, BANP, UNC45A, XPO1, MAPK14, L3MBTL2, MECP2, SIN3A, E2F6, RNF2, EEF1D, FOXK2, MORC2, SMARCA5, RECQL, SAP130, BAZ1A, FOXK1, H2AFY, SMARCA1, TBP, TFAP2A, TFDP1, TWIST1, WIZ, YEATS4, RPA2, MTERF1, VRK3, LIG3, XRCC1, FBXW7, FOXR1, FOXR2, DNMT3L, POU5F1, BFSP2, TCP10L, ARNTL, RPRD1A, HAUS6, PHLDB3, PTRF, PHF21A, OIP5, CCDC93, CCDC132, HMG20A, RCOR1, GRIPAP1, DZIP3, VPS53, PSMD9, CLOCK, GOLGA5, RABGAP1L, TUFT1, CCHCR1, KDM1A, TFPT, NCKAP5L, GIT2, NUF2, THAP11, JUN, PKN3, RABGEF1, TRIM25TEX10USP42, SLX4, SIRT7, LAS1L, MDN1, PTPN12, PELP1, SOX2, RPA3, RPA2, RPA1, CUL7, OBSL1, RNF2, SUMO2, RPL13, NPM1, RPS2, WDR18, HIST1H2BA, NTRK1, GNL3, NOL9, SENP3, IFI16, HERC2, RPL10, KIF2C, FOXQ1, CDC14B, DUSP5, TNFRSF13B, PHF19, MECP2, NEUROG3, HIST1H1E, RBM4, H2AFY2, ZBTB48, PDGFB, RSBN1, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAX_TEX10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAX_TEX10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMAXC0031511Pheochromocytoma1CTD_human