FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20909

FusionGeneSummary for MAP4K5_ADCK1

check button Fusion gene summary
Fusion gene informationFusion gene name: MAP4K5_ADCK1
Fusion gene ID: 20909
HgeneTgene
Gene symbol

MAP4K5

ADCK1

Gene ID

11183

57143

Gene namemitogen-activated protein kinase kinase kinase kinase 5aarF domain containing kinase 1
SynonymsGCKR|KHS|KHS1|MAPKKKK5-
Cytomap

14q22.1

14q24.3

Type of geneprotein-codingprotein-coding
Descriptionmitogen-activated protein kinase kinase kinase kinase 5MAPK/ERK kinase kinase kinase 5MEK kinase kinase 5MEKKK 5germinal center kinase-relatedkinase homologous to SPS1/STE20uncharacterized aarF domain-containing protein kinase 1
Modification date2018052320180519
UniProtAcc

Q9Y4K4

Q86TW2

Ensembl transtripts involved in fusion geneENST00000013125, ENST00000557578, 
ENST00000238561, ENST00000341211, 
ENST00000556560, 
Fusion gene scores* DoF score9 X 9 X 8=6483 X 3 X 4=36
# samples 134
** MAII scorelog2(13/648*10)=-2.31748218985617
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MAP4K5 [Title/Abstract] AND ADCK1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAP4K5

GO:0006468

protein phosphorylation

9038372

HgeneMAP4K5

GO:0035556

intracellular signal transduction

9038372


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-XF-AAMW-01AMAP4K5chr14

50971518

-ADCK1chr14

78353434

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000013125ENST00000238561MAP4K5chr14

50971518

-ADCK1chr14

78353434

+
In-frameENST00000013125ENST00000341211MAP4K5chr14

50971518

-ADCK1chr14

78353434

+
5CDS-intronENST00000013125ENST00000556560MAP4K5chr14

50971518

-ADCK1chr14

78353434

+
intron-3CDSENST00000557578ENST00000238561MAP4K5chr14

50971518

-ADCK1chr14

78353434

+
intron-3CDSENST00000557578ENST00000341211MAP4K5chr14

50971518

-ADCK1chr14

78353434

+
intron-intronENST00000557578ENST00000556560MAP4K5chr14

50971518

-ADCK1chr14

78353434

+

Top

FusionProtFeatures for MAP4K5_ADCK1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAP4K5

Q9Y4K4

ADCK1

Q86TW2

May play a role in the response to environmental stress.Appears to act upstream of the JUN N-terminal pathway.{ECO:0000269|PubMed:9038372}. The function of this protein is not yet clear. It is notknown if it has protein kinase activity and what type of substrateit would phosphorylate (Ser, Thr or Tyr).

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAP4K5chr14:50971518chr14:78353434ENST00000013125-33226_3455847Nucleotide bindingATP
TgeneADCK1chr14:50971518chr14:78353434ENST00000238561+311155_467141524DomainNote=Protein kinase
TgeneADCK1chr14:50971518chr14:78353434ENST00000341211+210155_46773456DomainNote=Protein kinase
TgeneADCK1chr14:50971518chr14:78353434ENST00000238561+311161_169141524Nucleotide bindingATP
TgeneADCK1chr14:50971518chr14:78353434ENST00000341211+210161_16973456Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAP4K5chr14:50971518chr14:78353434ENST00000013125-33220_27755847DomainProtein kinase
HgeneMAP4K5chr14:50971518chr14:78353434ENST00000013125-332506_81955847DomainCNH


Top

FusionGeneSequence for MAP4K5_ADCK1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000238561_chr14_78353434_+_438aa
MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPDPXFVPELRXHPSGDGLPGPGPQGSAAXWADGGRE
GPAPKGAGSELEGHSPDGGARSGCEAAVPRVXVYVACGXSQEEPAFGAGFPQXREECXEGVPDAQAFXLLEGPPNPLGPVHGAGPPDGVC
GWRAGQXQRLHGEEQDRRQXDLTPPGQDVXXDDLRQWLRALRSPPRQCTGAEAPRHGKGGDCPVGPWALPDAHGRIPPELLPPLAVSDLD
XHEESEGVQPATGSRGSLPLVCLHADGAIVGLGQQRHQPSSRHCHXGLRDSQQRGQLPPPDQPSPQPRAAPDAAHLEDQRPAAWHXGRPG

>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000341211_chr14_78353434_+_438aa
MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPDPXFVPELRXHPSGDGLPGPGPQGSAAXWADGGRE
GPAPKGAGSELEGHSPDGGARSGCEAAVPRVXVYVACGXSQEEPAFGAGFPQXREECXEGVPDAQAFXLLEGPPNPLGPVHGAGPPDGVC
GWRAGQXQRLHGEEQDRRQXDLTPPGQDVXXDDLRQWLRALRSPPRQCTGAEAPRHGKGGDCPVGPWALPDAHGRIPPELLPPLAVSDLD
XHEESEGVQPATGSRGSLPLVCLHADGAIVGLGQQRHQPSSRHCHXGLRDSQQRGQLPPPDQPSPQPRAAPDAAHLEDQRPAAWHXGRPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000238561_chr14_78353434_+_1315nt
ATGGAGGCCCCGCTGCGGCCTGCCGCGGACATCCTGAGGCGGAACCCGCAGCAGGACTACGAACTCGTCCAGAGGGTCGGCAGCGGCACC
TACGGGGACGTCTATAAGGCCAGAAATGTACACACAGGAGAGCTGGCTGCAGTAAAAATCATTAAATTGGAGCCTGATCCATGATTTGTT
CCAGAGCTTCGATGACACCCCTCTGGGGACGGCCTCCCTGGCCCAGGTCCACAAGGCAGTGCTGCATGATGGGCGGACGGTGGCCGTGAA
GGTCCAGCACCCAAAGGTGCGGGCTCAGAGCTCGAAGGACATTCTCCTGATGGAGGTGCTCGTTCTGGCTGTGAAGCAGCTGTTCCCAGA
GTTTGAGTTTATGTGGCTTGTGGATGAAGCCAAGAAGAACCTGCCTTTGGAGCTGGATTTCCTCAATGAAGGGAGGAATGCTGAGAAGGT
GTCCCAGATGCTCAGGCATTTTGACTTCTTGAAGGTCCCCCGAATCCACTGGGACCTGTCCACGGAGCGGGTCCTCCTGATGGAGTTTGT
GGATGGCGGGCAGGTCAATGACAGAGACTACATGGAGAGGAACAAGATCGACGTCAATGAGATCTCACGCCACCTGGGCAAGATGTATAG
TGAGATGATCTTCGTCAATGGCTTCGTGCACTGCGATCCCCACCCCGGCAATGTACTGGTGCGGAAGCACCCCGGCACGGGAAAGGCGGA
GATTGTCCTGTTGGACCATGGGCTTTACCAGATGCTCACGGAAGAATTCCGCCTGAATTACTGCCACCTCTGGCAGTCTCTGATCTGGAC
TGACATGAAGAGAGTGAAGGAGTACAGCCAGCGACTGGGAGCCGGGGATCTCTACCCCTTGTTTGCCTGCATGCTGACGGCGCGATCGTG
GGACTCGGTCAACAGAGGCATCAGCCAAGCTCCCGTCACTGCCACTGAGGACTTAGAGATTCGCAACAACGCGGCCAACTACCTCCCCCA
GATCAGCCATCTCCTCAACCACGTGCCGCGCCAGATGCTGCTCATCTTGAAGACCAACGACCTGCTGCGTGGCATTGAGGCCGCCCTGGG
CACCCGCGCCAGCGCCAGCTCCTTTCTCAACATGTCACGTTGCTGCATCAGAGCGCTAGCTGAGCACAAGAAGAAGAATACCTGTTCATT
CTTCAGAAGGACCCAGATCTCTTTCAGCGAGGCCTTCAACTTATGGCAGATCAACCTCCATGAGCTCATCCTGCGTGTGAAGGGGTTGAA

>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000341211_chr14_78353434_+_1315nt
ATGGAGGCCCCGCTGCGGCCTGCCGCGGACATCCTGAGGCGGAACCCGCAGCAGGACTACGAACTCGTCCAGAGGGTCGGCAGCGGCACC
TACGGGGACGTCTATAAGGCCAGAAATGTACACACAGGAGAGCTGGCTGCAGTAAAAATCATTAAATTGGAGCCTGATCCATGATTTGTT
CCAGAGCTTCGATGACACCCCTCTGGGGACGGCCTCCCTGGCCCAGGTCCACAAGGCAGTGCTGCATGATGGGCGGACGGTGGCCGTGAA
GGTCCAGCACCCAAAGGTGCGGGCTCAGAGCTCGAAGGACATTCTCCTGATGGAGGTGCTCGTTCTGGCTGTGAAGCAGCTGTTCCCAGA
GTTTGAGTTTATGTGGCTTGTGGATGAAGCCAAGAAGAACCTGCCTTTGGAGCTGGATTTCCTCAATGAAGGGAGGAATGCTGAGAAGGT
GTCCCAGATGCTCAGGCATTTTGACTTCTTGAAGGTCCCCCGAATCCACTGGGACCTGTCCACGGAGCGGGTCCTCCTGATGGAGTTTGT
GGATGGCGGGCAGGTCAATGACAGAGACTACATGGAGAGGAACAAGATCGACGTCAATGAGATCTCACGCCACCTGGGCAAGATGTATAG
TGAGATGATCTTCGTCAATGGCTTCGTGCACTGCGATCCCCACCCCGGCAATGTACTGGTGCGGAAGCACCCCGGCACGGGAAAGGCGGA
GATTGTCCTGTTGGACCATGGGCTTTACCAGATGCTCACGGAAGAATTCCGCCTGAATTACTGCCACCTCTGGCAGTCTCTGATCTGGAC
TGACATGAAGAGAGTGAAGGAGTACAGCCAGCGACTGGGAGCCGGGGATCTCTACCCCTTGTTTGCCTGCATGCTGACGGCGCGATCGTG
GGACTCGGTCAACAGAGGCATCAGCCAAGCTCCCGTCACTGCCACTGAGGACTTAGAGATTCGCAACAACGCGGCCAACTACCTCCCCCA
GATCAGCCATCTCCTCAACCACGTGCCGCGCCAGATGCTGCTCATCTTGAAGACCAACGACCTGCTGCGTGGCATTGAGGCCGCCCTGGG
CACCCGCGCCAGCGCCAGCTCCTTTCTCAACATGTCACGTTGCTGCATCAGAGCGCTAGCTGAGCACAAGAAGAAGAATACCTGTTCATT
CTTCAGAAGGACCCAGATCTCTTTCAGCGAGGCCTTCAACTTATGGCAGATCAACCTCCATGAGCTCATCCTGCGTGTGAAGGGGTTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000238561_chr14_78353434_+_2197nt
GGGTGGGGAACGTGGTGCGGCGGCGGCGGCGGCGGCGACTGTACGCGCCTCCGCCGCCCCCGAGAGGACGCGCCGTGCAGCGGCTGAGTG
GCGGCGGCGGCGACGGCAAACCCGGAGCTGCCGGCCGGCGCGCGGGAGGAGGACGCGGGTGCGGTCTAGGAAGTAGGTCCCGGGCTCCGC
GCTCAACAAAGACGGGGCCGCCCCCATTAGACGGAGCTGCGGGCGGAGGCTCCATGTTGGGAAGCGGCGCCGTTCGTGCTTGTTAGCGGG
AATCCGGGAGCCGCGGGGTGAGCTGGCGGGGGCCGGGCCCTAAGTGAAGATGGAGGCCCCGCTGCGGCCTGCCGCGGACATCCTGAGGCG
GAACCCGCAGCAGGACTACGAACTCGTCCAGAGGGTCGGCAGCGGCACCTACGGGGACGTCTATAAGGCCAGAAATGTACACACAGGAGA
GCTGGCTGCAGTAAAAATCATTAAATTGGAGCCTGATCCATGATTTGTTCCAGAGCTTCGATGACACCCCTCTGGGGACGGCCTCCCTGG
CCCAGGTCCACAAGGCAGTGCTGCATGATGGGCGGACGGTGGCCGTGAAGGTCCAGCACCCAAAGGTGCGGGCTCAGAGCTCGAAGGACA
TTCTCCTGATGGAGGTGCTCGTTCTGGCTGTGAAGCAGCTGTTCCCAGAGTTTGAGTTTATGTGGCTTGTGGATGAAGCCAAGAAGAACC
TGCCTTTGGAGCTGGATTTCCTCAATGAAGGGAGGAATGCTGAGAAGGTGTCCCAGATGCTCAGGCATTTTGACTTCTTGAAGGTCCCCC
GAATCCACTGGGACCTGTCCACGGAGCGGGTCCTCCTGATGGAGTTTGTGGATGGCGGGCAGGTCAATGACAGAGACTACATGGAGAGGA
ACAAGATCGACGTCAATGAGATCTCACGCCACCTGGGCAAGATGTATAGTGAGATGATCTTCGTCAATGGCTTCGTGCACTGCGATCCCC
ACCCCGGCAATGTACTGGTGCGGAAGCACCCCGGCACGGGAAAGGCGGAGATTGTCCTGTTGGACCATGGGCTTTACCAGATGCTCACGG
AAGAATTCCGCCTGAATTACTGCCACCTCTGGCAGTCTCTGATCTGGACTGACATGAAGAGAGTGAAGGAGTACAGCCAGCGACTGGGAG
CCGGGGATCTCTACCCCTTGTTTGCCTGCATGCTGACGGCGCGATCGTGGGACTCGGTCAACAGAGGCATCAGCCAAGCTCCCGTCACTG
CCACTGAGGACTTAGAGATTCGCAACAACGCGGCCAACTACCTCCCCCAGATCAGCCATCTCCTCAACCACGTGCCGCGCCAGATGCTGC
TCATCTTGAAGACCAACGACCTGCTGCGTGGCATTGAGGCCGCCCTGGGCACCCGCGCCAGCGCCAGCTCCTTTCTCAACATGTCACGTT
GCTGCATCAGAGCGCTAGCTGAGCACAAGAAGAAGAATACCTGTTCATTCTTCAGAAGGACCCAGATCTCTTTCAGCGAGGCCTTCAACT
TATGGCAGATCAACCTCCATGAGCTCATCCTGCGTGTGAAGGGGTTGAAGCTGGCTGACCGGGTCTTGGCCCTAATATGCTGGCTGTTCC
CTGCTCCACTCTGAGTGGAATTGCTCTCCCTGCCCCATTCTGGTGTCTTTCCACTCCTCAGCCCCTCATCTTGCCTCCACCCAGCTGCTC
CATTTTTGCCACATCGTGGCCCGCAGCCCCAGAGTCACTGTCCATGTCACCATCCTTCTCCTCCTTTGGAATCCTCTCCGCACACTGTGG
CCCTTGTCTCAGGGCCCACAAGCTGAACTGTGGCATAGCTCTCTCTTCTTCTCCAAGAAGACTCAGCAGCCTACATTCCCATTCCTGGTA
TGTGCCATTGGGTTGGATGTCCCCACTACTTCCGTTAACCCTTCCCATTGTCAAGATGTGCCACGGGTGCCACTGGGGGCACACTGAACT
TGTAGGGAGTGTGATTTTGTTGGAGGTGCACATGGTCTCTGAATTTGACAGAGAACACCTTCCCTTTCCTTGCCATGTCACCCTCCAGAG
GAAGTCACACCTCAGCGAGGTGGTTTGGCATCTGGGGCCAACTCCATTACAGCTATGAGCTCACTGCTGTCAGTGACGTTTGGTGTTTTC

>In-frame_MAP4K5_ENST00000013125_chr14_50971518_-_ADCK1_ENST00000341211_chr14_78353434_+_2195nt
GGGTGGGGAACGTGGTGCGGCGGCGGCGGCGGCGGCGACTGTACGCGCCTCCGCCGCCCCCGAGAGGACGCGCCGTGCAGCGGCTGAGTG
GCGGCGGCGGCGACGGCAAACCCGGAGCTGCCGGCCGGCGCGCGGGAGGAGGACGCGGGTGCGGTCTAGGAAGTAGGTCCCGGGCTCCGC
GCTCAACAAAGACGGGGCCGCCCCCATTAGACGGAGCTGCGGGCGGAGGCTCCATGTTGGGAAGCGGCGCCGTTCGTGCTTGTTAGCGGG
AATCCGGGAGCCGCGGGGTGAGCTGGCGGGGGCCGGGCCCTAAGTGAAGATGGAGGCCCCGCTGCGGCCTGCCGCGGACATCCTGAGGCG
GAACCCGCAGCAGGACTACGAACTCGTCCAGAGGGTCGGCAGCGGCACCTACGGGGACGTCTATAAGGCCAGAAATGTACACACAGGAGA
GCTGGCTGCAGTAAAAATCATTAAATTGGAGCCTGATCCATGATTTGTTCCAGAGCTTCGATGACACCCCTCTGGGGACGGCCTCCCTGG
CCCAGGTCCACAAGGCAGTGCTGCATGATGGGCGGACGGTGGCCGTGAAGGTCCAGCACCCAAAGGTGCGGGCTCAGAGCTCGAAGGACA
TTCTCCTGATGGAGGTGCTCGTTCTGGCTGTGAAGCAGCTGTTCCCAGAGTTTGAGTTTATGTGGCTTGTGGATGAAGCCAAGAAGAACC
TGCCTTTGGAGCTGGATTTCCTCAATGAAGGGAGGAATGCTGAGAAGGTGTCCCAGATGCTCAGGCATTTTGACTTCTTGAAGGTCCCCC
GAATCCACTGGGACCTGTCCACGGAGCGGGTCCTCCTGATGGAGTTTGTGGATGGCGGGCAGGTCAATGACAGAGACTACATGGAGAGGA
ACAAGATCGACGTCAATGAGATCTCACGCCACCTGGGCAAGATGTATAGTGAGATGATCTTCGTCAATGGCTTCGTGCACTGCGATCCCC
ACCCCGGCAATGTACTGGTGCGGAAGCACCCCGGCACGGGAAAGGCGGAGATTGTCCTGTTGGACCATGGGCTTTACCAGATGCTCACGG
AAGAATTCCGCCTGAATTACTGCCACCTCTGGCAGTCTCTGATCTGGACTGACATGAAGAGAGTGAAGGAGTACAGCCAGCGACTGGGAG
CCGGGGATCTCTACCCCTTGTTTGCCTGCATGCTGACGGCGCGATCGTGGGACTCGGTCAACAGAGGCATCAGCCAAGCTCCCGTCACTG
CCACTGAGGACTTAGAGATTCGCAACAACGCGGCCAACTACCTCCCCCAGATCAGCCATCTCCTCAACCACGTGCCGCGCCAGATGCTGC
TCATCTTGAAGACCAACGACCTGCTGCGTGGCATTGAGGCCGCCCTGGGCACCCGCGCCAGCGCCAGCTCCTTTCTCAACATGTCACGTT
GCTGCATCAGAGCGCTAGCTGAGCACAAGAAGAAGAATACCTGTTCATTCTTCAGAAGGACCCAGATCTCTTTCAGCGAGGCCTTCAACT
TATGGCAGATCAACCTCCATGAGCTCATCCTGCGTGTGAAGGGGTTGAAGCTGGCTGACCGGGTCTTGGCCCTAATATGCTGGCTGTTCC
CTGCTCCACTCTGAGTGGAATTGCTCTCCCTGCCCCATTCTGGTGTCTTTCCACTCCTCAGCCCCTCATCTTGCCTCCACCCAGCTGCTC
CATTTTTGCCACATCGTGGCCCGCAGCCCCAGAGTCACTGTCCATGTCACCATCCTTCTCCTCCTTTGGAATCCTCTCCGCACACTGTGG
CCCTTGTCTCAGGGCCCACAAGCTGAACTGTGGCATAGCTCTCTCTTCTTCTCCAAGAAGACTCAGCAGCCTACATTCCCATTCCTGGTA
TGTGCCATTGGGTTGGATGTCCCCACTACTTCCGTTAACCCTTCCCATTGTCAAGATGTGCCACGGGTGCCACTGGGGGCACACTGAACT
TGTAGGGAGTGTGATTTTGTTGGAGGTGCACATGGTCTCTGAATTTGACAGAGAACACCTTCCCTTTCCTTGCCATGTCACCCTCCAGAG
GAAGTCACACCTCAGCGAGGTGGTTTGGCATCTGGGGCCAACTCCATTACAGCTATGAGCTCACTGCTGTCAGTGACGTTTGGTGTTTTC


Top

FusionGenePPI for MAP4K5_ADCK1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAP4K5CRK, CRKL, TRAF2, HCK, COPS5, GRB2, ZNF440, SETDB1, NEDD4, ELAVL1, CDRT15, NTRK1, PPM1A, PPM1B, SMURF1, MAP4K3ADCK1EXOC5, MOV10, NXF1, SPACA1, PLAUR, GNAI2, MKNK2, ADCK1, STOML2, PRELID1, TOMM5, CHCHD3, IMMT, ATP5H, MLYCD, CHCHD2, ECH1, PMPCB, ATP5O, MTX1, C1QBP, MTCH2, APLNR, NPY2R, C5AR2, VIPR2, GRPR, SLC15A1, LYPD4, SLC18A1, CHRM4, C1orf85, OPRM1, P2RX5, FAM131B, IL13RA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAP4K5_ADCK1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAP4K5_ADCK1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource