FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21093

FusionGeneSummary for MARK3_TDRD9

check button Fusion gene summary
Fusion gene informationFusion gene name: MARK3_TDRD9
Fusion gene ID: 21093
HgeneTgene
Gene symbol

MARK3

TDRD9

Gene ID

4140

122402

Gene namemicrotubule affinity regulating kinase 3tudor domain containing 9
SynonymsCTAK1|KP78|PAR1A|Par-1aC14orf75|HIG-1|HLS|NET54|SPNE
Cytomap

14q32.32-q32.33

14q32.33

Type of geneprotein-codingprotein-coding
DescriptionMAP/microtubule affinity-regulating kinase 3C-TAK1ELKL motif kinase 2EMK-2cdc25C-associated protein kinase 1protein kinase STK10ser/Thr protein kinase PAR-1serine/threonine-protein kinase p78ATP-dependent RNA helicase TDRD9hypoxia-inducible HIG-1putative ATP-dependent RNA helicase TDRD9tudor domain-containing protein 9
Modification date2018052320180523
UniProtAcc

P27448

Q8NDG6

Ensembl transtripts involved in fusion geneENST00000440884, ENST00000416682, 
ENST00000429436, ENST00000303622, 
ENST00000216288, ENST00000553942, 
ENST00000335102, ENST00000561071, 
ENST00000409874, ENST00000339063, 
ENST00000554571, 
Fusion gene scores* DoF score17 X 13 X 8=17682 X 2 X 2=8
# samples 202
** MAII scorelog2(20/1768*10)=-3.14404636961671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: MARK3 [Title/Abstract] AND TDRD9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMARK3

GO:0018105

peptidyl-serine phosphorylation

9543386

HgeneMARK3

GO:0032092

positive regulation of protein binding

9543386

HgeneMARK3

GO:0035331

negative regulation of hippo signaling

28087714

HgeneMARK3

GO:0036289

peptidyl-serine autophosphorylation

9543386


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-77-7139-01AMARK3chr14

103958371

+TDRD9chr14

104506533

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000440884ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000440884ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000440884ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000416682ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000416682ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000416682ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000429436ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000429436ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000429436ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000303622ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000303622ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000303622ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000216288ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000216288ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000216288ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000553942ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000553942ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000553942ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
In-frameENST00000335102ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000335102ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
5CDS-intronENST00000335102ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+
3UTR-3CDSENST00000561071ENST00000409874MARK3chr14

103958371

+TDRD9chr14

104506533

+
3UTR-intronENST00000561071ENST00000339063MARK3chr14

103958371

+TDRD9chr14

104506533

+
3UTR-intronENST00000561071ENST00000554571MARK3chr14

103958371

+TDRD9chr14

104506533

+

Top

FusionProtFeatures for MARK3_TDRD9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MARK3

P27448

TDRD9

Q8NDG6

ATP-binding RNA helicase required during spermatogenesis(PubMed:28536242). Required to repress transposable elements andprevent their mobilization, which is essential for the germlineintegrity. Acts via the piRNA metabolic process, which mediatesthe repression of transposable elements during meiosis by formingcomplexes composed of piRNAs and Piwi proteins and governs themethylation and subsequent repression of transposons. Actsdownstream of piRNA biogenesis: exclusively required fortransposon silencing in the nucleus, suggesting that it acts as anuclear effector in the nucleus together with PIWIL4.{ECO:0000250|UniProtKB:Q14BI7, ECO:0000269|PubMed:28536242}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMARK3chr14:103958371chr14:104506533ENST00000216288+1516326_365598714DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000216288+151656_307598714DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000303622+1516326_365614730DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000303622+151656_307614730DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000416682+1617326_365637753DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000416682+161756_307637753DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000429436+1518326_365614754DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000429436+151856_307614754DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000440884+1416326_365535660DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000440884+141656_307535660DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000553942+1517326_365614745DomainUBA
HgeneMARK3chr14:103958371chr14:104506533ENST00000553942+151756_307614745DomainProtein kinase
HgeneMARK3chr14:103958371chr14:104506533ENST00000216288+151662_70598714Nucleotide bindingATP
HgeneMARK3chr14:103958371chr14:104506533ENST00000303622+151662_70614730Nucleotide bindingATP
HgeneMARK3chr14:103958371chr14:104506533ENST00000416682+161762_70637753Nucleotide bindingATP
HgeneMARK3chr14:103958371chr14:104506533ENST00000429436+151862_70614754Nucleotide bindingATP
HgeneMARK3chr14:103958371chr14:104506533ENST00000440884+141662_70535660Nucleotide bindingATP
HgeneMARK3chr14:103958371chr14:104506533ENST00000553942+151762_70614745Nucleotide bindingATP
TgeneTDRD9chr14:103958371chr14:104506533ENST00000339063+031142_308-101192DomainHelicase ATP-binding
TgeneTDRD9chr14:103958371chr14:104506533ENST00000339063+031377_544-101192DomainHelicase C-terminal
TgeneTDRD9chr14:103958371chr14:104506533ENST00000339063+031944_1004-101192DomainTudor
TgeneTDRD9chr14:103958371chr14:104506533ENST00000339063+031254_257-101192MotifDEAH box
TgeneTDRD9chr14:103958371chr14:104506533ENST00000339063+031155_162-101192Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMARK3chr14:103958371chr14:104506533ENST00000216288+1516704_753598714DomainKA1
HgeneMARK3chr14:103958371chr14:104506533ENST00000303622+1516704_753614730DomainKA1
HgeneMARK3chr14:103958371chr14:104506533ENST00000416682+1617704_753637753DomainKA1
HgeneMARK3chr14:103958371chr14:104506533ENST00000429436+1518704_753614754DomainKA1
HgeneMARK3chr14:103958371chr14:104506533ENST00000440884+1416704_753535660DomainKA1
HgeneMARK3chr14:103958371chr14:104506533ENST00000553942+1517704_753614745DomainKA1
TgeneTDRD9chr14:103958371chr14:104506533ENST00000409874+3136142_30812381383DomainHelicase ATP-binding
TgeneTDRD9chr14:103958371chr14:104506533ENST00000409874+3136377_54412381383DomainHelicase C-terminal
TgeneTDRD9chr14:103958371chr14:104506533ENST00000409874+3136944_100412381383DomainTudor
TgeneTDRD9chr14:103958371chr14:104506533ENST00000409874+3136254_25712381383MotifDEAH box
TgeneTDRD9chr14:103958371chr14:104506533ENST00000409874+3136155_16212381383Nucleotide bindingATP


Top

FusionGeneSequence for MARK3_TDRD9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MARK3_ENST00000440884_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_680aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
ELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESL
SKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTS
TADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENS
TIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRIDQN
GKYYTGVLCGLGWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQSKPR

>In-frame_MARK3_ENST00000416682_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_782aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQGCQAGQTIKVQVSFDLLSL
MFTFIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLV
SGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVG
MGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIP
SVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTAD
RHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSK
LTSKLTRRIDQNGKYYTGVLCGLGWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQ

>In-frame_MARK3_ENST00000429436_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_759aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY
RIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGI
SSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRIDQNGKYYTGVLCGL
GWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQSKPREKIVPKWHEKP

>In-frame_MARK3_ENST00000303622_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_759aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY
RIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGI
SSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRIDQNGKYYTGVLCGL
GWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQSKPREKIVPKWHEKP

>In-frame_MARK3_ENST00000216288_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_743aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY
RIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSEVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIA
PASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFP
RGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRIDQNGKYYTGVLCGLGWNPATGASILPEHDM
ELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQSKPREKIVPKWHEKPYEWNQVDPKLVMEQAD

>In-frame_MARK3_ENST00000553942_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_759aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY
RIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGI
SSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRIDQNGKYYTGVLCGL
GWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQKLLGLFCQSKPREKIVPKWHEKP

>In-frame_MARK3_ENST00000335102_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_782aa
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKT
QLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQGCQAGQTIKVQVSFDLLSL
MFTFIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLV
SGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVG
MGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSDHAGPAIP
SVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTAD
RHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSK
LTSKLTRRIDQNGKYYTGVLCGLGWNPATGASILPEHDMELAFDVQFSVEDVVEVNILRAAINKLVCDGPNGCKCLGPERVAQLQDIARQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MARK3_ENST00000440884_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2040nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAG
GAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTG
CTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTT
GTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTT
AGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGC
AGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTT
TTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGC
ACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGT
CCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCT
GGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGC
ACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACT
GCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAA
GCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAAT
GGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCG
TTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGA
TGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGG
GAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGC

>In-frame_MARK3_ENST00000416682_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2346nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGGGTTGTCAAGCTGGACAGACTATTAAAGTTCAAGTCTCCTTTGATTTGCTTAGTCTG
ATGTTTACATTTATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGAT
GCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCA
TACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTC
AGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCT
ACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATC
AATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGA
ATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAA
TCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACT
GGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCT
TCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGC
AGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAG
AAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGAT
AGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCA
GCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATAT
AATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAA
TTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGG
GCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCT
GCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAG
AAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGAT
CCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGC

>In-frame_MARK3_ENST00000429436_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2277nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAG
GCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGAC
ACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGG
GTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATAC
AGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAA
ATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAA
AGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACA
TATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGC
AGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGAC
CATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATT
TCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAG
GCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGC
AGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCA
ACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGG
GAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGC
TCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTG
GGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTC
GAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAG
CTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCC
TACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTC

>In-frame_MARK3_ENST00000303622_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2277nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAG
GCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGAC
ACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGG
GTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATAC
AGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAA
ATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAA
AGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACA
TATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGC
AGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGAC
CATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATT
TCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAG
GCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGC
AGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCA
ACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGG
GAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGC
TCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTG
GGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTC
GAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAG
CTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCC
TACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTC

>In-frame_MARK3_ENST00000216288_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2229nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAG
GCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGAC
ACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGG
GTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATAC
AGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAA
ATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAA
AGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACA
TATTTGTTATTGGGGAGAAAATCTTCAGAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAG
AGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGT
CAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCT
CCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAAC
ACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAA
GAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCA
AGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTG
TCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATT
GATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATG
GAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGA
CCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCA
AAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGAC

>In-frame_MARK3_ENST00000553942_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2277nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAG
GCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGAC
ACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGG
GTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATAC
AGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAA
ATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAA
AGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACA
TATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGC
AGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGAC
CATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATT
TCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAG
GCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGC
AGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCA
ACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGG
GAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGC
TCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTG
GGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTC
GAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAG
CTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCC
TACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTC

>In-frame_MARK3_ENST00000335102_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2346nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGGGTTGTCAAGCTGGACAGACTATTAAAGTTCAAGTCTCCTTTGATTTGCTTAGTCTG
ATGTTTACATTTATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGAT
GCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCA
TACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTC
AGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCT
ACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATC
AATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGA
ATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAA
TCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACT
GGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCT
TCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGC
AGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAG
AAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGAT
AGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCA
GCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATAT
AATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAA
TTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGG
GCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCT
GCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAG
AAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGAT
CCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MARK3_ENST00000440884_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_3263nt
GGAAGCCGAGGGGCGGCCATCTTGGCTCCGTGAGGCTCTGAGGTGCCGGGGTGCGGCGGCGGCAGCGGCGGCCAGCAGGGCGGAGGCTGA
GGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCG
GCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTG
AAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCC
GAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAG
CCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTT
CGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGT
GCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAG
TTACCTCTCGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGAC
TGTTGAAAACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTG
ACAAAACTCAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGT
TATTCGAAGTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATG
GCAGGATGAAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAG
ACCTCAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTT
TCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCA
AACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAG
AATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCA
GTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGA
GAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTC
AGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTC
CAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACA
CAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAG
AAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAA
GAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGT
CCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTG
ATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGG
AGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGAC
CAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAA
AACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACC
GTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCATGTCCACAGGTGGCCTCCA
GCACACCCCTCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTGGGTGTTACAGTCTGTGCCC
ACTGCATCCTAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCAGGTGGGAAGGATTGGAAAC
TCTAGTCTTTTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGTTTGGATAAAGAGCTGTATT
TTGCTTTAAATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATATTCTGTTCTGTTACAGTGA
TTTAAACCAGTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTCCATGAGGGAAAATATCTAA
TTTTTATAAGACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAGATTACATGGCCATAGCTTATCTGTGTTA

