FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21071

FusionGeneSummary for MARK2_BUB1B

check button Fusion gene summary
Fusion gene informationFusion gene name: MARK2_BUB1B
Fusion gene ID: 21071
HgeneTgene
Gene symbol

MARK2

BUB1B

Gene ID

2011

701

Gene namemicrotubule affinity regulating kinase 2BUB1 mitotic checkpoint serine/threonine kinase B
SynonymsEMK-1|EMK1|PAR-1|Par-1b|Par1bBUB1beta|BUBR1|Bub1A|MAD3L|MVA1|SSK1|hBUBR1
Cytomap

11q13.1

15q15.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase MARK2ELKL motif kinase 1MAP/microtubule affinity-regulating kinase 2PAR1 homolog bSer/Thr protein kinase PAR-1Bserine/threonine protein kinase EMKtesticular tissue protein Li 117mitotic checkpoint serine/threonine-protein kinase BUB1 betaBUB1B, mitotic checkpoint serine/threonine kinaseMAD3/BUB1-related protein kinasebudding uninhibited by benzimidazoles 1 homolog betamitotic checkpoint kinase MAD3L
Modification date2018052320180523
UniProtAcc

Q7KZI7

O60566

Ensembl transtripts involved in fusion geneENST00000377809, ENST00000402010, 
ENST00000413835, ENST00000377810, 
ENST00000315032, ENST00000508192, 
ENST00000361128, ENST00000350490, 
ENST00000502399, ENST00000509502, 
ENST00000513765, ENST00000408948, 
ENST00000425897, 
ENST00000287598, 
ENST00000412359, ENST00000560120, 
Fusion gene scores* DoF score11 X 7 X 11=8475 X 4 X 4=80
# samples 184
** MAII scorelog2(18/847*10)=-2.23436506300252
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/80*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MARK2 [Title/Abstract] AND BUB1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMARK2

GO:0006468

protein phosphorylation

14976552

HgeneMARK2

GO:0010976

positive regulation of neuron projection development

12429843

HgeneMARK2

GO:0018105

peptidyl-serine phosphorylation

10542369

HgeneMARK2

GO:0030010

establishment of cell polarity

12429843

HgeneMARK2

GO:0035556

intracellular signal transduction

14976552

HgeneMARK2

GO:0045197

establishment or maintenance of epithelial cell apical/basal polarity

15324659

HgeneMARK2

GO:0070507

regulation of microtubule cytoskeleton organization

10542369


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-94-7557-01AMARK2chr11

63607032

+BUB1Bchr15

40468678

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377809ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000377809ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000377809ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000402010ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000402010ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000402010ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000413835ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000413835ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000413835ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5UTR-3CDSENST00000377810ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5UTR-3CDSENST00000377810ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5UTR-3UTRENST00000377810ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000315032ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000315032ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000315032ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000508192ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000508192ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000508192ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000361128ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000361128ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000361128ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000350490ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000350490ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000350490ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000502399ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
In-frameENST00000502399ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
5CDS-3UTRENST00000502399ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000509502ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000509502ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3UTRENST00000509502ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000513765ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000513765ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3UTRENST00000513765ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000408948ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000408948ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3UTRENST00000408948ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000425897ENST00000287598MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3CDSENST00000425897ENST00000412359MARK2chr11

63607032

+BUB1Bchr15

40468678

+
intron-3UTRENST00000425897ENST00000560120MARK2chr11

63607032

+BUB1Bchr15

40468678

+

Top

FusionProtFeatures for MARK2_BUB1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MARK2

Q7KZI7

BUB1B

O60566

Serine/threonine-protein kinase (PubMed:23666762).Involved in cell polarity and microtubule dynamics regulation.Phosphorylates CRTC2/TORC2, DCX, HDAC7, KIF13B, MAP2, MAP4 andRAB11FIP2. Phosphorylates the microtubule-associated proteinMAPT/TAU (PubMed:23666762). Plays a key role in cell polarity byphosphorylating the microtubule-associated proteins MAP2, MAP4 andMAPT/TAU at KXGS motifs, causing detachment from microtubules, andtheir disassembly. Regulates epithelial cell polarity byphosphorylating RAB11FIP2. Involved in the regulation of neuronalmigration through its dual activities in regulating cellularpolarity and microtubule dynamics, possibly by phosphorylating andregulating DCX. Regulates axogenesis by phosphorylating KIF13B,promoting interaction between KIF13B and 14-3-3 and inhibitingmicrotubule-dependent accumulation of KIF13B. Also required forneurite outgrowth and establishment of neuronal polarity.Regulates localization and activity of some histone deacetylasesby mediating phosphorylation of HDAC7, promoting subsequentinteraction between HDAC7 and 14-3-3 and export from the nucleus.Also acts as a positive regulator of the Wnt signaling pathway,probably by mediating phosphorylation of dishevelled proteins(DVL1, DVL2 and/or DVL3). Modulates the developmental decision tobuild a columnar versus a hepatic epithelial cell apparently bypromoting a switch from a direct to a transcytotic mode of apicalprotein delivery. Essential for the asymmetric development ofmembrane domains of polarized epithelial cells.{ECO:0000269|PubMed:11433294, ECO:0000269|PubMed:12429843,ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:15158914,ECO:0000269|PubMed:15324659, ECO:0000269|PubMed:15365179,ECO:0000269|PubMed:16775013, ECO:0000269|PubMed:16980613,ECO:0000269|PubMed:18626018, ECO:0000269|PubMed:20194617,ECO:0000269|PubMed:23666762}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+323209_2151281051Compositional biasNote=Poly-Glu
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+323209_2151421065Compositional biasNote=Poly-Glu
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+323766_10501281051DomainNote=Protein kinase
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+323766_10501421065DomainNote=Protein kinase
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+323224_2321281051MotifNote=D-box
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+323224_2321421065MotifNote=D-box
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+323772_7801281051Nucleotide bindingATP
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+323772_7801421065Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMARK2chr11:63607032chr15:40468678ENST00000315032+118323_36218780DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000315032+11853_30418780DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000315032+118739_78818780DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000350490+116323_36218710DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000350490+11653_30418710DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000350490+116739_78818710DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000361128+117323_36218720DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000361128+11753_30418720DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000361128+117739_78818720DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000377809+118323_36218774DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000377809+11853_30418774DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000377809+118739_78818774DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000377810+117323_362-15692DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000377810+11753_304-15692DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000377810+117739_788-15692DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000402010+119323_36218789DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000402010+11953_30418789DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000402010+119739_78818789DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000408948+116323_362-6692DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000408948+11653_304-6692DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000408948+116739_788-6692DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000413835+118323_36218735DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000413835+11853_30418735DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000413835+118739_78818735DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000508192+117323_36218725DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000508192+11753_30418725DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000508192+117739_78818725DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000509502+118323_362-155746DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000509502+11853_304-155746DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000509502+118739_788-155746DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000513765+118323_362-17756DomainUBA
HgeneMARK2chr11:63607032chr15:40468678ENST00000513765+11853_304-17756DomainProtein kinase
HgeneMARK2chr11:63607032chr15:40468678ENST00000513765+118739_788-17756DomainKA1
HgeneMARK2chr11:63607032chr15:40468678ENST00000315032+11859_6718780Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000350490+11659_6718710Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000361128+11759_6718720Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000377809+11859_6718774Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000377810+11759_67-15692Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000402010+11959_6718789Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000408948+11659_67-6692Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000413835+11859_6718735Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000508192+11759_6718725Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000509502+11859_67-155746Nucleotide bindingATP
HgeneMARK2chr11:63607032chr15:40468678ENST00000513765+11859_67-17756Nucleotide bindingATP
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+32362_2261281051DomainBUB1 N-terminal
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+32362_2261421065DomainBUB1 N-terminal
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000287598+323111_1181281051MotifNuclear localization signal
TgeneBUB1Bchr11:63607032chr15:40468678ENST00000412359+323111_1181421065MotifNuclear localization signal


Top

FusionGeneSequence for MARK2_BUB1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_941aa
MSSARTPLPTLNERDTEQGRLCNEPLDMYSYLHNQGIGVSLAQFTISWAEETEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARV
SRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKP
TVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPTVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQ
RVQSHQQASEEKKEKMMTCKEKITAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEE
TMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSE
DQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQTRRQLLKSLPELSAS
AELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQD
GCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRV
QLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_2823nt
ATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAA
GCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTG
TCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTA
AAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAAT
CCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCT
ACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAA
AGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTC
TCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCA
GAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAG
ACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAA
GTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATT
TTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGAT
GCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACT
CCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAG
GACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACA
CACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACT
AATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCT
GCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGAT
GGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTG
TTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTC
AGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTG
CAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAG
GTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCT
GTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3779nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC
TTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTT

>In-frame_MARK2_ENST00000377809_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3681nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3779nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC
TTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTT

>In-frame_MARK2_ENST00000402010_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3681nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3779nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC
TTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTT

>In-frame_MARK2_ENST00000413835_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3681nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3779nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC
TTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTT

>In-frame_MARK2_ENST00000315032_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3681nt
AAACAGAGCCGAAGCTTCGTCTTCGGAATCGAGGAGGAGAGCGCGTCCCCGGGGTTTACCTTCTTCGGCTGTTTCCGGAATTCACCCGTA
GTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGAAAAGAGCCGAGGG
CCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCGCTGAGGGCAGGGG
AGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCCCAGCCGGGGGTCG
GGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCC
CGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCC
TCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAG
CAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCA
TGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAA
AGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTT
GAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGT
GCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAA
AATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAG
CTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTT
CCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGC
ACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATG
TATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAA
AGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAA
ACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAG
AAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAA
CAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGAT
CCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTT
TGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGAC
ACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGA
CTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAG
AAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCC
ATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGC
AGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAG
GAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAAC
TCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAA
GATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTT
CTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAA
ATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTG
AAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAA
GGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAA
CACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTT
GTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTC
CAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTC
ACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTA
CCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAAC

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3702nt
GAATTCACCCGTAGTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGA
AAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCG
CTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCC
CAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGC
TGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCC
TTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGA
GAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCA
GTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGC
TGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGA
GGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCAT
CCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTAC
TGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGC
CAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGT
ACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAA
CCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAA
AGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAA
ATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCT
AAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGC
TTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAA
CATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAG
TCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGT
GTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCC
TAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTC
TGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGAC
TCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGC
AAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTG
TTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTT
GGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGT
GGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGA
ACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCAC
CCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCT
ACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAA
CAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGT
ACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACT
ATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTG
GAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTT
TGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAG
GCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACA
TTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCAT
GGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACT
TTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATAATAAAATAGTATCTGTTAAAT

>In-frame_MARK2_ENST00000508192_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3604nt
GAATTCACCCGTAGTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGA
AAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCG
CTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCC
CAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGC
TGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCC
TTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGA
GAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCA
GTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGC
TGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGA
GGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCAT
CCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTAC
TGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGC
CAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGT
ACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAA
CCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAA
AGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAA
ATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCT
AAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGC
TTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAA
CATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAG
TCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGT
GTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCC
TAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTC
TGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGAC
TCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGC
AAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTG
TTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTT
GGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGT
GGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGA
ACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCAC
CCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCT
ACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAA
CAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGT
ACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACT
ATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTG
GAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTT
TGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAG
GCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACA
TTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCAT
GGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACT

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3702nt
GAATTCACCCGTAGTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGA
AAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCG
CTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCC
CAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGC
TGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCC
TTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGA
GAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCA
GTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGC
TGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGA
GGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCAT
CCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTAC
TGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGC
CAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGT
ACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAA
CCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAA
AGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAA
ATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCT
AAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGC
TTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAA
CATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAG
TCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGT
GTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCC
TAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTC
TGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGAC
TCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGC
AAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTG
TTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTT
GGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGT
GGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGA
ACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCAC
CCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCT
ACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAA
CAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGT
ACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACT
ATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTG
GAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTT
TGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAG
GCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACA
TTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCAT
GGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACT
TTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATAATAAAATAGTATCTGTTAAAT

>In-frame_MARK2_ENST00000361128_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3604nt
GAATTCACCCGTAGTCTGTGGCCGGGAGGAGAAGGCGCGCCCCACCTCCCGTTTCTAGCCGCTTCGGATGTTTCCGGCTGCTGCCGGCGA
AAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGCCG
CTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAGCC
CAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGC
TGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCC
TTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGA
GAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCA
GTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGC
TGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGA
GGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCAT
CCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTAC
TGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGC
CAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGT
ACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAA
CCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAA
AGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAA
ATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCT
AAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGC
TTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAA
CATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAG
TCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGT
GTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCC
TAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTC
TGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGAC
TCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGC
AAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTG
TTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTT
GGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGT
GGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGA
ACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCAC
CCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCT
ACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAA
CAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGT
ACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACT
ATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTG
GAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTT
TGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAG
GCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACA
TTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCAT
GGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACT

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3614nt
GAAAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGC
CGCTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAG
CCCAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCG
GCTGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTC
CCTTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAAC
GAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCT
CAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAG
GCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAA
GAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATC
ATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATT
ACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGG
GCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCT
GTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATA
AACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAG
AAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAG
AAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAG
CTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATT
GCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAG
AACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAA
AGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGAT
GTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGT
CCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCT
TCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAG
ACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTT
GCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGG
TGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAG
TTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGG
GTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAG
GAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTC
ACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATG
CTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAG
AACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACT
GTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTA
CTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTG
TGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTT
TTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCT
AGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACA
CATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTC
ATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTA
CTTTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATAATAAAATAGTATCTGTTAA

>In-frame_MARK2_ENST00000350490_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3516nt
GAAAAGAGCCGAGGGCCGGCGGTGGTGGCGGCCATGTTGGGAGCAGCAGGTCCGGCGGCGGCTGCCTGTGTGCCGGGCGCGGAGCAGTGC
CGCTGAGGGCAGGGGAGGAGCGAGGCAGGCGGCCGGCTGCGGCGGCAGAGAGTAGGCGGAGCGGCGCGGCCCGGCCGAAAGGCGGCACAG
CCCAGCCGGGGGTCGGGGGGGTGCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCG
GCTGCCCGGCCTCCCCGCACCCCCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTC
CCTTCCCTCCCTTCCTCCAAGCTTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAAC
GAGAGGGACACGGAGCAGGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCT
CAGTTCTATATCTCATGGGCAGAAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAG
GCTGAACCACTAGAAAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAA
GAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATC
ATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATT
ACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGG
GCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCT
GTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATA
AACCACATCCTAAGCACCAGAAAGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAG
AAAGAGAAGATGATGTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAG
AAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAG
CTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATT
GCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAG
AACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAA
AGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGAT
GTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGT
CCTAACCCAGAAGACACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCT
TCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAG
ACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTT
GCAAGCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGG
TGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAG
TTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGG
GTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAG
GAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTC
ACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATG
CTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAG
AACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACT
GTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTA
CTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTG
TGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTT
TTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCT
AGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACA
CATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTC
ATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTA

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000287598_chr15_40468678_+_3412nt
GCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCCCGCACCC
CCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCCTCCAAGC
TTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGC
GTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAG
AAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTAC
AGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTT
CTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCA
AGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTG
ATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAG
CAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTT
TCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAA
AGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTA
AGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAG
CCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTC
AGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATAC
CAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTC
ATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCAC
GAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATG
AATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTG
ACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTAC
CGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGA
GCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAAT
GTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGC
TACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTG
AATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAG
AATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTG
ATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAAC
ACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCC
ATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAG
TGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAA
AGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTAC
AGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGA
TTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTC
ACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATT
GCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGC
TGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTG
AAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCAT

>In-frame_MARK2_ENST00000502399_chr11_63607032_+_BUB1B_ENST00000412359_chr15_40468678_+_3314nt
GCGGTCCGGAGCCGCTCGGAGCCGGCGCGGCCTAGCCCGAGCGGCGCATCCCCGGGCTGGCGTGAGCGGCTGCCCGGCCTCCCCGCACCC
CCGGCCGGGGCCCATGCGGCGGGTGCTCCTGCTGTGAGAAGCCCCGCCCGGCCGGGCTCCGCGCCTTCCCTTCCCTCCCTTCCTCCAAGC
TTCTCGGTTCCCTCCCCCGAGATACCGGCGCCATGTCCAGCGCTCGGACCCCCCTACCCACGCTGAACGAGAGGGACACGGAGCAGGGGC
GTTTATGCAATGAGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAG
AAGAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGAAAGACTAC
AGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGGAGGAAGTTTTTGAGTCTT
CTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCA
AGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTG
ATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAG
CAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTT
TCACTCCATATGTGGAAGAGACTGCACGACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAA
AGCCTGGAAAGGAAGAAGGAGATCCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTA
AGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCAAAGGGAAG
CCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTC
AGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATAC
CAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTC
ATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCAC
GAGTTTTAGCTCAACGAAGACCCCTTGCAGTTCTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATG
AATTTACAGGAATTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTG
ACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTAC
CGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGA
GCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAAT
GTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTTCACAGTATCGCAGACAGC
TACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGACAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTG
AATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAG
AATTAACAGTAATAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTG
ATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAAC
ACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCC
ATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAG
TGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAA
AGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTAC
AGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGA
TTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTC
ACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATT
GCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGC
TGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTG


Top

FusionGenePPI for MARK2_BUB1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MARK2YWHAG, YWHAQ, MAP3K3, SFN, AKT1, DTNA, USP21, FUCA1, KIF5B, MARK1, MARK3, PRKCI, SNTB2, UTRN, YWHAH, ARHGEF2, GPRASP1, COL4A3BP, C11orf58, CLASP2, PMPCA, PHLPP1, MTCL1, KIF13B, UTP18, MARK4, CEP85L, HDAC7, TADA2A, PRKAA1, NEDD4, PARD6A, YWHAZ, PARD6G, MARK2, NEDD4L, STK11, YWHAE, RAB11FIP2, PPP2R4, YWHAB, DMD, RHOA, PINK1, PRKCE, PKD1, VCP, GAB1, GAB2, PARD3, RNF41, CAMK1, AURKB, CDKN1A, CEP57, MAPT, BAIAP2, CCDC8, NAP1L5, CDK15, HNRNPA1, NTRK1, CEP89, DCTN1, TMEM17, CAPZA1, CAPZA2, CAPZB, AP2M1, APC, LDHD, PPP2R1A, PPP2R5E, HERC2, DLG5, WDR46, PDCD7, PRDX3, NUPL2, CAMSAP2, CLASP1, RSF1, CCDC82, SOGA1, FBXL16, FRYL, CDC5L, SMURF1, CDH1, TMCC2, NRROS, NUAK2, SIX2, MANSC1, CDH19, CAV3, CBY1BUB1BHDAC1, BRCA2, SNCG, CDC20, BUB3, MAD2L1, CENPE, AP2B1, APC, CDC27, CDC16, ANAPC7, UBE2C, PARP1, KAT2B, ANAPC4, BUB1, MIS12, ZWINT, BUB1B, NSL1, DNMBP, MXI1, MDM2, MAD2L1BP, PLK1, TUBB, CASC5, TP73, AJUBA, AURKB, PLK3, PTTG1, SGOL1, DAXX, FZR1, TRIM33, COMMD4, GANAB, PRKCSH, PNMA2, UGP2, TRIP13, SUMO1, ANAPC1, ANAPC2, BAG2, DSN1, ZFC3H1, CCT2, EEF2, HSPB1, HSPH1, NDC80, NUF2, PMF1, PSMA3, PSMA4, PSMA6, PSMB5, PSMD6, RPL39, SKIV2L2, RAE1, UBR5, CCNA2, FBXW7, BTRC, MED4, XPO1, CD14, CDC23, SMEK1, CERK, ANAPC10, NEK2, SNW1, CDC5L, PPP2R5A, TYW3, HDAC2, HDAC3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MARK2_BUB1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MARK2_BUB1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMARK2C0036341Schizophrenia2PSYGENET
HgeneMARK2C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneMARK2C0036095Salivary Gland Neoplasms1CTD_human
TgeneBUB1BC0018273Growth Disorders1CTD_human
TgeneBUB1BC0025958Microcephaly1CTD_human
TgeneBUB1BC0206656Rhabdomyosarcoma, Embryonal1CTD_human
TgeneBUB1BC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneBUB1BC1850343MOSAIC VARIEGATED ANEUPLOIDY SYNDROME1CTD_human;ORPHANET;UNIPROT
TgeneBUB1BC1864389PREMATURE CHROMATID SEPARATION TRAIT1CTD_human;UNIPROT