FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21049

FusionGeneSummary for MAPRE1_KMT2A

check button Fusion gene summary
Fusion gene informationFusion gene name: MAPRE1_KMT2A
Fusion gene ID: 21049
HgeneTgene
Gene symbol

MAPRE1

KMT2A

Gene ID

22919

4297

Gene namemicrotubule associated protein RP/EB family member 1lysine methyltransferase 2A
SynonymsEB1ALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTS
Cytomap

20q11.21

11q23.3

Type of geneprotein-codingprotein-coding
Descriptionmicrotubule-associated protein RP/EB family member 1APC-binding protein EB1adenomatous polyposis coli-binding protein EB1end-binding protein 1histone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-like
Modification date2018052320180519
UniProtAcc

Q15691

Q03164

Ensembl transtripts involved in fusion geneENST00000375571, ENST00000534358, 
ENST00000389506, ENST00000354520, 
ENST00000420751, 
Fusion gene scores* DoF score8 X 6 X 6=28815 X 40 X 1=600
# samples 858
** MAII scorelog2(8/288*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(58/600*10)=-0.0489096004809464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MAPRE1 [Title/Abstract] AND KMT2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAPRE1

GO:0031115

negative regulation of microtubule polymerization

11943150

HgeneMAPRE1

GO:0035372

protein localization to microtubule

19632184|21820309

TgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

TgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

TgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

TgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AY752859MAPRE1chr20

31427663

+KMT2Achr11

118354896

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375571ENST00000534358MAPRE1chr20

31427663

+KMT2Achr11

118354896

+
In-frameENST00000375571ENST00000389506MAPRE1chr20

31427663

+KMT2Achr11

118354896

+
In-frameENST00000375571ENST00000354520MAPRE1chr20

31427663

+KMT2Achr11

118354896

+
5CDS-3UTRENST00000375571ENST00000420751MAPRE1chr20

31427663

+KMT2Achr11

118354896

+

Top

FusionProtFeatures for MAPRE1_KMT2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAPRE1

Q15691

KMT2A

Q03164

Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubulecytoskeleton (PubMed:12388762, PubMed:16109370, PubMed:19632184,PubMed:21646404, PubMed:28726242, PubMed:28814570). Promotescytoplasmic microtubule nucleation and elongation(PubMed:12388762, PubMed:16109370, PubMed:19632184,PubMed:21646404, PubMed:28726242, PubMed:28814570). May beinvolved in spindle function by stabilizing microtubules andanchoring them at centrosomes (PubMed:12388762). Also acts as aregulator of minus-end microtubule organization: interacts withthe complex formed by AKAP9 and PDE4DIP, leading to recruitCAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomalminus-end microtubules to the Golgi, an important step forpolarized cell movement (PubMed:28814570). Promotes elongation ofCAMSAP2-decorated microtubule stretches on the minus-end ofmicrotubules (PubMed:28814570). Acts as a regulator ofautophagosome transport via interaction with CAMSAP2(PubMed:28726242). May play a role in cell migration (Bysimilarity). {ECO:0000250|UniProtKB:Q61166,ECO:0000269|PubMed:12388762, ECO:0000269|PubMed:16109370,ECO:0000269|PubMed:19632184, ECO:0000269|PubMed:21646404,ECO:0000269|PubMed:28726242, ECO:0000269|PubMed:28814570}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+5714_116199269DomainCalponin-homology (CH)
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351703_174813623932DomainBromo%3B divergent
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7352018_207413623932DomainFYR N-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7353666_374713623932DomainFYR C-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7353829_394513623932DomainSET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7353953_396913623932DomainPost-SET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361703_174813623970DomainBromo%3B divergent
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7362018_207413623970DomainFYR N-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7363666_374713623970DomainFYR C-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7363829_394513623970DomainSET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7363953_396913623970DomainPost-SET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361703_174813623973DomainBromo%3B divergent
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7362018_207413623973DomainFYR N-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7363666_374713623973DomainFYR C-terminal
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7363829_394513623973DomainSET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7363953_396913623973DomainPost-SET
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7353906_390713623932RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7363906_390713623970RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7363906_390713623973RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351431_148213623932Zinc fingerPHD-type 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351479_153313623932Zinc fingerPHD-type 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351566_162713623932Zinc fingerPHD-type 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351870_191013623932Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351931_197813623932Zinc fingerPHD-type 4
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361431_148213623970Zinc fingerPHD-type 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361479_153313623970Zinc fingerPHD-type 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361566_162713623970Zinc fingerPHD-type 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361870_191013623970Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361931_197813623970Zinc fingerPHD-type 4
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361431_148213623973Zinc fingerPHD-type 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361479_153313623973Zinc fingerPHD-type 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361566_162713623973Zinc fingerPHD-type 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361870_191013623973Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361931_197813623973Zinc fingerPHD-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+57185_255199269DomainEB1 C-terminal
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+57208_268199269RegionNote=DCTN1-binding
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+57220_242199269RegionNote=APC-binding
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735137_14313623932Compositional biasNote=Poly-Gly
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+73517_10213623932Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735561_56413623932Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735568_57113623932Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736137_14313623970Compositional biasNote=Poly-Gly
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+73617_10213623970Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736561_56413623970Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736568_57113623970Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736137_14313623973Compositional biasNote=Poly-Gly
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+73617_10213623973Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736561_56413623973Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736568_57113623973Compositional biasNote=Poly-Pro
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735169_18013623932DNA bindingNote=A.T hook 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735217_22713623932DNA bindingNote=A.T hook 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+735301_30913623932DNA bindingNote=A.T hook 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736169_18013623970DNA bindingNote=A.T hook 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736217_22713623970DNA bindingNote=A.T hook 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+736301_30913623970DNA bindingNote=A.T hook 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736169_18013623973DNA bindingNote=A.T hook 1
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736217_22713623973DNA bindingNote=A.T hook 2
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+736301_30913623973DNA bindingNote=A.T hook 3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351147_119513623932Zinc fingerCXXC-type
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361147_119513623970Zinc fingerCXXC-type
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361147_119513623973Zinc fingerCXXC-type


Top

FusionGeneSequence for MAPRE1_KMT2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000534358_chr11_118354896_+_2810aa
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKI
IPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVV
CFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKK
VWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEIL
SNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQ
DDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLP
NAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYG
DDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDK
KVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTD
ARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSY
SPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSA
KVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPK
LAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGS
SSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAK
ELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLML
PDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVIS
SGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKM
DNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESS
SSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRV
TITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNS
TDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLP
TSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRK
NKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTIS
QDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLG
TSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKA
LSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQ
QDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQ
ICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHL
RKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAG
NVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIED

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000389506_chr11_118354896_+_2807aa
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKI
IPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVV
CFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKK
VWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNL
PESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQ
QPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAV
LPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDS
ANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVY
CQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARK
RCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPT
QRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVV
DHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAP
QVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSR
DRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQ
APRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDG
PKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGG
EERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNC
HSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSE
LLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTIT
EKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDS
PGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQ
SLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKK
LAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDT
SHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQ
TPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSS
AVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDT
ASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICA
ESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKS
AFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVI
RSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASN

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000354520_chr11_118354896_+_2769aa
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKI
IPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKFVYCQVCCEPFHKFCLEENERPLEDQL
ENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAK
LFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTAL
LNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSD
GGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKG
PGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNV
HMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFL
NGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTS
FTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIG
SRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLD
GSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLH
LRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLK
PEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIE
STSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYG
EEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVT
ATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLL
DTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSV
SSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDA
DHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVL
QTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPP
SGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDL
GSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGH
VTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQ
LQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTK
RFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAE
PKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLG
ILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATS
MDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000534358_chr11_118354896_+_8430nt
ATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAACCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTG
AATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTATTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAA
GTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAACTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATA
ATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAATTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGAT
GGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGAAACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAG
AAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCATCTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTG
CGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGCTGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAAT
GCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTG
GACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTT
TGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAAC
GAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAG
CAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAA
GTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTC
TCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGT
AAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTA
TCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTG
CAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCA
GACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAG
GATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATT
GTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGG
CAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCA
AACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATG
AAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGT
ACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGT
GATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTG
TTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGA
GCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAA
AAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGAC
TTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGC
TTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGAT
GCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGAT
GAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCA
TCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTAT
TCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGAT
CCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATG
TCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCC
AAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTG
GTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGC
TCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAA
CTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCT
TCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAAC
TCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCT
AGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGT
CAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAAC
AATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAG
GAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAA
GAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTG
GCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTT
CCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGG
CTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCA
GCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCT
TCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTT
GATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACA
GAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATG
GATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTC
CACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGAC
TGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCT
TCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAG
CTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGAT
CTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTA
ACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACT
CCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAG
GATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCT
ACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTT
GTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCT
ACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCA
ACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAA
AGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAA
TCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAG
AATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCC
CAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAA
TCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGC
CAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACA
ACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAAT
CTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGG
ACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCT
TCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGT
GATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCT
TTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTG
CCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTG
CGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAG
CAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACC
CAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTT
CAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAG
ATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCA
TTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGT
CGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTC
AGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAG
GTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCA
GTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGC
AACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCA
GAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATT
GATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGAT

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000389506_chr11_118354896_+_8421nt
ATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAACCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTG
AATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTATTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAA
GTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAACTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATA
ATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAATTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGAT
GGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGAAACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAG
AAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCATCTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTG
CGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGCTGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAAT
GCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTG
GACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTT
TGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAAC
GAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAG
CAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAA
GTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTC
TCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGT
AAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTG
CCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCT
CTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAAT
CCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAG
CAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATC
ATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAA
CGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTG
CTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATC
ATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGG
AGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGT
GCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGAT
GATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTG
GGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATAT
TGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGA
ATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATT
CTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAG
CGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGG
ACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGAC
CGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACA
CAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTC
TCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATG
AGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTT
GATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTA
GGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTA
AAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCA
CAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAG
GCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCA
GATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGA
GATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACA
ACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCT
TCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAG
GCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGT
CCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCA
AGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGC
CCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCA
CTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGA
CAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGA
GAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGG
ACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTA
AAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGC
CATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGT
ACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAAT
ATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAA
CTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACA
ACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTC
TTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACA
GAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCAT
TTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACT
AGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGT
CCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAG
AACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGT
GTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAA
TCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTC
CCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAG
AGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAA
CTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCT
AATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATC
ATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACT
AGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACA
AGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATC
AAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAG
ACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCT
GGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGAT
TCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCA
GCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCC
ACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGT
TCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACA
GCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCA
GCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAA
CAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCA
GAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGT
GTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTAC
AAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCA
GCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTG
AAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTC
TACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATC
CGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTG
GATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAG
AAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAAC

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000354520_chr11_118354896_+_8307nt
ATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAACCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTG
AATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTATTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAA
GTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAACTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATA
ATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAATTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGAT
GGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGAAACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAG
AAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCATCTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTG
CGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGCTGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAAT
GCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTG
GACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTG
GAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGC
CGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTT
CGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAG
CTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGT
GATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGT
GTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTG
TTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCT
TCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTC
AAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGAT
GGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTC
AAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAAT
TATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGT
CCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTG
AACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTA
TATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTG
CATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACC
AGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATC
AAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTC
AATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAA
GATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATA
GTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCT
TTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCT
GGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCG
TTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGC
TCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGG
AATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAAT
TCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGAT
GGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTG
AGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGA
GAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCAT
TTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACC
TTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAA
TCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAG
CCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGC
CTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAA
GTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAG
TCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAG
GATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCT
TTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGT
GAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTA
AGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAAT
TTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACA
GCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCT
GGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACA
CAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTG
GACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGAC
TTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTG
GGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTC
TCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTC
CCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAA
AGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCA
GACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTT
CAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAAT
GCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTC
CAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTA
TTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAA
GGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCT
TCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTA
GCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCA
AACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTG
GGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTG
TTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTG
TCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACAC
GTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGG
ATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACA
GCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAG
CTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCC
AACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCT
CCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAA
CGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGAC
CAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAG
AAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAA
CCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACT
GAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAG
TCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGG
ATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAG
GAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTG
GCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGC
ATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGG
GGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGG
GAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCT
GCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATG
CGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000534358_chr11_118354896_+_13221nt
CTTTACGTCGGCGCGTAACGAGGGGGTGCGTGTGAGGTCATCGCGCGGGCGGGCGGGCGGGGTCTGGCGGTTTGAACGAGACGAAGACGG
AACCGGAGCCGGTTGCGGGCAGTGGACGCGGTTCTGCCGAGAGCCGAAGATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAA
CCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTGAATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTA
TTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAAGTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAA
CTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATAATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAA
TTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGATGGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGA
AACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAGAAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCAT
CTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTGCGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGC
TGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAA
TAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGAT
GGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTA
TTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCG
TCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCC
TGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGG
ATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAA
CTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTC
CAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTG
TACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTC
TCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAG
CTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAA
GATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACA
GCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTC
CAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCA
GTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGA
ACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACC
CCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGG
CCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGC
TGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTA
TCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGA
AGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTT
GGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCT
CTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTG
CCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGA
AAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTG
TTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTC
TGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCG
TCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGT
TTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTAC
TAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTC
ATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAA
GAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAA
TGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGG
GCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCT
ATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAA
AGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTT
TATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTAT
GCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACT
GACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATC
TCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCA
AAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAG
GAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGA
CATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTC
AGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCG
GGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAAC
AAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAA
AGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACA
AGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTA
TAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACT
AAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGA
CAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTC
TATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCA
GAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCC
AGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACAT
CTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACC
TGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGT
CCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCT
TCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACC
CATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCT
ACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCT
GCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCC
ATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGC
CCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACT
TAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACA
GAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTT
GGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTT
AACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGA
CCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATC
TAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCA
TGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTAC
CCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGG
TTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCA
GCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAAC
GACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTG
TGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAAC
AGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAA
ACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGAC
AGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCA
TGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAA
TGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAA
ACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCT
GCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTT
CTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTA
TTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTT
CATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGAT
CTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATG
CCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTC
CAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACAT
GTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTA
GAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTC
CACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTA
GATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCG
AGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATT
GAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCC
CATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTG
CCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGG
AGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTA
GGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGA
CATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGA
TTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATG
ACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCT
GTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCT
ATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTA
ATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAA
GGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAA
GGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATT
CTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCA
GAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACC
AAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCAC
GATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGA
AGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCC
TGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCC
AGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACC
TCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGT
TTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTTGTTACTGAAATGATTAATGCACTGAT
GGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGG
CCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGC
TGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCC
AAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTC
CAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAGGAATTGTGATGGGTCATTCCCAAGAA
TCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTG
CTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTT
GGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAATAACAAGAATTAAGGGGGAAGCCCTG
GCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGC
ACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAACACACACACAAAAATAAAAAAAATATT
CTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAG
TTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTT
TATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAATCATGAATACTAGTCAAGTCACACACT
CTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGGAACTAATATAGTAATGCACCATGTAA
CAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCA
GGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAGTCCATTCCTCGGATCAGAGAAAAATG
CAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATG
TTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCA
AGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAA
CAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCA
AGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAA
AATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAA

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000389506_chr11_118354896_+_10305nt
CTTTACGTCGGCGCGTAACGAGGGGGTGCGTGTGAGGTCATCGCGCGGGCGGGCGGGCGGGGTCTGGCGGTTTGAACGAGACGAAGACGG
AACCGGAGCCGGTTGCGGGCAGTGGACGCGGTTCTGCCGAGAGCCGAAGATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAA
CCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTGAATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTA
TTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAAGTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAA
CTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATAATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAA
TTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGATGGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGA
AACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAGAAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCAT
CTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTGCGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGC
TGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAA
TAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGAT
GGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTA
TTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCG
TCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCC
TGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGG
ATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAA
CTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTC
CAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCG
GCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTAC
CAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGA
AGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCA
AGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAAT
TAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTG
GGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGA
GCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTC
ACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCAT
AGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGA
GTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAG
GGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCAT
GTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCC
TGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGA
AAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTAT
TGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCC
AGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATC
AAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCA
TGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAG
TCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTAC
CTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGT
CTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGG
GCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGA
AATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGA
GGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAA
AATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAA
TGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAAT
GAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTT
CAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGA
GGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGT
CCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCT
AAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGA
ACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAA
CTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCC
CCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATT
CTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGA
CGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGA
ACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAG
CAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGT
CACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTT
GGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGA
GCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATAC
TCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCG
TGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGC
AGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAG
TAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCT
GAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCC
TCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCC
AACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCAC
TCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGG
AGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGG
TGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTC
TCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGG
GGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGG
ACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGA
TGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTC
ATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGG
AGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAG
TTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCC
AAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGT
GGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTG
TGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCA
GCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGT
AGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATC
CTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCT
AGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCT
GACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACC
TGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGA
AGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAA
AGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGT
CCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGT
TGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCC
CTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCA
GCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCC
CATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAG
AAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAG
CAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCA
CTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGG
AGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTT
CCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTG
GGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATA
GTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGG
AATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAAT
AAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGA
CAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCAC
TTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCA
GGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTC
TTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAA
GGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGG
TCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAA
AAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTAC
TTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGC
CCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTG
CCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTA
AGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGC
ACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTT
TATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTT
TTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCA

>In-frame_MAPRE1_ENST00000375571_chr20_31427663_+_KMT2A_ENST00000354520_chr11_118354896_+_10970nt
CTTTACGTCGGCGCGTAACGAGGGGGTGCGTGTGAGGTCATCGCGCGGGCGGGCGGGCGGGGTCTGGCGGTTTGAACGAGACGAAGACGG
AACCGGAGCCGGTTGCGGGCAGTGGACGCGGTTCTGCCGAGAGCCGAAGATGGCAGTGAACGTATACTCAACGTCAGTGACCAGTGATAA
CCTAAGTCGACATGACATGCTGGCCTGGATCAATGAGTCTCTGCAGTTGAATCTGACAAAGATCGAACAGTTGTGCTCAGGGGCTGCGTA
TTGTCAGTTTATGGACATGCTGTTCCCTGGCTCCATTGCCTTGAAGAAAGTGAAATTCCAAGCTAAGCTAGAACACGAGTACATCCAGAA
CTTCAAAATACTACAAGCAGGTTTTAAGAGAATGGGTGTTGACAAAATAATTCCTGTGGACAAATTAGTAAAAGGAAAGTTTCAGGACAA
TTTTGAATTCGTTCAGTGGTTCAAGAAGTTTTTCGATGCAAACTATGATGGAAAAGACTATGACCCTGTGGCTGCCAGACAAGGTCAAGA
AACTGCAGTGGCTCCTTCCCTTGTTGCTCCAGCTCTGAATAAACCGAAGAAACCTCTCACTTCTAGCAGTGCAGCTCCCCAGAGGCCCAT
CTCAACACAGAGAACCGCTGCGGCTCCTAAGGCTGGCCCTGGTGTGGTGCGAAAGAACCCTGGTGTGGGCAACGGAGACGACGAGGCAGC
TGAGTTGATGCAGCAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAA
TAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTT
CCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTG
TGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCC
CACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTG
GGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATG
TTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGA
GATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGC
CCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCA
GGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTAC
TGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGA
GTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAA
GTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAA
CAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGA
GCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTAC
ACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTT
ATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTT
GTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATT
CTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGT
CTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAG
AAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTC
TATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATA
CTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAG
CACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGA
AATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGAT
TCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAAT
AGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTC
CAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGA
TCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAA
TTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGA
CTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTA
CCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTC
TTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTC
TACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAA
CGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATC
TTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGG
CCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGT
AGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATC
CAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCC
AGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGA
CAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTC
TAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAA
GCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCAC
TAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTC
ACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGG
TAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAA
AAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGA
GTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAA
TAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGA
GAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGA
AGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCT
AGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTC
AGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCC
TGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGG
TCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAA
GTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCAC
TGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGAC
CTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACT
AAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTT
CCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCA
ACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCG
TCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGAT
TAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACAT
CATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGG
CACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATC
CATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATAT
TGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAAT
GTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTAC
GGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGAT
TCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACT
GGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTC
AGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCA
CAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGG
AGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCC
GGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCC
ACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAG
TGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCG
CCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTC
TGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAG
GGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGA
TGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAA
GACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGT
GATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTT
CCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTC
TCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAA
GTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCC
CCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACA
GCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCT
CGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCC
TGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCC
TTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCT
ACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCT
AGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCC
CAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCC
CTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGA
TGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAA
CATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAA
ATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACAT
AGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACC
TTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGG
TCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCT
GTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATG
ACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAG
AAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGT
TTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCC
TCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCA
ACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTG
ACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCA
CCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAA
GGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATA
CGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACT
TTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTG
TCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCA


Top

FusionGenePPI for MAPRE1_KMT2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAPRE1APC, TERF1, COPS5, COPS8, CSN3, COPS7A, HDAC6, LRP1, APP, CDK2, AURKA, AURKB, TUBB, SPTAN1, FN1, VCAM1, IQCB1, ITGA4, CLIP1, TUBA1A, BAG3, CDK5RAP2, OLA1, SNRPD2, SNRPE, SNRPF, TBCB, YWHAZ, PAFAH1B1, PRKACA, PRKACB, STIM1, NAV1, NAV2, NAV3, TRIO, LMO2, POLE2, PSMA1, PDE4DIP, TROAP, PQBP1, MAPRE2, MAPRE1, MAPRE3, SPDYE2, CYLD, IKBKG, HSPA1A, TRAF2, ABCB1, STK11, BCL3, KAT2B, KAT5, MTUS2, KIF2C, MACF1, CLASP1, CLASP2, NUPR1, ABCE1, GAS2L1, DST, PPP1R13L, AKAP9, KIF18B, UNK, CKAP5, SUMO3, UCHL3, NTRK1, EWSR1, SRPK2, CEP135, CEP290, LCA5, OFD1, CEP170, CEP104, DCTN1, CEP19, ACTN4, ACTN1, ADD1, ADD3, BLMH, CALM1, CALML3, CAPZA1, CD59, CLTA, CLTB, CLTC, CPM, CTNNA1, CTNNB1, DAB2, DBN1, DYNC1H1, DYNC1I2, EPS15, FLNA, FYN, GNAI2, HSP90AB1, ABLIM1, MYO1E, PCM1, PCNT, PLEC, PRKAR2A, QARS, SPTBN1, SSFA2, SVIL, TMOD1, TPM4, CLIP2, YES1, LUZP1, AXIN1, SORBS2, TAOK2, CEP350, SEC16A, WDR1, ACTR1A, PIBF1, DCTN2, SPAG5, RAB35, FGFR1OP, SYNPO, CEP162, CEP131, ERC1, COBL, LIMA1, SYBU, CEP72, MIB1, AFAP1, HYI, DYNLRB1, CCDC77, KNSTRN, NEXN, SPECC1, TBC1D31, SSX2IP, MISP, CD109, WDR90, TPRN, U2AF2, CDH1, KLHL21, PRKAR2B, HSPA5, PSMB1, TANC2, PPP1CA, IFT52, G3BP1KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7351584_160013623932histone H3K4me3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7361584_160013623970histone H3K4me3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7361584_160013623973histone H3K4me3
TgeneKMT2Achr20:31427663chr11:118354896ENST00000354520+7353764_377113623932WDR5
TgeneKMT2Achr20:31427663chr11:118354896ENST00000389506+7363764_377113623970WDR5
TgeneKMT2Achr20:31427663chr11:118354896ENST00000534358+7363764_377113623973WDR5


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+57185_268199269CDK5RAP2
HgeneMAPRE1chr20:31427663chr11:118354896ENST00000375571+57124_268199269MTUS2/TIP150


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAPRE1_KMT2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAPRE1_KMT2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMAPRE1C0043094Weight Gain1CTD_human
HgeneMAPRE1C0151744Myocardial Ischemia1CTD_human
TgeneKMT2AC0023418leukemia2CTD_human
TgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
TgeneKMT2AC0023470Myeloid Leukemia2CTD_human
TgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
TgeneKMT2AC0001418Adenocarcinoma1CTD_human
TgeneKMT2AC0005695Bladder Neoplasm1CTD_human
TgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
TgeneKMT2AC0008625Chromosome Aberrations1CTD_human
TgeneKMT2AC0023448Lymphoid leukemia1CTD_human
TgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
TgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
TgeneKMT2AC0036341Schizophrenia1PSYGENET
TgeneKMT2AC0038356Stomach Neoplasms1CTD_human
TgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
TgeneKMT2AC2239176Liver carcinoma1CTD_human