>In-frame_MARK3_ENST00000416682_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_3508nt
GCAGCGGCGGCCAGCAGGGCGGAGGCTGAGGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGC
TCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCC
GGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGC
GCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGC
CTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGA
AGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTT
TTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCA
CACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCTCGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGA
TGAACAACCTCACATCGGAAACTACAGACTGTTGAAAACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTAC
AGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACTCAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAA
GATTTTAAATCATCCCAATATAGTGAAGTTATTCGAAGTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGG
TGAAGTATTTGACTATTTGGTTGCACATGGCAGGATGAAGGAAAAAGAAGCAAGATCTAAATTTAGACAGGGTTGTCAAGCTGGACAGAC
TATTAAAGTTCAAGTCTCCTTTGATTTGCTTAGTCTGATGTTTACATTTATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGT
ACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGT
TGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGA
TGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGT
ATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACG
CGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGA
CATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGA
TGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGC
TAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCA
AAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCT
CAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGC
AAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACG
AAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAG
AACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTT
CCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCA
GACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGG
AGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAG
CGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCC
AGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAA
GTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACAC
CTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCATGTCCACAGGTGGCCTCCAGCACACCCCTCAGGAAGCTGTGGAG
GCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTGGGTGTTACAGTCTGTGCCCACTGCATCCTAAAGGCCTTTTCTTT
CTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCAGGTGGGAAGGATTGGAAACTCTAGTCTTTTCTAGAAACAGAAAA
TCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGTTTGGATAAAGAGCTGTATTTTGCTTTAAATTTATTAAGGTAAAT
ATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATATTCTGTTCTGTTACAGTGATTTAAACCAGTAGTATAGGAAAAAA
CTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTCCATGAGGGAAAATATCTAATTTTTATAAGACTAAGTTGAGTTAT

>In-frame_MARK3_ENST00000429436_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_3372nt
CAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCG
CCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGT
GAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCAC
TGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCG
GGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCC
TCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTG
AATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCTCGTACCAGCCGCTCAGGAGCTCGGTGTAGA
AACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAAACAATCGGCAAGGGGAATTTTGCAAAAGTA
AAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACTCAGTTGAATCCAACAAGTCTACAAAAGCTC
TTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAAGTCATTGAAACTGAAAAAACACTCTACCTA
ATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATGAAGGAAAAAGAAGCAAGATCTAAATTTAGA
CAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGATGCCGATATG
AACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCATACGCAGCA
CCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTCAGTGGCTCA
CTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGT
GAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGG
CATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATAT
TCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAG
CTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCT
CCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTG
GCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTT
GGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCC
ACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCA
GTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCA
GATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCT
CCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCA
AAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATA
CTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAAC
AAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTA
GGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTG
GTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCA
TGTCCACAGGTGGCCTCCAGCACACCCCTCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTG
GGTGTTACAGTCTGTGCCCACTGCATCCTAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCA
GGTGGGAAGGATTGGAAACTCTAGTCTTTTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGT
TTGGATAAAGAGCTGTATTTTGCTTTAAATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATA
TTCTGTTCTGTTACAGTGATTTAAACCAGTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTC
CATGAGGGAAAATATCTAATTTTTATAAGACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAGATTACATGG

>In-frame_MARK3_ENST00000303622_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_3351nt
GCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCG
CCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGG
GCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTC
GCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGG
GAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTG
TTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAAC
CACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCTCGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCA
GATGAACAACCTCACATCGGAAACTACAGACTGTTGAAAACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTT
ACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACTCAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATG
AAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAAGTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGA
GGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATGAAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAA
TACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTC
GGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAG
AAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAAC
CTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTC
CTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAA
CCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAA
TCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGATTCCAGT
TCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGA
AGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAG
ACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCA
GCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACA
GCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAA
AACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGA
GGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCC
CATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGAT
CAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAG
CTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCA
AATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAA
CCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGT
GAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCATGTCCACAGGTGGCCTCCAGC
ACACCCCTCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTGGGTGTTACAGTCTGTGCCCAC
TGCATCCTAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCAGGTGGGAAGGATTGGAAACTC
TAGTCTTTTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGTTTGGATAAAGAGCTGTATTTT
GCTTTAAATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATATTCTGTTCTGTTACAGTGATT
TAAACCAGTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTCCATGAGGGAAAATATCTAATT
TTTATAAGACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAGATTACATGGCCATAGCTTATCTGTGTTAAA

>In-frame_MARK3_ENST00000216288_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2984nt
GACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTC
GAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTA
GGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCTCGTACCAGCC
GCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAAACAATCGGCA
AGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACTCAGTTGAATC
CAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAAGTCATTGAAA
CTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATGAAGGAAAAAG
AAGCAAGATCTAAATTTAGACAGATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATC
TATTGTTAGATGCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTG
GCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTAT
ACACACTAGTCAGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCT
TCTACATGTCTACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGG
ACAGGTGGATCAATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATA
TTATGGTGGGAATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTAT
TGGGGAGAAAATCTTCAGAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTT
TTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCA
CTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTC
CCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTG
GTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCA
CTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTG
CCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAG
CCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGGATTGATCAGAATG
GCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGT
TTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGATGGACCAAATGGAT
GCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGG
AGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCA
GCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCATGTCCACAGGTGGCCTCCAGCACACCCC
TCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTGGGTGTTACAGTCTGTGCCCACTGCATCC
TAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCAGGTGGGAAGGATTGGAAACTCTAGTCTT
TTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGTTTGGATAAAGAGCTGTATTTTGCTTTAA
ATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATATTCTGTTCTGTTACAGTGATTTAAACCA
GTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTCCATGAGGGAAAATATCTAATTTTTATAA
GACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAGATTACATGGCCATAGCTTATCTGTGTTAAAACAATAA

>In-frame_MARK3_ENST00000553942_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2907nt
GTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACT
GAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCTCGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCC
TGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAAACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACAT
ATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACTCAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGA
ATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAAGTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCA
AGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATGAAGGAAAAAGAAGCAAGATCTAAATTTAGACAGATTGTGTCTGCA
GTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGATGCCGATATGAACATTAAAATAGCA
GATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCATACGCAGCACCTGAGCTCTTCCAG
GGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTCAGTGGCTCACTTCCCTTTGATGGG
CAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCTACAGACTGTGAAAACCTTCTCAAA
CGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATCAATGCAGGGCATGAAGAAGATGAA
CTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGAATGGGATATTCACAAGAAGAAATT
CAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAATCTTCAGAGCTGGATGCTAGTGAT
TCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACTGGCCAGTCTCCTCACCACAAAGTG
CAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCTTCTGTTGTGGCGTATCCGAAAAGG
AGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGCAGTGCTGTTGGAGGAAAGGGAATT
GCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAGAAAAGCTCCACTGTCCCTAGTAGT
AACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGATAGACACTCAGTGATTCAGAATGGC
AAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCAGCCACCCCAGATCGAATCCGCTTC
CCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATATAATGGCCCTCCTGCCTCTCCCAGC
CTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAATTAACTTCAAAACTCACAAGGAGG
ATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGGGCTTCCATACTGCCCGAGCACGAC
ATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCTGCTATTAACAAGCTAGTCTGTGAT
GGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAGAAGCTTTTAGGTTTGTTCTGTCAG
TCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGATCCAAAGCTGGTCATGGAGCAGGCC
GACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGCACCTGAGCATGTCCACAGGTGGCC
TCCAGCACACCCCTCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCTCTGTGTCTGGGTGTTACAGTCTGT
GCCCACTGCATCCTAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGTTTTTGTTCAGGTGGGAAGGATTGG
AAACTCTAGTCTTTTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAAGAAGTCTGTTTGGATAAAGAGCTG
TATTTTGCTTTAAATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGTGCTTACATATTCTGTTCTGTTACA
GTGATTTAAACCAGTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGATTTTTTTTTCCATGAGGGAAAATAT
CTAATTTTTATAAGACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAGATTACATGGCCATAGCTTATCTGT

>In-frame_MARK3_ENST00000335102_chr14_103958371_+_TDRD9_ENST00000409874_chr14_104506533_+_2931nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACCACACGTCACATGGAGATGGGCGTCAAGAAGTTACCTCT
CGTACCAGCCGCTCAGGAGCTCGGTGTAGAAACTCTATAGCCTCCTGTGCAGATGAACAACCTCACATCGGAAACTACAGACTGTTGAAA
ACAATCGGCAAGGGGAATTTTGCAAAAGTAAAATTGGCAAGACATATCCTTACAGGCAGAGAGGTTGCAATAAAAATAATTGACAAAACT
CAGTTGAATCCAACAAGTCTACAAAAGCTCTTCAGAGAAGTAAGAATAATGAAGATTTTAAATCATCCCAATATAGTGAAGTTATTCGAA
GTCATTGAAACTGAAAAAACACTCTACCTAATCATGGAATATGCAAGTGGAGGTGAAGTATTTGACTATTTGGTTGCACATGGCAGGATG
AAGGAAAAAGAAGCAAGATCTAAATTTAGACAGGGTTGTCAAGCTGGACAGACTATTAAAGTTCAAGTCTCCTTTGATTTGCTTAGTCTG
ATGTTTACATTTATTGTGTCTGCAGTTCAATACTGCCATCAGAAACGGATCGTACATCGAGACCTCAAGGCTGAAAATCTATTGTTAGAT
GCCGATATGAACATTAAAATAGCAGATTTCGGTTTTAGCAATGAATTTACTGTTGGCGGTAAACTCGACACGTTTTGTGGCAGTCCTCCA
TACGCAGCACCTGAGCTCTTCCAGGGCAAGAAATATGACGGGCCAGAAGTGGATGTGTGGAGTCTGGGGGTCATTTTATACACACTAGTC
AGTGGCTCACTTCCCTTTGATGGGCAAAACCTAAAGGAACTGAGAGAGAGAGTATTAAGAGGGAAATACAGAATTCCCTTCTACATGTCT
ACAGACTGTGAAAACCTTCTCAAACGTTTCCTGGTGCTAAATCCAATTAAACGCGGCACTCTAGAGCAAATCATGAAGGACAGGTGGATC
AATGCAGGGCATGAAGAAGATGAACTCAAACCATTTGTTGAACCAGAGCTAGACATCTCAGACCAAAAAAGAATAGATATTATGGTGGGA
ATGGGATATTCACAAGAAGAAATTCAAGAATCTCTTAGTAAGATGAAATACGATGAAATCACAGCTACATATTTGTTATTGGGGAGAAAA
TCTTCAGAGCTGGATGCTAGTGATTCCAGTTCTAGCAGCAATCTTTCACTTGCTAAGGTTAGGCCGAGCAGTGATCTCAACAACAGTACT
GGCCAGTCTCCTCACCACAAAGTGCAGAGAAGTGTTTTTTCAAGCCAAAAGCAAAGACGCTACAGTGACCATGCTGGACCAGCTATTCCT
TCTGTTGTGGCGTATCCGAAAAGGAGTCAGACCAGCACTGCAGATAGTGACCTCAAAGAAGATGGAATTTCCTCCCGGAAATCAAGTGGC
AGTGCTGTTGGAGGAAAGGGAATTGCTCCAGCCAGTCCCATGCTTGGGAATGCAAGTAATCCTAATAAGGCGGATATTCCTGAACGCAAG
AAAAGCTCCACTGTCCCTAGTAGTAACACAGCATCTGGTGGAATGACACGACGAAATACTTATGTTTGCAGTGAGAGAACTACAGCTGAT
AGACACTCAGTGATTCAGAATGGCAAAGAAAACAGCACTATTCCTGATCAGAGAACTCCAGTTGCTTCAACACACAGTATCAGTAGTGCA
GCCACCCCAGATCGAATCCGCTTCCCAAGAGGCACTGCCAGTCGTAGCACTTTCCACGGCCAGCCCCGGGAACGGCGAACCGCAACATAT
AATGGCCCTCCTGCCTCTCCCAGCCTGTCCCATGAAGCCACACCATTGTCCCAGACTCGAAGCCGAGGCTCCACTAATCTCTTTAGTAAA
TTAACTTCAAAACTCACAAGGAGGATTGATCAGAATGGCAAGTACTATACTGGAGTCCTTTGTGGTTTGGGGTGGAATCCAGCTACAGGG
GCTTCCATACTGCCCGAGCACGACATGGAGCTTGCGTTTGACGTTCAATTCAGCGTGGAGGATGTCGTCGAGGTTAATATTCTCAGGGCT
GCTATTAACAAGCTAGTCTGTGATGGACCAAATGGATGCAAGTGTCTTGGGCCAGAGAGAGTTGCGCAGCTTCAAGACATTGCCCGTCAG
AAGCTTTTAGGTTTGTTCTGTCAGTCAAAACCAAGGGAGAAGATTGTTCCCAAGTGGCATGAAAAGCCCTACGAGTGGAATCAGGTTGAT
CCAAAGCTGGTCATGGAGCAGGCCGACCGTGAGAGCAGCAGAGGGAAGAACACCTTTCTCTACCAGCTCCACAAACTGGTTGTGCTCGGC
ACCTGAGCATGTCCACAGGTGGCCTCCAGCACACCCCTCAGGAAGCTGTGGAGGCTGGATTCCAGGCTCCCTCCGCAGACTGACTTTCCT
CTGTGTCTGGGTGTTACAGTCTGTGCCCACTGCATCCTAAAGGCCTTTTCTTTCTTCTTTTCTCTTTGGGTGATAGTCAGAGAGTGGTGT
TTTTGTTCAGGTGGGAAGGATTGGAAACTCTAGTCTTTTCTAGAAACAGAAAATCACTGTATTAAATATTTTGGAAAGATTGTTCTGAAA
GAAGTCTGTTTGGATAAAGAGCTGTATTTTGCTTTAAATTTATTAAGGTAAATATAAGTAGTTAATCTTAGATGTAAGGTTCCAGAATGT
GCTTACATATTCTGTTCTGTTACAGTGATTTAAACCAGTAGTATAGGAAAAAACTTAAAAAAACAAAAAAACCATGTAGTATTTTCTGAT
TTTTTTTTCCATGAGGGAAAATATCTAATTTTTATAAGACTAAGTTGAGTTATACTTCTTGGTTCACATTTTGGAAATCAGAGATTACAG


Top

FusionGenePPI for MARK3_TDRD9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MARK3SFN, YWHAB, YWHAG, YWHAQ, RASGRF1, ATP6V0C, CHGB, SAAL1, PMPCB, PNPLA2, VPS11, TCEA2, TTR, USP21, MARK2, HDAC7, HDAC4, HDAC5, TADA2A, TERF2, PRKAA1, YWHAZ, YWHAH, MITF, MAP2, YWHAE, CDC25C, KSR1, PKP2, PIM1, MARK3, ASB13, MAPT, CAPZA1, CAPZB, CNBP, DLG5, HNRNPDL, MTCL1, ALYREF, CASQ2, NTRK1, CEP192, TMEM17, CTBP2, PPP2CB, CPSF3, MEX3C, CDH1, COL4A3BP, NRROS, TMCC2, NUAK2, PCDHGB4, CDH19, MANSC1, TRIM25, HEY1TDRD9PPP2R1A, DNAJC7, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MARK3_TDRD9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MARK3_TDRD9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource