FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21090

FusionGeneSummary for MARK3_MIA2

check button Fusion gene summary
Fusion gene informationFusion gene name: MARK3_MIA2
Fusion gene ID: 21090
HgeneTgene
Gene symbol

MARK3

MIA2

Gene ID

4140

4253

Gene namemicrotubule affinity regulating kinase 3MIA SH3 domain ER export factor 2
SynonymsCTAK1|KP78|PAR1A|Par-1aCTAGE5|MEA6|MGEA|MGEA11|MGEA6|TALI
Cytomap

14q32.32-q32.33

14q21.1

Type of geneprotein-codingprotein-coding
DescriptionMAP/microtubule affinity-regulating kinase 3C-TAK1ELKL motif kinase 2EMK-2cdc25C-associated protein kinase 1protein kinase STK10ser/Thr protein kinase PAR-1serine/threonine-protein kinase p78cTAGE family member 5melanoma inhibitory activity protein 2CTAGE family member 5, ER export factorCTAGE family, member 5TANGO1-likecutaneous T-cell lymphoma-associated antigen 5melanoma inhibitory activity 2meningioma expressed antigen 6 (coiled-co
Modification date2018052320180523
UniProtAcc

P27448

Q96PC5

Ensembl transtripts involved in fusion geneENST00000440884, ENST00000416682, 
ENST00000429436, ENST00000303622, 
ENST00000216288, ENST00000553942, 
ENST00000335102, ENST00000561071, 
ENST00000280082, ENST00000556784, 
Fusion gene scores* DoF score17 X 13 X 8=17683 X 3 X 3=27
# samples 203
** MAII scorelog2(20/1768*10)=-3.14404636961671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MARK3 [Title/Abstract] AND MIA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMARK3

GO:0018105

peptidyl-serine phosphorylation

9543386

HgeneMARK3

GO:0032092

positive regulation of protein binding

9543386

HgeneMARK3

GO:0035331

negative regulation of hippo signaling

28087714

HgeneMARK3

GO:0036289

peptidyl-serine autophosphorylation

9543386

TgeneMIA2

GO:1905097

regulation of guanyl-nucleotide exchange factor activity

25202031


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-B6-A0I9-01AMARK3chr14

103852417

+MIA2chr14

39716115

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000440884ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000440884ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000416682ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000416682ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000429436ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000429436ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000303622ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000303622ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000216288ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000216288ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000553942ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000553942ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000335102ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
In-frameENST00000335102ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+
intron-3CDSENST00000561071ENST00000280082MARK3chr14

103852417

+MIA2chr14

39716115

+
intron-3CDSENST00000561071ENST00000556784MARK3chr14

103852417

+MIA2chr14

39716115

+

Top

FusionProtFeatures for MARK3_MIA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MARK3

P27448

MIA2

Q96PC5

Plays a role in the transport of cargos that are toolarge to fit into COPII-coated vesicles and require specificmechanisms to be incorporated into membrane-bound carriers andexported from the endoplasmic reticulum. Isoform 1 plays a role inthe secretion of lipoproteins, pre-chylomicrons and pre-VLDLs, byparticipating in their export from the endoplasmic reticulum(PubMed:27138255). Thereby, may play a role in cholesterol andtriglyceride homeostasis (By similarity).{ECO:0000250|UniProtKB:Q91ZV0, ECO:0000269|PubMed:27138255}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26725_850112655Coiled coilOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26948_1102112655Coiled coilOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24725_850111542Coiled coilOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24948_1102111542Coiled coilOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+261297_1408112655Compositional biasPro-rich
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+241297_1408111542Compositional biasPro-rich
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26606_626112655IntramembraneOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24606_626111542IntramembraneOntology_term=ECO:0000255
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26627_646112655Topological domainLumenal
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26668_1412112655Topological domainCytoplasmic
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24627_646111542Topological domainLumenal
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24668_1412111542Topological domainCytoplasmic
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+26647_667112655TransmembraneHelical
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+24647_667111542TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMARK3chr14:103852417chr14:39716115ENST00000216288+116326_36517714DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000216288+11656_30717714DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000216288+116704_75317714DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000303622+116326_36517730DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000303622+11656_30717730DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000303622+116704_75317730DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000416682+117326_36517753DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000416682+11756_30717753DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000416682+117704_75317753DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000429436+118326_36517754DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000429436+11856_30717754DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000429436+118704_75317754DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000440884+116326_36517660DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000440884+11656_30717660DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000440884+116704_75317660DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000553942+117326_36517745DomainUBA
HgeneMARK3chr14:103852417chr14:39716115ENST00000553942+11756_30717745DomainProtein kinase
HgeneMARK3chr14:103852417chr14:39716115ENST00000553942+117704_75317745DomainKA1
HgeneMARK3chr14:103852417chr14:39716115ENST00000216288+11662_7017714Nucleotide bindingATP
HgeneMARK3chr14:103852417chr14:39716115ENST00000303622+11662_7017730Nucleotide bindingATP
HgeneMARK3chr14:103852417chr14:39716115ENST00000416682+11762_7017753Nucleotide bindingATP
HgeneMARK3chr14:103852417chr14:39716115ENST00000429436+11862_7017754Nucleotide bindingATP
HgeneMARK3chr14:103852417chr14:39716115ENST00000440884+11662_7017660Nucleotide bindingATP
HgeneMARK3chr14:103852417chr14:39716115ENST00000553942+11762_7017745Nucleotide bindingATP
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+2639_101112655DomainSH3
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+2439_101111542DomainSH3
TgeneMIA2chr14:103852417chr14:39716115ENST00000280082+2620_605112655Topological domainLumenal
TgeneMIA2chr14:103852417chr14:39716115ENST00000556784+2420_605111542Topological domainLumenal


Top

FusionGeneSequence for MARK3_MIA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_560aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
YLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSS
KDSDENSKPSVDTEGPALVEIDRSVENTLLNSQMVSTDNSLSSQNYISQKEDASEFQILKYLFQIDVYDFMNSAFSPIVILTERVSLPFK

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_448aa
MSTRTPLPTVNERDTENESDFLCLLGVSYTFDNEDSELNGDYGENIYPYEEDKDEKSSIYESDFQIEPGFYATYESTLFEDQVPALEAPE
DIGSTSESKDWEEVVVESMEQDRIPEVHVPPSSAVSGVKEWFGLGGEQAEEKAFESVIEPVQESSFRSRKIAVEDENDLEELNNGEPQTE
HQQESESEIDSVPKTQSELASESEHIPKPQSTGWFGGGFTSYLGFGDEDTGLELIAEESNPPLQDFPNSISSDKEATVPCTEILTEKKDT
ITNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_1680nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2724nt
GGAAGCCGAGGGGCGGCCATCTTGGCTCCGTGAGGCTCTGAGGTGCCGGGGTGCGGCGGCGGCAGCGGCGGCCAGCAGGGCGGAGGCTGA
GGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCG
GCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTG
AAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCC
GAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAG
CCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTT
CGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGT
GCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAA
GTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTA
GTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGG
CTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGC
ATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTA
TTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTC
AAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCA
AACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAG
AAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAA
AAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAG
ATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAA
AAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATA
CTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCA
AACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTA
TGATATTCAAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCT
CATCTTCTAAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATA
CCCTGCTAAATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGA
TTCTGAAATACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGC
CTTTTAAACCTTTTGCAATAATTTTACCTATTTTGCTAAATATAAGAGTGGCTACAAAATATGTTTGAATGAATCCTCCCTGTTTAATGT
TTATATAATGTTTCTCTTTCCATGACATCTTACCTGTAAGATTTCTCTTTATATGAATGTTTTGTCAAATGGATATTGATTTTTAAAAAC
ATTTCCCTAAGTTTTGTTGATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCCACCCTCCCCATTTTTCAAATTAGGGAAAGTTAGGTAC
TAAATAAGTTAACTCAGGAATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGTGCCTGGAGTTCCCACTACTTAGGAGGCTGAGGCAGGA
GGATCCTTTTACTGAATGTAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAGGGTTTGAGACCAGTCTGGGCAACATAGCTAGACCTTA

>In-frame_MARK3_ENST00000440884_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1982nt
GGAAGCCGAGGGGCGGCCATCTTGGCTCCGTGAGGCTCTGAGGTGCCGGGGTGCGGCGGCGGCAGCGGCGGCCAGCAGGGCGGAGGCTGA
GGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCG
GCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTG
AAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCC
GAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAG
CCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTT
CGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGT
GCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAA
GTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTA
GTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGG
CTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGC
ATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTA
TTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTC
AAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCA
AACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAG
AAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAA
AAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAG
ATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAA
AAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATA
CTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCA
AACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTA
TGATATTCAAAAGTTCATACAGTCTGTCAGGTTGGTATGAAAATATTTACATTAGAATTTATTTTATTTTTAAACATAATTTATTTTTAT

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2663nt
GCAGCGGCGGCCAGCAGGGCGGAGGCTGAGGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGC
TCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCC
GGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGC
GCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGC
CTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGA
AGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTT
TTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGA
ATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCC
TTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTT
GTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAG
TATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACA
AGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGA
CCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGA
ACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGA
GGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGT
TCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGC
TATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACA
TCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACC
AGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACAT
TCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGA
TAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAG
AATTCACGAAGAAGTATATTTTGAACCCTCATCTTCTAAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCT
GGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTAAATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTC
TCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAATACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAAT
TGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAACCTTTTGCAATAATTTTACCTATTTTGCTAAATATAAGAGTGGCTACAAAATA
TGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAATGTTTCTCTTTCCATGACATCTTACCTGTAAGATTTCTCTTTATATGAATGTT
TTGTCAAATGGATATTGATTTTTAAAAACATTTCCCTAAGTTTTGTTGATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCCACCCTCCC
CATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAGTTAACTCAGGAATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGTGCCTGGAG
TTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTTTTACTGAATGTAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAGGGTTTGAG

>In-frame_MARK3_ENST00000416682_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1921nt
GCAGCGGCGGCCAGCAGGGCGGAGGCTGAGGCAGCAAGCTCGCTAGAGAGGGAGAAGCAGTCGGGCGCAGGCGCCTCCTCCGCAGCCCGC
TCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCGCC
GGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGGGC
GCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTCGC
CTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGA
AGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTT
TTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGA
ATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCC
TTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTT
GTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAG
TATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACA
AGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGA
CCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGA
ACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGA
GGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGT
TCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGC
TATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACA
TCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACC
AGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACAT
TCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGA
TAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGGTTGGTATGAAAATATTTACATTAGAATTTA

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2596nt
CAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCG
CCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGT
GAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCAC
TGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCG
GGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCC
TCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTG
AATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGT
GATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTT
TATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGAC
TGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAA
TGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAA
ATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGAT
TCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACA
AGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATA
TCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCA
AGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGAT
GGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACA
GAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGAC
AACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAA
GAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGATATGGTC
TCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCTAAAGATAGTGATGAAAATTCGAAACCATCA
GTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTAAATAGTCAGATGGTTTCAACTGATAACTCT
TTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAATACTTATTCCAAATTGATGTTTATGATTTC
ATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAACCTTTTGCAATAATTTTACCTATTTTGCTA
AATATAAGAGTGGCTACAAAATATGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAATGTTTCTCTTTCCATGACATCTTACCTGTA
AGATTTCTCTTTATATGAATGTTTTGTCAAATGGATATTGATTTTTAAAAACATTTCCCTAAGTTTTGTTGATGTTGATCTTGAGCGGTG
TTTGCTTTTTACTCCACCCTCCCCATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAGTTAACTCAGGAATAATAGGAACTAGAGCTG
GGTGTGGTGGTGTGTGCCTGGAGTTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTTTTACTGAATGTAACAAGGAGAATAAAAGGG

>In-frame_MARK3_ENST00000429436_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1854nt
CAGGCGCCTCCTCCGCAGCCCGCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCG
CCTCCTCGTTTTCAGGCGCCGCCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGT
GAGGGGGCCCAGGATCGCGGGGCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCAC
TGCCGCCCTCCCGGTCTCCTCGCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCG
GGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCC
TCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTG
AATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGT
GATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTT
TATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGAC
TGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAA
TGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAA
ATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGAT
TCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACA
AGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATA
TCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCA
AGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGAT
GGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACA
GAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGAC
AACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAA
GAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGGTTGGTAT

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2575nt
GCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCG
CCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGG
GCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTC
GCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGG
GAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTG
TTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAAC
GAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATAT
CCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACT
TTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAA
AGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAA
CAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAAT
GACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCT
GAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGAT
GAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACA
GTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTT
GCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAA
CATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAA
CCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAAC
ATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATT
GATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACG
AGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCTAAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCT
CTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTAAATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATT
TCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAATACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCA
ATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAACCTTTTGCAATAATTTTACCTATTTTGCTAAATATAAGAGTGGCTACAAAA
TATGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAATGTTTCTCTTTCCATGACATCTTACCTGTAAGATTTCTCTTTATATGAATG
TTTTGTCAAATGGATATTGATTTTTAAAAACATTTCCCTAAGTTTTGTTGATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCCACCCTC
CCCATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAGTTAACTCAGGAATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGTGCCTGG
AGTTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTTTTACTGAATGTAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAGGGTTTG

>In-frame_MARK3_ENST00000303622_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1833nt
GCTCCATGGTCGGCGCCCACAGCCCGCGGCGGCCTGTCTTGCGCTCCACTTCCTTCACATCCTCCTCCGCCTCCTCGTTTTCAGGCGCCG
CCGGCGGCGCTGTGTGGAGGCCCGCGAGCTGAAATTCGCGGTGCGACGGGAGGGAGTGGAGAAGGAGGTGAGGGGGCCCAGGATCGCGGG
GCGCCCTGAGGCAAGGGGACGCCGGCGGGCCGAAGCGCAGCCCGCCGCCCGCAGGCTCGGCTCCGCCACTGCCGCCCTCCCGGTCTCCTC
GCCTCGGCCGCCGAGGCAGGGAGAGAATGAGCCCCGGGACCCGCCGGGGGACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGG
GAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTCGAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTG
TTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAAC
GAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATAT
CCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACT
TTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAA
AGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAA
CAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAAT
GACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCT
GAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGAT
GAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACA
GTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTT
GCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAA
CATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAA
CCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAAC
ATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATT
GATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGGTTGGTATGAAAATATTTACATTAGAATT

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2256nt
GACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTC
GAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTA
GGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATG
AAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATT
TTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAA
GTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAG
CTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAA
GCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAG
AATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTT
GGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTAC
AAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATG
ATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATG
ACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAA
CGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAA
AGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAA
ATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCAT
ACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCTAAAGATAGTG
ATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTAAATAGTCAGA
TGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAATACTTATTCC
AAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAACCTTTTGCAA
TAATTTTACCTATTTTGCTAAATATAAGAGTGGCTACAAAATATGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAATGTTTCTCTT
TCCATGACATCTTACCTGTAAGATTTCTCTTTATATGAATGTTTTGTCAAATGGATATTGATTTTTAAAAACATTTCCCTAAGTTTTGTT
GATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCCACCCTCCCCATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAGTTAACTCAGG
AATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGTGCCTGGAGTTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTTTTACTGAATG
TAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAGGGTTTGAGACCAGTCTGGGCAACATAGCTAGACCTTATCTCTTAAAAAAGAAAAA

>In-frame_MARK3_ENST00000216288_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1514nt
GACGGCCCGGGCCAGGCCCGGGATCTAGACGGCCGTAGGGGGAAGGGAGCCGCCCTCCCCACGGCGCCTTTTCGGAACTGCCGTGGACTC
GAGGACGCTGGTCGCCGGCCTCCTAGGGCTGTGCTGTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTA
GGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATG
AAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATT
TTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAA
GTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAG
CTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAA
GCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAG
AATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTT
GGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTAC
AAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATG
ATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATG
ACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAA
CGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAA
AGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAA
ATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCAT

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2131nt
GTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACT
GAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAAT
ATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAA
AGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTT
GTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGA
GGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGAT
GAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACA
CAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTT
GGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAA
GCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTT
GGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAA
CATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGAC
AAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTC
CAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTT
TCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTA
CCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCTAAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGG
CCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTAAATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAAT
TATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAATACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTT
TCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAACCTTTTGCAATAATTTTACCTATTTTGCTAAATATAAGAGTGGCT
ACAAAATATGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAATGTTTCTCTTTCCATGACATCTTACCTGTAAGATTTCTCTTTATA
TGAATGTTTTGTCAAATGGATATTGATTTTTAAAAACATTTCCCTAAGTTTTGTTGATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCC
ACCCTCCCCATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAGTTAACTCAGGAATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGT
GCCTGGAGTTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTTTTACTGAATGTAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAG

>In-frame_MARK3_ENST00000553942_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1389nt
GTTTTGTTTTGACCCTCGCATTGTGCAGAATTAAAGTGCAGTAAAATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACT
GAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACATTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAAT
ATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATATGAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAA
AGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAAGATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTT
GTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCACCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGA
GGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCTGTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGAT
GAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAACATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACA
CAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAATCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTT
GGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAATCCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAA
GCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACAATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTT
GGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATTATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAA
CATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAAGAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGAC
AAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCATATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTC
CAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATACTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTT
TCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTCAAAAGTTCATACAGTCTGTCAGGTTGGTATGAAAATATTTACATT

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000280082_chr14_39716115_+_2086nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC
AAAAGTTCATACAGTCTGTCAGATATGGTCTCTAACATAGAGTTACCTACGAGAATTCACGAAGAAGTATATTTTGAACCCTCATCTTCT
AAAGATAGTGATGAAAATTCGAAACCATCAGTAGACACCGAAGGGCCTGCTCTGGTGGAGATAGACAGATCTGTGGAAAATACCCTGCTA
AATAGTCAGATGGTTTCAACTGATAACTCTTTGTCTTCTCAAAATTATATTTCTCAGAAAGAAGATGCTTCTGAGTTTCAGATTCTGAAA
TACTTATTCCAAATTGATGTTTATGATTTCATGAATTCTGCATTTTCACCAATTGTAATTCTTACAGAAAGGGTAAGTTTGCCTTTTAAA
CCTTTTGCAATAATTTTACCTATTTTGCTAAATATAAGAGTGGCTACAAAATATGTTTGAATGAATCCTCCCTGTTTAATGTTTATATAA
TGTTTCTCTTTCCATGACATCTTACCTGTAAGATTTCTCTTTATATGAATGTTTTGTCAAATGGATATTGATTTTTAAAAACATTTCCCT
AAGTTTTGTTGATGTTGATCTTGAGCGGTGTTTGCTTTTTACTCCACCCTCCCCATTTTTCAAATTAGGGAAAGTTAGGTACTAAATAAG
TTAACTCAGGAATAATAGGAACTAGAGCTGGGTGTGGTGGTGTGTGCCTGGAGTTCCCACTACTTAGGAGGCTGAGGCAGGAGGATCCTT
TTACTGAATGTAACAAGGAGAATAAAAGGGAAGAGTGAGCCCAAGGGTTTGAGACCAGTCTGGGCAACATAGCTAGACCTTATCTCTTAA

>In-frame_MARK3_ENST00000335102_chr14_103852417_+_MIA2_ENST00000556784_chr14_39716115_+_1344nt
ATGTCCACTAGGACCCCATTGCCAACGGTGAATGAACGAGACACTGAAAACGAATCTGACTTTCTTTGTCTTCTTGGAGTAAGTTACACA
TTTGACAATGAAGATAGTGAATTAAACGGTGATTATGGTGAAAATATATATCCTTATGAAGAAGATAAAGATGAAAAATCTAGTATATAT
GAAAGTGATTTTCAGATAGAACCTGGATTTTATGCAACTTATGAAAGTACTTTGTTTGAAGACCAAGTTCCAGCATTAGAGGCTCCTGAA
GATATCGGAAGTACCAGTGAATCAAAAGACTGGGAAGAAGTAGTTGTTGAAAGTATGGAACAGGATCGTATTCCAGAAGTGCATGTCCCA
CCATCTTCAGCTGTGTCTGGAGTCAAAGAATGGTTTGGATTGGGAGGAGAACAAGCTGAAGAGAAGGCTTTTGAATCAGTTATTGAACCT
GTACAAGAAAGCTCATTTCGGAGTAGAAAAATAGCAGTGGAAGATGAGAATGACCTAGAGGAATTAAATAATGGTGAGCCTCAAACAGAA
CATCAGCAAGAATCTGAATCAGAAATTGATTCAGTGCCAAAGACACAGTCTGAACTAGCATCTGAGTCAGAGCACATTCCCAAACCTCAA
TCCACTGGTTGGTTTGGTGGAGGATTTACAAGTTATTTAGGTTTTGGAGATGAGGATACAGGGCTTGAATTAATAGCTGAAGAAAGCAAT
CCACCACTACAAGATTTTCCCAATTCCATATCATCTGATAAAGAAGCCACAGTTCCATGTACAGAAATATTAACAGAAAAAAAAGACACA
ATCACTAATGATAGCTTGAGTCTCAAGCCAAGTTGGTTTGATTTTGGTTTTGCTATACTAGGCTTTGCATATGCCAAGGAAGATAAAATT
ATGTTAGATGACAGGAAAAATGAAGAAGATGGTGGGGCAGATGAACATGAACATCCTCTAACAAGTGAATTAGACCCTGAAAAAGAACAA
GAAATAGAAACGATAAAAATTATAGAAACAGAAGATCAAATAGACAAGAAACCAGTCTCAGAAAAAACAGACGAATCTGATACTATACCA
TATTTGAAAAAGTTCTTGTATAATTTTGACAACCCTTGGAACTTCCAGAACATTCCAAAGGAAACAGAATTGCCATTTCCCAAACAGATA
CTGGATCAAAATAATGTAATTGAAAATGAAGAAACTGGAGAATTTTCCATTGATAATTATCCCACAGATAATACAAAAGTTATGATATTC


Top

FusionGenePPI for MARK3_MIA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MARK3SFN, YWHAB, YWHAG, YWHAQ, RASGRF1, ATP6V0C, CHGB, SAAL1, PMPCB, PNPLA2, VPS11, TCEA2, TTR, USP21, MARK2, HDAC7, HDAC4, HDAC5, TADA2A, TERF2, PRKAA1, YWHAZ, YWHAH, MITF, MAP2, YWHAE, CDC25C, KSR1, PKP2, PIM1, MARK3, ASB13, MAPT, CAPZA1, CAPZB, CNBP, DLG5, HNRNPDL, MTCL1, ALYREF, CASQ2, NTRK1, CEP192, TMEM17, CTBP2, PPP2CB, CPSF3, MEX3C, CDH1, COL4A3BP, NRROS, TMCC2, NUAK2, PCDHGB4, CDH19, MANSC1, TRIM25, HEY1MIA2KHDRBS1, TP53


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MARK3_MIA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MARK3_MIA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource