FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20834

FusionGeneSummary for MAP3K10_SUPT5H

check button Fusion gene summary
Fusion gene informationFusion gene name: MAP3K10_SUPT5H
Fusion gene ID: 20834
HgeneTgene
Gene symbol

MAP3K10

SUPT5H

Gene ID

4294

6829

Gene namemitogen-activated protein kinase kinase kinase 10SPT5 homolog, DSIF elongation factor subunit
SynonymsMEKK10|MLK2|MSTSPT5|SPT5H|Tat-CT1
Cytomap

19q13.2

19q13.2

Type of geneprotein-codingprotein-coding
Descriptionmitogen-activated protein kinase kinase kinase 10MKN28 derived nonreceptor_type serine/threonine kinaseMKN28 kinasemixed lineage kinase 2protein kinase MSTtranscription elongation factor SPT5DRB sensitivity-inducing factor 160 kDa subunitDRB sensitivity-inducing factor large subunitDSIF large subunitDSIF p160Tat-cotransactivator 1 proteinhSPT5suppressor of Ty 5 homolog
Modification date2018052320180523
UniProtAcc

Q02779

O00267

Ensembl transtripts involved in fusion geneENST00000253055, ENST00000593906, 
ENST00000599117, ENST00000432763, 
ENST00000402194, ENST00000359191, 
ENST00000598725, 
Fusion gene scores* DoF score4 X 4 X 4=647 X 6 X 4=168
# samples 47
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MAP3K10 [Title/Abstract] AND SUPT5H [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAP3K10

GO:0018105

peptidyl-serine phosphorylation

19801649

HgeneMAP3K10

GO:0018107

peptidyl-threonine phosphorylation

19801649

TgeneSUPT5H

GO:0000122

negative regulation of transcription by RNA polymerase II

9450929

TgeneSUPT5H

GO:0006368

transcription elongation from RNA polymerase II promoter

9450929

TgeneSUPT5H

GO:0032785

negative regulation of DNA-templated transcription, elongation

9450929

TgeneSUPT5H

GO:0032786

positive regulation of DNA-templated transcription, elongation

9450929

TgeneSUPT5H

GO:0045944

positive regulation of transcription by RNA polymerase II

9450929


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-S9-A6U0-01AMAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000253055ENST00000599117MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
In-frameENST00000253055ENST00000432763MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
In-frameENST00000253055ENST00000402194MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
In-frameENST00000253055ENST00000359191MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
In-frameENST00000253055ENST00000598725MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
intron-3CDSENST00000593906ENST00000599117MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
intron-3CDSENST00000593906ENST00000432763MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
intron-3CDSENST00000593906ENST00000402194MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
intron-3CDSENST00000593906ENST00000359191MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+
intron-3CDSENST00000593906ENST00000598725MAP3K10chr19

40712064

+SUPT5Hchr19

39948315

+

Top

FusionProtFeatures for MAP3K10_SUPT5H


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAP3K10

Q02779

SUPT5H

O00267

Activates the JUN N-terminal pathway. {ECO:0000250}. Component of the DRB sensitivity-inducing factor complex(DSIF complex), which regulates mRNA processing and transcriptionelongation by RNA polymerase II. DSIF positively regulates mRNAcapping by stimulating the mRNA guanylyltransferase activity ofRNGTT/CAP1A. DSIF also acts cooperatively with the negativeelongation factor complex (NELF complex) to enhancetranscriptional pausing at sites proximal to the promoter.Transcriptional pausing may facilitate the assembly of anelongation competent RNA polymerase II complex. DSIF and NELFpromote pausing by inhibition of the transcription elongationfactor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II attranscription pause sites and stimulates the weak intrinsicnuclease activity of the enzyme. Cleavage of blocked transcriptsby RNA polymerase II promotes the resumption of transcription fromthe new 3' terminus and may allow repeated attempts attranscription through natural pause sites. DSIF can alsopositively regulate transcriptional elongation and is required forthe efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppresstranscriptional pausing in transcripts derived from the HIV-1 LTRand blocks premature release of HIV-1 transcripts at terminatorsequences. {ECO:0000269|PubMed:10075709,ECO:0000269|PubMed:10199401, ECO:0000269|PubMed:10393184,ECO:0000269|PubMed:10421630, ECO:0000269|PubMed:10454543,ECO:0000269|PubMed:10757782, ECO:0000269|PubMed:10912001,ECO:0000269|PubMed:11112772, ECO:0000269|PubMed:11553615,ECO:0000269|PubMed:11809800, ECO:0000269|PubMed:12653964,ECO:0000269|PubMed:12718890, ECO:0000269|PubMed:14701750,ECO:0000269|PubMed:15136722, ECO:0000269|PubMed:15380072,ECO:0000269|PubMed:16214896, ECO:0000269|PubMed:9450929,ECO:0000269|PubMed:9514752, ECO:0000269|PubMed:9857195}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+5102_5478955Compositional biasNote=Poly-Glu
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+510449_463478955Compositional biasNote=Arg/Lys-rich (basic)
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+51016_81478955DomainSH3
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+51098_360478955DomainProtein kinase
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+510104_112478955Nucleotide bindingATP
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+510384_405478955RegionNote=Leucine-zipper 1
HgeneMAP3K10chr19:40712064chr19:39948315ENST00000253055+510419_440478955RegionNote=Leucine-zipper 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128844_968801084Compositional biasNote=Pro-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229844_968801084Compositional biasNote=Pro-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230844_968801088Compositional biasNote=Pro-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129844_968801088Compositional biasNote=Pro-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331844_968801088Compositional biasNote=Pro-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128273_306801084DomainNote=KOW 1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128420_451801084DomainNote=KOW 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128472_503801084DomainNote=KOW 3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128594_627801084DomainNote=KOW 4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128704_737801084DomainNote=KOW 5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229273_306801084DomainNote=KOW 1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229420_451801084DomainNote=KOW 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229472_503801084DomainNote=KOW 3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229594_627801084DomainNote=KOW 4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229704_737801084DomainNote=KOW 5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230273_306801088DomainNote=KOW 1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230420_451801088DomainNote=KOW 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230472_503801088DomainNote=KOW 3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230594_627801088DomainNote=KOW 4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230704_737801088DomainNote=KOW 5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129273_306801088DomainNote=KOW 1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129420_451801088DomainNote=KOW 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129472_503801088DomainNote=KOW 3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129594_627801088DomainNote=KOW 4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129704_737801088DomainNote=KOW 5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331273_306801088DomainNote=KOW 1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331420_451801088DomainNote=KOW 2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331472_503801088DomainNote=KOW 3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331594_627801088DomainNote=KOW 4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331704_737801088DomainNote=KOW 5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128754_817801084RegionNote=9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ]%2C motif CTR1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128844_950801084RegionNote=10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y%2C motif CTR2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229754_817801084RegionNote=9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ]%2C motif CTR1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229844_950801084RegionNote=10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y%2C motif CTR2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230754_817801088RegionNote=9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ]%2C motif CTR1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230844_950801088RegionNote=10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y%2C motif CTR2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129754_817801088RegionNote=9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ]%2C motif CTR1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129844_950801088RegionNote=10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y%2C motif CTR2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331754_817801088RegionNote=9 X 7 AA approximate tandem repeats of G-S-[QR]-T-P-X-[YQ]%2C motif CTR1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331844_950801088RegionNote=10 X 8 AA approximate tandem repeats of P-[TS]-P-S-P-[QA]-[SG]-Y%2C motif CTR2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128754_759801084RepeatNote=CTR1-1%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128760_765801084RepeatNote=CTR1-2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128766_771801084RepeatNote=CTR1-3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128772_778801084RepeatNote=CTR1-4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128781_787801084RepeatNote=CTR1-5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128788_794801084RepeatNote=CTR1-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128796_802801084RepeatNote=CTR1-7
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128803_809801084RepeatNote=CTR1-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128811_817801084RepeatNote=CTR1-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128844_851801084RepeatNote=CTR2-1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128854_862801084RepeatNote=CTR2-2%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128863_869801084RepeatNote=CTR2-3%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128881_885801084RepeatNote=CTR2-4%3B half-length
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128896_902801084RepeatNote=CTR2-5%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128904_911801084RepeatNote=CTR2-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128916_921801084RepeatNote=CTR2-7%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128924_930801084RepeatNote=CTR2-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128932_939801084RepeatNote=CTR2-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128943_950801084RepeatNote=CTR2-10
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229754_759801084RepeatNote=CTR1-1%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229760_765801084RepeatNote=CTR1-2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229766_771801084RepeatNote=CTR1-3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229772_778801084RepeatNote=CTR1-4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229781_787801084RepeatNote=CTR1-5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229788_794801084RepeatNote=CTR1-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229796_802801084RepeatNote=CTR1-7
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229803_809801084RepeatNote=CTR1-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229811_817801084RepeatNote=CTR1-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229844_851801084RepeatNote=CTR2-1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229854_862801084RepeatNote=CTR2-2%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229863_869801084RepeatNote=CTR2-3%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229881_885801084RepeatNote=CTR2-4%3B half-length
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229896_902801084RepeatNote=CTR2-5%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229904_911801084RepeatNote=CTR2-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229916_921801084RepeatNote=CTR2-7%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229924_930801084RepeatNote=CTR2-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229932_939801084RepeatNote=CTR2-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229943_950801084RepeatNote=CTR2-10
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230754_759801088RepeatNote=CTR1-1%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230760_765801088RepeatNote=CTR1-2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230766_771801088RepeatNote=CTR1-3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230772_778801088RepeatNote=CTR1-4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230781_787801088RepeatNote=CTR1-5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230788_794801088RepeatNote=CTR1-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230796_802801088RepeatNote=CTR1-7
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230803_809801088RepeatNote=CTR1-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230811_817801088RepeatNote=CTR1-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230844_851801088RepeatNote=CTR2-1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230854_862801088RepeatNote=CTR2-2%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230863_869801088RepeatNote=CTR2-3%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230881_885801088RepeatNote=CTR2-4%3B half-length
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230896_902801088RepeatNote=CTR2-5%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230904_911801088RepeatNote=CTR2-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230916_921801088RepeatNote=CTR2-7%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230924_930801088RepeatNote=CTR2-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230932_939801088RepeatNote=CTR2-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230943_950801088RepeatNote=CTR2-10
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129754_759801088RepeatNote=CTR1-1%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129760_765801088RepeatNote=CTR1-2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129766_771801088RepeatNote=CTR1-3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129772_778801088RepeatNote=CTR1-4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129781_787801088RepeatNote=CTR1-5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129788_794801088RepeatNote=CTR1-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129796_802801088RepeatNote=CTR1-7
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129803_809801088RepeatNote=CTR1-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129811_817801088RepeatNote=CTR1-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129844_851801088RepeatNote=CTR2-1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129854_862801088RepeatNote=CTR2-2%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129863_869801088RepeatNote=CTR2-3%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129881_885801088RepeatNote=CTR2-4%3B half-length
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129896_902801088RepeatNote=CTR2-5%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129904_911801088RepeatNote=CTR2-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129916_921801088RepeatNote=CTR2-7%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129924_930801088RepeatNote=CTR2-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129932_939801088RepeatNote=CTR2-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129943_950801088RepeatNote=CTR2-10
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331754_759801088RepeatNote=CTR1-1%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331760_765801088RepeatNote=CTR1-2
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331766_771801088RepeatNote=CTR1-3
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331772_778801088RepeatNote=CTR1-4
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331781_787801088RepeatNote=CTR1-5
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331788_794801088RepeatNote=CTR1-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331796_802801088RepeatNote=CTR1-7
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331803_809801088RepeatNote=CTR1-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331811_817801088RepeatNote=CTR1-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331844_851801088RepeatNote=CTR2-1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331854_862801088RepeatNote=CTR2-2%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331863_869801088RepeatNote=CTR2-3%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331881_885801088RepeatNote=CTR2-4%3B half-length
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331896_902801088RepeatNote=CTR2-5%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331904_911801088RepeatNote=CTR2-6
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331916_921801088RepeatNote=CTR2-7%3B approximate
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331924_930801088RepeatNote=CTR2-8
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331932_939801088RepeatNote=CTR2-9
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331943_950801088RepeatNote=CTR2-10

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+12811_106801084Compositional biasNote=Glu-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+22911_106801084Compositional biasNote=Glu-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+23011_106801088Compositional biasNote=Glu-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+12911_106801088Compositional biasNote=Glu-rich
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+33111_106801088Compositional biasNote=Glu-rich


Top

FusionGeneSequence for MAP3K10_SUPT5H


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000599117_chr19_39948315_+_1486aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPGAPAAPAGLQLP
QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
RVRKRKGNFKRSRLLKLREGGSHISLPSDVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYM
KKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQ
THVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSL
KDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTEST
GKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVIL
FSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQN
NIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRG
GFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYG
SQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGY
PDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSP
MTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVK

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000432763_chr19_39948315_+_1486aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPGAPAAPAGLQLP
QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
RVRKRKGNFKRSRLLKLREGGSHISLPSDVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYM
KKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQ
THVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSL
KDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTEST
GKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVIL
FSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQN
NIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRG
GFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYG
SQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGY
PDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSP
MTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVK

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000402194_chr19_39948315_+_1482aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPGAPAAPAGLQLP
QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
RVRKRKGNFKRSRLLKLREGGSHISLPSDVDDEYEDEDQWEDGAEDILEKASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYMKKYA
KSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVK
QAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWF
AKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKER
EHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDL
TMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHV
KDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGS
PGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTP
MYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPS
SPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPG
APSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000359191_chr19_39948315_+_1482aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPGAPAAPAGLQLP
QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
RVRKRKGNFKRSRLLKLREGGSHISLPSDVDDEYEDEDQWEDGAEDILEKASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYMKKYA
KSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVK
QAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWF
AKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKER
EHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDL
TMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHV
KDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGS
PGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTP
MYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPS
SPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPG
APSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000598725_chr19_39948315_+_1486aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPGAPAAPAGLQLP
QEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWM
APEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
RVRKRKGNFKRSRLLKLREGGSHISLPSDVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYM
KKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQ
THVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSL
KDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTEST
GKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVIL
FSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQN
NIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRG
GFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYG
SQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGY
PDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSP
MTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000599117_chr19_39948315_+_4458nt
ATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTGTTCGACTACGAGGCGGCG
GGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGCGACGAGGGCTGGTGGACC
GGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCCGCGGGCCTCCAGCTGCCC
CAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGGGCCCTGTGGCGTGGCGAG
GAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAGGAAGCCCGGCTCTTTGGA
GCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATGGAGTATGCCCGGGGTGGT
GCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCCCGGGGCATGAACTACCTA
CACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATCGAGAACCACAACCTCGCA
GACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCGGGGACCTACGCCTGGATG
GCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGGGAGCTGCTGACGGGGGAG
GTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATTCCCTCCACGTGCCCCGAG
CCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTGAAGCGGCTTGAAGTCATC
GAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATTCAGCACATGTTTGATGAC
CTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTCCAGGAGGAGCAGCTGCGG
CGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAGCTGAGCCAGGAGAAGCCC
CGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATCAGCCTGCCCTCTGATGTT
GACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAAGCCTCCAATATCGATAAT
GTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTATTACATG
AAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTGCTCCCA
GGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTCATTGCC
TACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTACAAGCAG
ACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATGACAGAC
GTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATTGCTCAG
GTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATGAGCTTG
AAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGTGATGTT
GCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCTGTGATC
ACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAGAGCACA
GGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATCCTCAGC
GTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAATACTTC
AAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTTATCCTG
TTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTTGGGGGC
CAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTGCTGAAC
ATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAGCAGAAC
AACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGCTTCGCC
TTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAGCCCCGT
GATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAGCGTGGC
GGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTGCGCATC
TCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGCCAGACC
ATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATGTATGGC
TCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCACACTAC
GGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCACGGGCT
GAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCTGGCTAC
CCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTCTCTCCC
TATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGCTACCAG
AATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTACAGTCCT
ATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTAACCACT
GACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGCATGTGC
TCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAGGTGAAA
GTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGATGAGCAG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000432763_chr19_39948315_+_4458nt
ATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTGTTCGACTACGAGGCGGCG
GGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGCGACGAGGGCTGGTGGACC
GGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCCGCGGGCCTCCAGCTGCCC
CAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGGGCCCTGTGGCGTGGCGAG
GAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAGGAAGCCCGGCTCTTTGGA
GCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATGGAGTATGCCCGGGGTGGT
GCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCCCGGGGCATGAACTACCTA
CACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATCGAGAACCACAACCTCGCA
GACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCGGGGACCTACGCCTGGATG
GCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGGGAGCTGCTGACGGGGGAG
GTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATTCCCTCCACGTGCCCCGAG
CCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTGAAGCGGCTTGAAGTCATC
GAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATTCAGCACATGTTTGATGAC
CTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTCCAGGAGGAGCAGCTGCGG
CGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAGCTGAGCCAGGAGAAGCCC
CGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATCAGCCTGCCCTCTGATGTT
GACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAAGCCTCCAATATCGATAAT
GTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTATTACATG
AAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTGCTCCCA
GGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTCATTGCC
TACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTACAAGCAG
ACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATGACAGAC
GTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATTGCTCAG
GTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATGAGCTTG
AAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGTGATGTT
GCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCTGTGATC
ACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAGAGCACA
GGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATCCTCAGC
GTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAATACTTC
AAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTTATCCTG
TTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTTGGGGGC
CAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTGCTGAAC
ATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAGCAGAAC
AACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGCTTCGCC
TTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAGCCCCGT
GATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAGCGTGGC
GGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTGCGCATC
TCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGCCAGACC
ATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATGTATGGC
TCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCACACTAC
GGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCACGGGCT
GAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCTGGCTAC
CCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTCTCTCCC
TATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGCTACCAG
AATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTACAGTCCT
ATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTAACCACT
GACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGCATGTGC
TCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAGGTGAAA
GTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGATGAGCAG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000402194_chr19_39948315_+_4446nt
ATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTGTTCGACTACGAGGCGGCG
GGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGCGACGAGGGCTGGTGGACC
GGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCCGCGGGCCTCCAGCTGCCC
CAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGGGCCCTGTGGCGTGGCGAG
GAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAGGAAGCCCGGCTCTTTGGA
GCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATGGAGTATGCCCGGGGTGGT
GCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCCCGGGGCATGAACTACCTA
CACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATCGAGAACCACAACCTCGCA
GACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCGGGGACCTACGCCTGGATG
GCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGGGAGCTGCTGACGGGGGAG
GTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATTCCCTCCACGTGCCCCGAG
CCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTGAAGCGGCTTGAAGTCATC
GAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATTCAGCACATGTTTGATGAC
CTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTCCAGGAGGAGCAGCTGCGG
CGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAGCTGAGCCAGGAGAAGCCC
CGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATCAGCCTGCCCTCTGATGTT
GACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGCCTCCAATATCGATAATGTTGTCCTGGAT
GAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTATTACATGAAGAAATACGCC
AAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTGCTCCCAGGAGTCAAGGAT
CCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTCATTGCCTACCAGTTCACA
GACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTACAAGCAGACCCACGTGAAG
CAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATGACAGACGTGCTCAAAGTG
GTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATTGCTCAGGTGGACTACGTG
GAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATGAGCTTGAAAGACTGGTTT
GCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGTGATGTTGCCTCTGATGGT
GACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCTGTGATCACGGAGGGTGTG
AAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAGAGCACAGGGAAGGAGCGG
GAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATCCTCAGCGTGGATGGCAAC
AAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAATACTTCAAGATGGGGGAC
CACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTTATCCTGTTCTCTGACCTC
ACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTTGGGGGCCAGCATGAATGG
GGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTGCTGAACATGTACGGGAAG
GTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAGCAGAACAACATCCATGTG
AAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGCTTCGCCTTCCTACATTGC
AAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAGCCCCGTGATGTGACCAAC
TTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAGCGTGGCGGCTTTGGTAGC
CCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTGCGCATCTCCCAGGGGCCC
TACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGCCAGACCATCTCTGTGGAC
CGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATGTATGGCTCCCAGACGCCC
ATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCACACTACGGCTCACAGACG
CCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCACGGGCTGAGGAAGAATAT
GAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCTGGCTACCCAGACCCCTCG
TCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTCTCTCCCTATGCTGCCCCC
TCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGCTACCAGAATACCCACTCC
CCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTACAGTCCTATGACACCTGGA
GCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTAACCACTGACATTCAGGTG
AAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGCATGTGCTCTGTGTACCTG
AAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAGGTGAAAGTGATCCTGGGC
GAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGATGAGCAGCTCAAGATCCTC

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000359191_chr19_39948315_+_4446nt
ATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTGTTCGACTACGAGGCGGCG
GGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGCGACGAGGGCTGGTGGACC
GGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCCGCGGGCCTCCAGCTGCCC
CAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGGGCCCTGTGGCGTGGCGAG
GAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAGGAAGCCCGGCTCTTTGGA
GCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATGGAGTATGCCCGGGGTGGT
GCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCCCGGGGCATGAACTACCTA
CACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATCGAGAACCACAACCTCGCA
GACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCGGGGACCTACGCCTGGATG
GCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGGGAGCTGCTGACGGGGGAG
GTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATTCCCTCCACGTGCCCCGAG
CCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTGAAGCGGCTTGAAGTCATC
GAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATTCAGCACATGTTTGATGAC
CTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTCCAGGAGGAGCAGCTGCGG
CGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAGCTGAGCCAGGAGAAGCCC
CGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATCAGCCTGCCCTCTGATGTT
GACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGCCTCCAATATCGATAATGTTGTCCTGGAT
GAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTATTACATGAAGAAATACGCC
AAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTGCTCCCAGGAGTCAAGGAT
CCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTCATTGCCTACCAGTTCACA
GACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTACAAGCAGACCCACGTGAAG
CAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATGACAGACGTGCTCAAAGTG
GTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATTGCTCAGGTGGACTACGTG
GAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATGAGCTTGAAAGACTGGTTT
GCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGTGATGTTGCCTCTGATGGT
GACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCTGTGATCACGGAGGGTGTG
AAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAGAGCACAGGGAAGGAGCGG
GAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATCCTCAGCGTGGATGGCAAC
AAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAATACTTCAAGATGGGGGAC
CACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTTATCCTGTTCTCTGACCTC
ACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTTGGGGGCCAGCATGAATGG
GGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTGCTGAACATGTACGGGAAG
GTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAGCAGAACAACATCCATGTG
AAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGCTTCGCCTTCCTACATTGC
AAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAGCCCCGTGATGTGACCAAC
TTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAGCGTGGCGGCTTTGGTAGC
CCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTGCGCATCTCCCAGGGGCCC
TACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGCCAGACCATCTCTGTGGAC
CGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATGTATGGCTCCCAGACGCCC
ATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCACACTACGGCTCACAGACG
CCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCACGGGCTGAGGAAGAATAT
GAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCTGGCTACCCAGACCCCTCG
TCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTCTCTCCCTATGCTGCCCCC
TCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGCTACCAGAATACCCACTCC
CCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTACAGTCCTATGACACCTGGA
GCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTAACCACTGACATTCAGGTG
AAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGCATGTGCTCTGTGTACCTG
AAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAGGTGAAAGTGATCCTGGGC
GAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGATGAGCAGCTCAAGATCCTC

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000598725_chr19_39948315_+_4458nt
ATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTGTTCGACTACGAGGCGGCG
GGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGCGACGAGGGCTGGTGGACC
GGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCCGCGGGCCTCCAGCTGCCC
CAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGGGCCCTGTGGCGTGGCGAG
GAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAGGAAGCCCGGCTCTTTGGA
GCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATGGAGTATGCCCGGGGTGGT
GCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCCCGGGGCATGAACTACCTA
CACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATCGAGAACCACAACCTCGCA
GACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCGGGGACCTACGCCTGGATG
GCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGGGAGCTGCTGACGGGGGAG
GTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATTCCCTCCACGTGCCCCGAG
CCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTGAAGCGGCTTGAAGTCATC
GAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATTCAGCACATGTTTGATGAC
CTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTCCAGGAGGAGCAGCTGCGG
CGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAGCTGAGCCAGGAGAAGCCC
CGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATCAGCCTGCCCTCTGATGTT
GACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAAGCCTCCAATATCGATAAT
GTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTATTACATG
AAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTGCTCCCA
GGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTCATTGCC
TACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTACAAGCAG
ACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATGACAGAC
GTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATTGCTCAG
GTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATGAGCTTG
AAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGTGATGTT
GCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCTGTGATC
ACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAGAGCACA
GGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATCCTCAGC
GTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAATACTTC
AAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTTATCCTG
TTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTTGGGGGC
CAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTGCTGAAC
ATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAGCAGAAC
AACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGCTTCGCC
TTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAGCCCCGT
GATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAGCGTGGC
GGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTGCGCATC
TCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGCCAGACC
ATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATGTATGGC
TCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCACACTAC
GGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCACGGGCT
GAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCTGGCTAC
CCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTCTCTCCC
TATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGCTACCAG
AATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTACAGTCCT
ATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTAACCACT
GACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGCATGTGC
TCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAGGTGAAA
GTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGATGAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000599117_chr19_39948315_+_5017nt
CGCGCGGCCAGGCCCTCTTAGCCCTCTGCCGTTTGGGGGGCACGGGTGAACCTGCCGCCCCACTCCCACCCCGCCCCGCCCCGCCCGTAC
AGCCAAATCGGAAGGGACGAGCCTGCCCTTTGAAAGGGTTTTTTTTCTTGCTCCTGCGGAGGGCGCCCCAGCCATGGCCCTCAGGAGCTC
CCTAGACCCCGCAGGGACTGCCCTCCATCCCGGCCGCCGGGGCCCGCCCTCTGCATCCCGCGGGCAGCCTGTGTGAAGCGGCCTCCCGCA
GCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTG
TTCGACTACGAGGCGGCGGGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGC
GACGAGGGCTGGTGGACCGGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCC
GCGGGCCTCCAGCTGCCCCAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGG
GCCCTGTGGCGTGGCGAGGAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAG
GAAGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATG
GAGTATGCCCGGGGTGGTGCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCC
CGGGGCATGAACTACCTACACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATC
GAGAACCACAACCTCGCAGACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCG
GGGACCTACGCCTGGATGGCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGG
GAGCTGCTGACGGGGGAGGTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATT
CCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTG
AAGCGGCTTGAAGTCATCGAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATT
CAGCACATGTTTGATGACCTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTC
CAGGAGGAGCAGCTGCGGCGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAG
CTGAGCCAGGAGAAGCCCCGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATC
AGCCTGCCCTCTGATGTTGACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAA
GCCTCCAATATCGATAATGTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAA
CTGGGCGAGTATTACATGAAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACC
CAGCAGCAGCTGCTCCCAGGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTG
ATGCGCAAGTTCATTGCCTACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTAC
GTGGAGGCCTACAAGCAGACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCC
ATCAAGGAGATGACAGACGTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTAC
AAGGATGACATTGCTCAGGTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATC
AAGGCCCGCATGAGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGG
TCCCTGGGGGGTGATGTTGCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTC
GCCATGTCTGCTGTGATCACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAG
GTGGTGACTGAGAGCACAGGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTG
CAGGGCAAGATCCTCAGCGTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAG
GAACTTAGAAAATACTTCAAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAG
GAGAATTTCGTTATCCTGTTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCA
GGTGTGGATGTTGGGGGCCAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAG
ACCTTCCAGGTGCTGAACATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCC
TTGGACTCAGAGCAGAACAACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCAT
CTCTTCCGAAGCTTCGCCTTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCT
GGGGGCTCAAAGCCCCGTGATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGT
GCTGGAGGTCAGCGTGGCGGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATC
GGCCAGACCGTGCGCATCTCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTG
CACTCCACCTGCCAGACCATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGG
AGGACGCCCATGTATGGCTCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGT
AGCCGCACCCCACACTACGGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCC
AACACGCCGTCACGGGCTGAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAAT
CCCCAAACACCTGGCTACCCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAAC
ACAGACCAGTTCTCTCCCTATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCA
AGCCCAGCAGGCTACCAGAATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGC
CCCGTTGGCTACAGTCCTATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCC
AGCGACTGGGTAACCACTGACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGT
GTCACGGGGGGCATGTGCTCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACC
AAGAACAACAAGGTGAAAGTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGT
ATGGACCTTGATGAGCAGCTCAAGATCCTCAACCTCCGCTTCCTGGGGAAGCTCCTGGAAGCCTGAAGCAGGCAGGGCCGGTGGACTTCG
TCGGATGAAGAGTGATCCTCCTTCCTTCCCTGGCCCTTGGCTGTGACACAAGATCCTCCTGCAGGGCTAGGCGGATTGTTCTGGATTTCC
TTTTGTTTTTCCTTTTAGTTTTCCATCTTTTCCCTCCCTGGTGCTCATTGGAATCTGAGTAGAGTCTGGGGGAGGGTCCCCACCTTCCTG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000432763_chr19_39948315_+_5013nt
CGCGCGGCCAGGCCCTCTTAGCCCTCTGCCGTTTGGGGGGCACGGGTGAACCTGCCGCCCCACTCCCACCCCGCCCCGCCCCGCCCGTAC
AGCCAAATCGGAAGGGACGAGCCTGCCCTTTGAAAGGGTTTTTTTTCTTGCTCCTGCGGAGGGCGCCCCAGCCATGGCCCTCAGGAGCTC
CCTAGACCCCGCAGGGACTGCCCTCCATCCCGGCCGCCGGGGCCCGCCCTCTGCATCCCGCGGGCAGCCTGTGTGAAGCGGCCTCCCGCA
GCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTG
TTCGACTACGAGGCGGCGGGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGC
GACGAGGGCTGGTGGACCGGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCC
GCGGGCCTCCAGCTGCCCCAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGG
GCCCTGTGGCGTGGCGAGGAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAG
GAAGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATG
GAGTATGCCCGGGGTGGTGCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCC
CGGGGCATGAACTACCTACACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATC
GAGAACCACAACCTCGCAGACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCG
GGGACCTACGCCTGGATGGCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGG
GAGCTGCTGACGGGGGAGGTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATT
CCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTG
AAGCGGCTTGAAGTCATCGAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATT
CAGCACATGTTTGATGACCTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTC
CAGGAGGAGCAGCTGCGGCGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAG
CTGAGCCAGGAGAAGCCCCGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATC
AGCCTGCCCTCTGATGTTGACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAA
GCCTCCAATATCGATAATGTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAA
CTGGGCGAGTATTACATGAAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACC
CAGCAGCAGCTGCTCCCAGGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTG
ATGCGCAAGTTCATTGCCTACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTAC
GTGGAGGCCTACAAGCAGACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCC
ATCAAGGAGATGACAGACGTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTAC
AAGGATGACATTGCTCAGGTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATC
AAGGCCCGCATGAGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGG
TCCCTGGGGGGTGATGTTGCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTC
GCCATGTCTGCTGTGATCACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAG
GTGGTGACTGAGAGCACAGGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTG
CAGGGCAAGATCCTCAGCGTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAG
GAACTTAGAAAATACTTCAAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAG
GAGAATTTCGTTATCCTGTTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCA
GGTGTGGATGTTGGGGGCCAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAG
ACCTTCCAGGTGCTGAACATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCC
TTGGACTCAGAGCAGAACAACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCAT
CTCTTCCGAAGCTTCGCCTTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCT
GGGGGCTCAAAGCCCCGTGATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGT
GCTGGAGGTCAGCGTGGCGGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATC
GGCCAGACCGTGCGCATCTCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTG
CACTCCACCTGCCAGACCATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGG
AGGACGCCCATGTATGGCTCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGT
AGCCGCACCCCACACTACGGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCC
AACACGCCGTCACGGGCTGAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAAT
CCCCAAACACCTGGCTACCCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAAC
ACAGACCAGTTCTCTCCCTATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCA
AGCCCAGCAGGCTACCAGAATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGC
CCCGTTGGCTACAGTCCTATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCC
AGCGACTGGGTAACCACTGACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGT
GTCACGGGGGGCATGTGCTCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACC
AAGAACAACAAGGTGAAAGTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGT
ATGGACCTTGATGAGCAGCTCAAGATCCTCAACCTCCGCTTCCTGGGGAAGCTCCTGGAAGCCTGAAGCAGGCAGGGCCGGTGGACTTCG
TCGGATGAAGAGTGATCCTCCTTCCTTCCCTGGCCCTTGGCTGTGACACAAGATCCTCCTGCAGGGCTAGGCGGATTGTTCTGGATTTCC
TTTTGTTTTTCCTTTTAGTTTTCCATCTTTTCCCTCCCTGGTGCTCATTGGAATCTGAGTAGAGTCTGGGGGAGGGTCCCCACCTTCCTG

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000402194_chr19_39948315_+_5001nt
CGCGCGGCCAGGCCCTCTTAGCCCTCTGCCGTTTGGGGGGCACGGGTGAACCTGCCGCCCCACTCCCACCCCGCCCCGCCCCGCCCGTAC
AGCCAAATCGGAAGGGACGAGCCTGCCCTTTGAAAGGGTTTTTTTTCTTGCTCCTGCGGAGGGCGCCCCAGCCATGGCCCTCAGGAGCTC
CCTAGACCCCGCAGGGACTGCCCTCCATCCCGGCCGCCGGGGCCCGCCCTCTGCATCCCGCGGGCAGCCTGTGTGAAGCGGCCTCCCGCA
GCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTG
TTCGACTACGAGGCGGCGGGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGC
GACGAGGGCTGGTGGACCGGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCC
GCGGGCCTCCAGCTGCCCCAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGG
GCCCTGTGGCGTGGCGAGGAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAG
GAAGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATG
GAGTATGCCCGGGGTGGTGCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCC
CGGGGCATGAACTACCTACACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATC
GAGAACCACAACCTCGCAGACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCG
GGGACCTACGCCTGGATGGCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGG
GAGCTGCTGACGGGGGAGGTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATT
CCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTG
AAGCGGCTTGAAGTCATCGAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATT
CAGCACATGTTTGATGACCTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTC
CAGGAGGAGCAGCTGCGGCGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAG
CTGAGCCAGGAGAAGCCCCGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATC
AGCCTGCCCTCTGATGTTGACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGCCTCCAATATC
GATAATGTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTAT
TACATGAAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTG
CTCCCAGGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTC
ATTGCCTACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTAC
AAGCAGACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATG
ACAGACGTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATT
GCTCAGGTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATG
AGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGT
GATGTTGCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCT
GTGATCACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAG
AGCACAGGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATC
CTCAGCGTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAA
TACTTCAAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTT
ATCCTGTTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTT
GGGGGCCAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTG
CTGAACATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAG
CAGAACAACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGC
TTCGCCTTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAG
CCCCGTGATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAG
CGTGGCGGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTG
CGCATCTCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGC
CAGACCATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATG
TATGGCTCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCA
CACTACGGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCA
CGGGCTGAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCT
GGCTACCCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTC
TCTCCCTATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGC
TACCAGAATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTAC
AGTCCTATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTA
ACCACTGACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGC
ATGTGCTCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAG
GTGAAAGTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGAT
GAGCAGCTCAAGATCCTCAACCTCCGCTTCCTGGGGAAGCTCCTGGAAGCCTGAAGCAGGCAGGGCCGGTGGACTTCGTCGGATGAAGAG
TGATCCTCCTTCCTTCCCTGGCCCTTGGCTGTGACACAAGATCCTCCTGCAGGGCTAGGCGGATTGTTCTGGATTTCCTTTTGTTTTTCC
TTTTAGTTTTCCATCTTTTCCCTCCCTGGTGCTCATTGGAATCTGAGTAGAGTCTGGGGGAGGGTCCCCACCTTCCTGTACCTCCTCCCC

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000359191_chr19_39948315_+_5005nt
CGCGCGGCCAGGCCCTCTTAGCCCTCTGCCGTTTGGGGGGCACGGGTGAACCTGCCGCCCCACTCCCACCCCGCCCCGCCCCGCCCGTAC
AGCCAAATCGGAAGGGACGAGCCTGCCCTTTGAAAGGGTTTTTTTTCTTGCTCCTGCGGAGGGCGCCCCAGCCATGGCCCTCAGGAGCTC
CCTAGACCCCGCAGGGACTGCCCTCCATCCCGGCCGCCGGGGCCCGCCCTCTGCATCCCGCGGGCAGCCTGTGTGAAGCGGCCTCCCGCA
GCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTG
TTCGACTACGAGGCGGCGGGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGC
GACGAGGGCTGGTGGACCGGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCC
GCGGGCCTCCAGCTGCCCCAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGG
GCCCTGTGGCGTGGCGAGGAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAG
GAAGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATG
GAGTATGCCCGGGGTGGTGCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCC
CGGGGCATGAACTACCTACACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATC
GAGAACCACAACCTCGCAGACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCG
GGGACCTACGCCTGGATGGCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGG
GAGCTGCTGACGGGGGAGGTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATT
CCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTG
AAGCGGCTTGAAGTCATCGAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATT
CAGCACATGTTTGATGACCTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTC
CAGGAGGAGCAGCTGCGGCGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAG
CTGAGCCAGGAGAAGCCCCGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATC
AGCCTGCCCTCTGATGTTGACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGCCTCCAATATC
GATAATGTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAACTGGGCGAGTAT
TACATGAAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACCCAGCAGCAGCTG
CTCCCAGGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTGATGCGCAAGTTC
ATTGCCTACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTACGTGGAGGCCTAC
AAGCAGACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCCATCAAGGAGATG
ACAGACGTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTACAAGGATGACATT
GCTCAGGTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATCAAGGCCCGCATG
AGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGGTCCCTGGGGGGT
GATGTTGCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTCGCCATGTCTGCT
GTGATCACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAGGTGGTGACTGAG
AGCACAGGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGATC
CTCAGCGTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAGGAACTTAGAAAA
TACTTCAAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAGGAGAATTTCGTT
ATCCTGTTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCAGGTGTGGATGTT
GGGGGCCAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAGACCTTCCAGGTG
CTGAACATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCCTTGGACTCAGAG
CAGAACAACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCATCTCTTCCGAAGC
TTCGCCTTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCTGGGGGCTCAAAG
CCCCGTGATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGTGCTGGAGGTCAG
CGTGGCGGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATCGGCCAGACCGTG
CGCATCTCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTGCACTCCACCTGC
CAGACCATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGGAGGACGCCCATG
TATGGCTCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGTAGCCGCACCCCA
CACTACGGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCCAACACGCCGTCA
CGGGCTGAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAATCCCCAAACACCT
GGCTACCCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAACACAGACCAGTTC
TCTCCCTATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCAAGCCCAGCAGGC
TACCAGAATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGCCCCGTTGGCTAC
AGTCCTATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCCAGCGACTGGGTA
ACCACTGACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGTGTCACGGGGGGC
ATGTGCTCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACCAAGAACAACAAG
GTGAAAGTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGTATGGACCTTGAT
GAGCAGCTCAAGATCCTCAACCTCCGCTTCCTGGGGAAGCTCCTGGAAGCCTGAAGCAGGCAGGGCCGGTGGACTTCGTCGGATGAAGAG
TGATCCTCCTTCCTTCCCTGGCCCTTGGCTGTGACACAAGATCCTCCTGCAGGGCTAGGCGGATTGTTCTGGATTTCCTTTTGTTTTTCC
TTTTAGTTTTCCATCTTTTCCCTCCCTGGTGCTCATTGGAATCTGAGTAGAGTCTGGGGGAGGGTCCCCACCTTCCTGTACCTCCTCCCC

>In-frame_MAP3K10_ENST00000253055_chr19_40712064_+_SUPT5H_ENST00000598725_chr19_39948315_+_5017nt
CGCGCGGCCAGGCCCTCTTAGCCCTCTGCCGTTTGGGGGGCACGGGTGAACCTGCCGCCCCACTCCCACCCCGCCCCGCCCCGCCCGTAC
AGCCAAATCGGAAGGGACGAGCCTGCCCTTTGAAAGGGTTTTTTTTCTTGCTCCTGCGGAGGGCGCCCCAGCCATGGCCCTCAGGAGCTC
CCTAGACCCCGCAGGGACTGCCCTCCATCCCGGCCGCCGGGGCCCGCCCTCTGCATCCCGCGGGCAGCCTGTGTGAAGCGGCCTCCCGCA
GCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGTGGCCAAGGAGTGGGGCACGACCCCCGCGGGGCCCGTCTGGACCGCGGTG
TTCGACTACGAGGCGGCGGGCGACGAGGAGCTGACCCTGCGGAGGGGCGATCGCGTCCAGGTGCTTTCCCAAGACTGTGCGGTGTCCGGC
GACGAGGGCTGGTGGACCGGGCAGCTCCCCAGCGGCCGCGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGGCGCCCCCGCTGCACCC
GCGGGCCTCCAGCTGCCCCAGGAGATCCCCTTCCACGAGCTGCAGCTAGAGGAGATCATCGGTGTGGGGGGCTTTGGCAAGGTCTATCGG
GCCCTGTGGCGTGGCGAGGAGGTGGCAGTCAAGGCCGCCCGGCTGGACCCTGAGAAGGACCCGGCAGTGACAGCGGAGCAGGTGTGCCAG
GAAGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATAATTGCCCTTAGGGGCGCCTGCCTCAACCCCCCACACCTCTGCCTAGTGATG
GAGTATGCCCGGGGTGGTGCACTGAGCAGGGTGCTGGCAGGTCGCCGGGTGCCACCTCACGTGCTGGTCAACTGGGCTGTGCAGGTGGCC
CGGGGCATGAACTACCTACACAATGATGCCCCTGTGCCCATCATCCACCGGGACCTCAAGTCCATCAACATCCTGATCCTGGAGGCCATC
GAGAACCACAACCTCGCAGACACGGTGCTCAAGATCACGGACTTCGGCCTCGCCCGCGAGTGGCACAAGACCACCAAGATGAGCGCTGCG
GGGACCTACGCCTGGATGGCGCCGGAGGTTATCCGTCTCTCCCTCTTCTCCAAAAGCAGTGATGTCTGGAGCTTCGGGGTGCTGCTGTGG
GAGCTGCTGACGGGGGAGGTCCCCTACCGTGAGATCGACGCCTTGGCCGTGGCGTATGGCGTGGCTATGAATAAGCTGACGCTGCCCATT
CCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTCCTGGAGGAATGCTGGGACCCAGACCCCCACGGGCGGCCAGATTTCGGTAGCATCTTG
AAGCGGCTTGAAGTCATCGAACAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACTCGCTGCAGGAAGACTGGAAGCTGGAGATT
CAGCACATGTTTGATGACCTTCGGACCAAGGAGAAGGAGCTTCGGAGCCGTGAGGAGGAGCTGCTGCGGGCGGCACAGGAGCAGCGCTTC
CAGGAGGAGCAGCTGCGGCGGCGGGAGCAGGAGCTGGCAGAACGTGAGATGGACATCGTGGAACGGGAGCTGCACCTGCTCATGTGCCAG
CTGAGCCAGGAGAAGCCCCGGGTCCGCAAGCGCAAGGGCAACTTCAAGCGCAGCCGCCTGCTCAAGCTGCGGGAAGGCGGCAGCCACATC
AGCCTGCCCTCTGATGTTGACGATGAGTATGAGGACGAGGACCAGTGGGAGGATGGAGCAGAGGACATTCTAGAGAAAGAAGAGATTGAA
GCCTCCAATATCGATAATGTTGTCCTGGATGAAGATCGTTCTGGGGCTCGCCGCCTGCAAAACCTCTGGAGGGACCAGCGAGAAGAAGAA
CTGGGCGAGTATTACATGAAGAAATACGCCAAGTCATCTGTGGGAGAGACGGTGTATGGAGGATCTGATGAGCTCTCAGACGACATCACC
CAGCAGCAGCTGCTCCCAGGAGTCAAGGATCCCAATCTGTGGACTGTCAAATGTAAGATTGGGGAGGAACGGGCCACGGCCATTTCCTTG
ATGCGCAAGTTCATTGCCTACCAGTTCACAGACACGCCCCTGCAGATCAAGTCAGTAGTGGCACCAGAGCATGTGAAGGGCTACATCTAC
GTGGAGGCCTACAAGCAGACCCACGTGAAGCAGGCCATTGAGGGGGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCC
ATCAAGGAGATGACAGACGTGCTCAAAGTGGTGAAGGAGGTGGCCAACCTGAAACCAAAGTCCTGGGTCCGCCTCAAGCGGGGCATCTAC
AAGGATGACATTGCTCAGGTGGACTACGTGGAGCCCAGCCAGAACACCATCTCCCTGAAGATGATCCCACGCATCGACTACGATCGCATC
AAGGCCCGCATGAGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTTAAGCGGCCTCCACAGAGGCTGTTTGATGCTGAGAAGATCAGG
TCCCTGGGGGGTGATGTTGCCTCTGATGGTGACTTCCTCATCTTTGAGGGGAACCGTTACAGCCGGAAGGGCTTTCTGTTCAAGAGCTTC
GCCATGTCTGCTGTGATCACGGAGGGTGTGAAGCCAACACTCTCTGAGCTGGAAAAGTTTGAGGACCAGCCAGAGGGCATTGACCTGGAG
GTGGTGACTGAGAGCACAGGGAAGGAGCGGGAGCACAACTTCCAACCTGGGGACAACGTGGAGGTCTGTGAGGGTGAGCTCATCAACCTG
CAGGGCAAGATCCTCAGCGTGGATGGCAACAAGATCACCATCATGCCCAAGCATGAGGACCTCAAGGACATGTTGGAGTTCCCAGCCCAG
GAACTTAGAAAATACTTCAAGATGGGGGACCACGTGAAGGTGATTGCTGGCCGATTCGAGGGCGACACAGGCCTCATTGTGCGGGTGGAG
GAGAATTTCGTTATCCTGTTCTCTGACCTCACCATGCATGAGCTGAAGGTGCTCCCCCGGGACCTGCAGCTCTGCTCAGAGACAGCATCA
GGTGTGGATGTTGGGGGCCAGCATGAATGGGGCGAGCTGGTGCAGCTGGATCCCCAGACTGTGGGTGTCATCGTGCGACTAGAACGGGAG
ACCTTCCAGGTGCTGAACATGTACGGGAAGGTGGTGACTGTCAGACATCAGGCTGTGACCCGGAAGAAGGACAACCGCTTTGCTGTGGCC
TTGGACTCAGAGCAGAACAACATCCATGTGAAAGACATCGTTAAGGTCATTGATGGCCCCCACTCAGGCCGAGAAGGGGAGATTCGCCAT
CTCTTCCGAAGCTTCGCCTTCCTACATTGCAAGAAACTGGTGGAGAACGGGGGCATGTTTGTCTGCAAGACCCGCCACCTGGTGCTGGCT
GGGGGCTCAAAGCCCCGTGATGTGACCAACTTCACCGTGGGTGGCTTTGCGCCTATGAGTCCCCGGATCAGCAGCCCCATGCACCCCAGT
GCTGGAGGTCAGCGTGGCGGCTTTGGTAGCCCAGGTGGCGGCAGTGGTGGCATGAGCAGGGGCCGGGGCCGGAGGGACAACGAACTCATC
GGCCAGACCGTGCGCATCTCCCAGGGGCCCTACAAAGGCTACATCGGTGTGGTGAAAGATGCCACAGAGTCCACGGCCCGTGTGGAGCTG
CACTCCACCTGCCAGACCATCTCTGTGGACCGTCAGCGGCTCACCACGGTGGGCTCACGGCGCCCGGGCGGCATGACCTCGACCTATGGG
AGGACGCCCATGTATGGCTCCCAGACGCCCATGTATGGCTCTGGCTCCCGAACACCCATGTACGGCTCACAGACACCCCTCCAGGATGGT
AGCCGCACCCCACACTACGGCTCACAGACGCCCCTGCATGATGGCAGCCGCACTCCTGCCCAGAGTGGGGCCTGGGACCCCAACAACCCC
AACACGCCGTCACGGGCTGAGGAAGAATATGAGTATGCTTTCGATGATGAGCCCACCCCGTCCCCGCAGGCCTATGGGGGAACCCCCAAT
CCCCAAACACCTGGCTACCCAGACCCCTCGTCCCCACAGGTCAACCCACAATACAACCCGCAGACGCCAGGGACGCCGGCCATGTACAAC
ACAGACCAGTTCTCTCCCTATGCTGCCCCCTCCCCACAAGGTTCCTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAGGTGGCGCCA
AGCCCAGCAGGCTACCAGAATACCCACTCCCCAGCCAGCTACCACCCTACACCGTCGCCCATGGCCTATCAGGCTAGCCCCAGCCCGAGC
CCCGTTGGCTACAGTCCTATGACACCTGGAGCTCCCTCCCCTGGTGGCTACAACCCACACACGCCAGGCTCAGGCATCGAGCAGAACTCC
AGCGACTGGGTAACCACTGACATTCAGGTGAAGGTGCGGGACACCTACCTGGATACACAGGTGGTGGGACAGACAGGTGTCATCCGCAGT
GTCACGGGGGGCATGTGCTCTGTGTACCTGAAGGACAGTGAGAAGGTTGTCAGCATTTCCAGTGAGCACCTGGAGCCTATCACCCCCACC
AAGAACAACAAGGTGAAAGTGATCCTGGGCGAGGATCGGGAAGCCACGGGCGTCCTACTGAGCATTGATGGTGAGGATGGCATTGTCCGT
ATGGACCTTGATGAGCAGCTCAAGATCCTCAACCTCCGCTTCCTGGGGAAGCTCCTGGAAGCCTGAAGCAGGCAGGGCCGGTGGACTTCG
TCGGATGAAGAGTGATCCTCCTTCCTTCCCTGGCCCTTGGCTGTGACACAAGATCCTCCTGCAGGGCTAGGCGGATTGTTCTGGATTTCC
TTTTGTTTTTCCTTTTAGTTTTCCATCTTTTCCCTCCCTGGTGCTCATTGGAATCTGAGTAGAGTCTGGGGGAGGGTCCCCACCTTCCTG


Top

FusionGenePPI for MAP3K10_SUPT5H


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAP3K10NEUROD1, CDC42, RAC1, KIF17, KIF3A, KIFAP3, YWHAE, HPCA, HTT, MAPK8IP1, MAPK8IP2, DNM1, CLTC, DLG4, HGS, ABL2, KIAA1804, COPS2, MAPK9, MAP3K10, MAPK1, MAPK14, GARS, MAP2K4, SMURF1SUPT5HPRMT5, SUPT4H1, PRMT1, HTATSF1, POLR2A, PIN1, CDK9, CDK7, CCNT1, CCNH, PCBD1, IKBKG, SSBP3, MAML3, ZBTB3, ZNF496, SMC3, SIRT7, TERF1, CUL3, GTF2F2, HNRNPK, ILF2, NENF, CDH2, PPT2, HSP90AA1, NELFB, BARD1, MNAT1, POLR2C, FN1, CSNK2A1, ZFYVE9, ZNF512B, NSMF, SOX2, CCNT2, LMNA, SNX4, LMAN2, SIK1, CARM1, RANBP3, SEC24C, SF1, ATP6V1B2, CSDE1, FARSB, GANAB, GART, MSH2, MSH6, PAICS, PLOD2, SAMHD1, SET, SWAP70, XRCC6, BRCA1, ENO1, SHMT2, MOV10, NXF1, CUL7, OBSL1, RNF2, SIRT6, DOK4, VPS26B, PAK4, CDKL1, HSPB1, CSNK2B, CTR9, PAF1, POLR2B, CPSF2, CSNK2A2, EEF1D, LEO1, MRTO4, NCL, PAPOLA, POLR2E, POLR2F, POLR2H, RANGAP1, RTF1, SUB1, SUPT6H, TAF6, NTRK1, BLM, IFI16, CEP290, LCA5, OFD1, PCM1, POLR2D, POLR2G, POLR2I, POLR2J, POLR2L, FAN1, C17orf85, IWS1, CEP170P1, NELFA, WIPF1, NOLC1, MED14, SETX, SYNE2, RPRD2, PHF3, POC1A, MCM10, RPRD1B, CDC73, JADE1, WDR61, RNF214, NFATC2, UBR5, EGFR, EYA4, PPP4C, RNGTT, TENC1, PAK7, KHDRBS2, CPNE4, CPNE2, PLEKHO1, CPNE7, HNRNPF, AIPL1, MIOS, FGFR1OP, PDE5A, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128313_420801084RNA polymerase II
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229313_420801084RNA polymerase II
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230313_420801088RNA polymerase II
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129313_420801088RNA polymerase II
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331313_420801088RNA polymerase II
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000359191+128176_270801084SUPT4H1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000402194+229176_270801084SUPT4H1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000432763+230176_270801088SUPT4H1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000598725+129176_270801088SUPT4H1
TgeneSUPT5Hchr19:40712064chr19:39948315ENST00000599117+331176_270801088SUPT4H1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAP3K10_SUPT5H


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAP3K10_SUPT5H


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource