FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20718

FusionGeneSummary for MAML3_MED24

check button Fusion gene summary
Fusion gene informationFusion gene name: MAML3_MED24
Fusion gene ID: 20718
HgeneTgene
Gene symbol

MAML3

MED24

Gene ID

55534

9862

Gene namemastermind like transcriptional coactivator 3mediator complex subunit 24
SynonymsCAGH3|ERDA3|GDN|MAM-2|MAM2|TNRC3|mam-3ARC100|CRSP100|CRSP4|DRIP100|MED5|THRAP4|TRAP100
Cytomap

4q31.1

17q21.1

Type of geneprotein-codingprotein-coding
Descriptionmastermind-like protein 3CAG repeat containing (glia-derived nexin I alpha)expanded repeat domain, CAG/CTG 3polyglutamine richtrinucleotide repeat containing 3mediator of RNA polymerase II transcription subunit 24CRSP complex subunit 4activator-recruited cofactor 100 kDa componentcofactor required for Sp1 transcriptional activation subunit 4cofactor required for Sp1 transcriptional activation, subunit 4, 10
Modification date2018052420180523
UniProtAcc

Q96JK9

O75448

Ensembl transtripts involved in fusion geneENST00000509479, ENST00000327122, 
ENST00000398940, 
ENST00000394126, 
ENST00000356271, ENST00000394128, 
ENST00000394127, ENST00000501516, 
ENST00000479829, 
Fusion gene scores* DoF score14 X 7 X 6=58816 X 12 X 6=1152
# samples 1417
** MAII scorelog2(14/588*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(17/1152*10)=-2.76053406530461
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MAML3 [Title/Abstract] AND MED24 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAML3

GO:0007219

Notch signaling pathway

12370315

HgeneMAML3

GO:0045944

positive regulation of transcription by RNA polymerase II

12370315

TgeneMED24

GO:0006367

transcription initiation from RNA polymerase II promoter

12218053

TgeneMED24

GO:0030518

intracellular steroid hormone receptor signaling pathway

11867769

TgeneMED24

GO:0030521

androgen receptor signaling pathway

12218053

TgeneMED24

GO:0045893

positive regulation of transcription, DNA-templated

10198638


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPCPGTCGA-PR-A5PH-01AMAML3chr4

141074014

-MED24chr17

38209888

-
TCGALDPCPGTCGA-PR-A5PH-01AMAML3chr4

141074014

-MED24chr17

38209633

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000509479ENST00000394126MAML3chr4

141074014

-MED24chr17

38209888

-
5CDS-5UTRENST00000509479ENST00000356271MAML3chr4

141074014

-MED24chr17

38209888

-
5CDS-5UTRENST00000509479ENST00000394128MAML3chr4

141074014

-MED24chr17

38209888

-
5CDS-5UTRENST00000509479ENST00000394127MAML3chr4

141074014

-MED24chr17

38209888

-
5CDS-intronENST00000509479ENST00000501516MAML3chr4

141074014

-MED24chr17

38209888

-
5CDS-5UTRENST00000509479ENST00000479829MAML3chr4

141074014

-MED24chr17

38209888

-
intron-3CDSENST00000327122ENST00000394126MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000327122ENST00000356271MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000327122ENST00000394128MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000327122ENST00000394127MAML3chr4

141074014

-MED24chr17

38209888

-
intron-intronENST00000327122ENST00000501516MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000327122ENST00000479829MAML3chr4

141074014

-MED24chr17

38209888

-
intron-3CDSENST00000398940ENST00000394126MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000398940ENST00000356271MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000398940ENST00000394128MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000398940ENST00000394127MAML3chr4

141074014

-MED24chr17

38209888

-
intron-intronENST00000398940ENST00000501516MAML3chr4

141074014

-MED24chr17

38209888

-
intron-5UTRENST00000398940ENST00000479829MAML3chr4

141074014

-MED24chr17

38209888

-
Frame-shiftENST00000509479ENST00000394126MAML3chr4

141074014

-MED24chr17

38209633

-
Frame-shiftENST00000509479ENST00000356271MAML3chr4

141074014

-MED24chr17

38209633

-
Frame-shiftENST00000509479ENST00000394128MAML3chr4

141074014

-MED24chr17

38209633

-
Frame-shiftENST00000509479ENST00000394127MAML3chr4

141074014

-MED24chr17

38209633

-
Frame-shiftENST00000509479ENST00000501516MAML3chr4

141074014

-MED24chr17

38209633

-
5CDS-5UTRENST00000509479ENST00000479829MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000327122ENST00000394126MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000327122ENST00000356271MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000327122ENST00000394128MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000327122ENST00000394127MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000327122ENST00000501516MAML3chr4

141074014

-MED24chr17

38209633

-
intron-5UTRENST00000327122ENST00000479829MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000398940ENST00000394126MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000398940ENST00000356271MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000398940ENST00000394128MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000398940ENST00000394127MAML3chr4

141074014

-MED24chr17

38209633

-
intron-3CDSENST00000398940ENST00000501516MAML3chr4

141074014

-MED24chr17

38209633

-
intron-5UTRENST00000398940ENST00000479829MAML3chr4

141074014

-MED24chr17

38209633

-

Top

FusionProtFeatures for MAML3_MED24


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAML3

Q96JK9

MED24

O75448

Acts as a transcriptional coactivator for NOTCHproteins. Has been shown to amplify NOTCH-induced transcription ofHES1. {ECO:0000269|PubMed:12370315, ECO:0000269|PubMed:12386158}. Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors. {ECO:0000269|PubMed:12218053,ECO:0000269|PubMed:16595664}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025128_132-13977MotifNote=LXXLL motif 1
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025344_348-13977MotifNote=LXXLL motif 2
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025448_452-13977MotifNote=LXXLL motif 3
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025557_561-13977MotifNote=LXXLL motif 4
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025788_792-13977MotifNote=LXXLL motif 5
TgeneMED24chr4:141074014chr17:38209888ENST00000356271-025857_861-13977MotifNote=LXXLL motif 6
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025128_132-35977MotifNote=LXXLL motif 1
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025344_348-35977MotifNote=LXXLL motif 2
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025448_452-35977MotifNote=LXXLL motif 3
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025557_561-35977MotifNote=LXXLL motif 4
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025788_792-35977MotifNote=LXXLL motif 5
TgeneMED24chr4:141074014chr17:38209888ENST00000394127-025857_861-35977MotifNote=LXXLL motif 6
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026128_132-13990MotifNote=LXXLL motif 1
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026344_348-13990MotifNote=LXXLL motif 2
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026448_452-13990MotifNote=LXXLL motif 3
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026557_561-13990MotifNote=LXXLL motif 4
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026788_792-13990MotifNote=LXXLL motif 5
TgeneMED24chr4:141074014chr17:38209888ENST00000394128-026857_861-13990MotifNote=LXXLL motif 6

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAML3chr4:141074014chr17:38209888ENST00000509479-15467_9681561139Compositional biasNote=Gln-rich
HgeneMAML3chr4:141074014chr17:38209888ENST00000509479-15548_5951561139Compositional biasNote=Asn-rich


Top

FusionGeneSequence for MAML3_MED24


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAML3_ENST00000509479_chr4_141074014_-_MED24_ENST00000394126_chr17_38209888_-_156aa
MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGGCGGSGGPGGGSAAVPKHSTVVERLRQRIEGCRRHHVN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAML3_ENST00000509479_chr4_141074014_-_MED24_ENST00000394126_chr17_38209888_-_468nt
ATGGGGGATTTCGCAGCCCCCGCTGCTGCCGCGAATGGCAGTAGTATTTGCATCAACAGTAGCCTGAACAGCAGCCTCGGCGGGGCCGGG
ATCGGTGTGAATAATACTCCCAATAGTACTCCCGCTGCTCCGAGTAGCAATCACCCGGCAGCCGGTGGATGCGGCGGCTCCGGGGGCCCC
GGCGGCGGTTCGGCGGCCGTTCCCAAGCACAGCACCGTGGTGGAGCGGCTCCGCCAGCGCATCGAGGGCTGCCGTCGGCACCACGTCAAC
TGCGAGAACAGGTACCAGCAGGCTCAGGTGGAGCAGCTGGAGCTGGAGCGCCGGGACACCGTGAGCCTCTACCAGCGGACCCTGGAGCAG
AGGGCCAAGAAATCGGGCGCCGGCACCGGCAAACAGCAGCACCCGAGCAAACCCCAGCAAGATGCGGAGGCTGCCTCGGCGGAGCAGAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAML3_ENST00000509479_chr4_141074014_-_MED24_ENST00000394126_chr17_38209888_-_5328nt
ACTCCGCTGGCATGGAGGAGGAGGAGGAGGTGGAGGAGCGAGAGGAGGAGGAGGAGGCGGCGGCGGCGGCGGCGGCGAGCAGTTGATCAT
TGTGATGGTGGCAGGAGCAGCGGCGGCAGCGGCAGCCCAGCCGAGCGTTAGGTGCTGCTCTCTGCGCGGCGTTTTGCAAAGGACTTCACC
GATCTACTTTTGCAGTCGCCTCGGACTGTCCATGTGTTTACTTCCCCCAGCCCGAGGATTCGATATCTAGGTTCCTGTGAAATGCAACTG
AGCAGCCAAAGTACTTTGAGAACACGGGGCGGCATAAACACCAAAACTTTTTTGTGGAAGGAAAATGCAATAAGCAAGCTTGCCGTTTTC
CGATGCGGTGTGGAGTGAGTGTGTGTCGCGCGTGTCCGCACTGGAGGCATATGCTTGTGTGTGTACATGGGGTGTGTTTTTCGGTATGTA
GGGAGAAAATGCTTGCCAACCACCGGAAATCTCCTGGAATTTATTAGAAAATAATGGATTATAAAAAGAAGGCAAGCAAGGAGCGGATCT
CCCCTTGAGTTGCAACCCGATTTGCTGCTGGCTCAGTTTGTTGTGATTCTTTTTGTTGATAGGTGTCTGATGGTATTCCGATAACGTTCC
CCCCTTTTCTTCCCCTTGAGCTTTTACAGTTTAAAAAAAGGAAACAAAAACCACCCCAAAATCTCCCCCCCCGTTTTTTTCGCCCCGTCG
GGATCGCCGTTTCCATCCATGTGCTTGCGTCTCCCCCGCGTTCCACTTAAACTATTTTAATCCTTGGACCCAAGGAGGAGGCTGATAGGG
GGGTGGATAAAAAAAGTTCTTCCAAAATAGTGTGCCCGGGGAGCAGGATGGGGGATTTCGCAGCCCCCGCTGCTGCCGCGAATGGCAGTA
GTATTTGCATCAACAGTAGCCTGAACAGCAGCCTCGGCGGGGCCGGGATCGGTGTGAATAATACTCCCAATAGTACTCCCGCTGCTCCGA
GTAGCAATCACCCGGCAGCCGGTGGATGCGGCGGCTCCGGGGGCCCCGGCGGCGGTTCGGCGGCCGTTCCCAAGCACAGCACCGTGGTGG
AGCGGCTCCGCCAGCGCATCGAGGGCTGCCGTCGGCACCACGTCAACTGCGAGAACAGGTACCAGCAGGCTCAGGTGGAGCAGCTGGAGC
TGGAGCGCCGGGACACCGTGAGCCTCTACCAGCGGACCCTGGAGCAGAGGGCCAAGAAATCGGGCGCCGGCACCGGCAAACAGCAGCACC
CGAGCAAACCCCAGCAAGATGCGGAGGCTGCCTCGGCGGAGCAGAGGAACCACACGCTGATCATGGGTGCGATCTCGGCTCACCCCAACA
ACCTCCGCCTCCCGGGTTCAAGCGATTCTACTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCATGCACCACCAAGCCCGGCTAATTT
TGTATTTTTAGTGGAGACGAGGTTTCTCCATGTTGGTCAGGCTAGTCTCGAACTCCTGACCTCCGGTGATTCGCCCGCCTCTGCCTCCCG
AAGTGCTGGGATTACAGGTGCGAGCCACTGCGCTCGGCCGATACTTTCTTAGTGCCCCAGTTTAAGGAAGGGCGGTTCAGGAGGAGAGAG
TCTGACAGGATCTTACTTTATCCCTTTAGCTCTTTTTCTTTCAAATTCCTCTGTCTCGCTTAAATCTTCCCGCATCTTCTCCTTTCTATT
TAATTCTGCCTTCCCCGGTTCTCCTTAGAACCTCATGTCCTTTTCTTTAGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCC
ACCTGCTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGC
AATCAACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACC
ATCCCCCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGATGGTGTCCTACTCTTCTGTCCTCACAGCCATCAGTAA
GTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGC
AGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGA
GGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAA
CCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGC
CAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGA
GCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGT
GGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCAT
TGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTC
TCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCG
CTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAA
GCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGA
GCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTC
CGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATT
CACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGC
CCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCC
TGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTC
CTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAA
TGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCT
TGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAA
CACCCTGCAGTTCTACAATGAGAGGGTGGTGATCATGAACTCGATCCTGGAGCGCATGTGTGCCGACGTGCTGCAGCAGACAGCCACGCA
GATCAAGTTTCCCTCCACCGGGGTGGACACAATGCCCTACTGGAACCTGCTGCCCCCCAAGCGGCCCATCAAAGAGGTGCTGACGGACAT
TTTTGCCAAGGTGCTGGAGAAGGGCTGGGTGGACAGCCGCTCCATCCACATCTTTGACACCCTGCTGCACATGGGCGGCGTCTACTGGTT
CTGCAACAACCTGATTAAGGAGCTGCTGAAGGAGACGCGGAAGGAGCACACGCTGCGGGCAGTGGAGCTGCTCTACTCCATCTTCTGCCT
GGACATGCAGCAAGTGACCCTGGTCCTGCTGGGCCACATCCTACCTGGCCTGCTCACTGACTCCTCCAAGTGGCACAGCCTCATGGACCC
CCCGGGCACTGCTCTTGCCAAGCTGGCCGTGTGGTGTGCCCTCAGTTCCTACTCCTCCCACAAGGGACAGGCGTCCACCCGCCAGAAGAA
GAGACACCGCGAAGACATTGAGGATTATATCAGCCTCTTCCCCCTGGACGATGTGCAGCCTTCGAAGTTGATGCGACTGCTGAGCTCTAA
TGAGGACGATGCCAACATCCTTTCGAGCCCCACAGACCGATCCATGAGCAGCTCCCTCTCAGCCTCTCAGCTCCACACGGTCAACATGCG
GGACCCTCTGAACCGAGTCCTGGCCAACCTGTTCCTGCTCATCTCCTCCATCCTGGGGTCTCGCACCGCTGGCCCCCACACCCAGTTCGT
GCAGTGGTTCATGGAGGAGTGTGTGGACTGCCTGGAGCAGGGTGGCCGTGGCAGCGTCCTGCAGTTCATGCCCTTCACCACCGGGGACTA
ACAGACGGCATCATCTGTGAATCACCAGACACCTGGAAGGGAAAGGACCTCCTTAGGATCCCTCATGAGCTGTACCAGCCCTGCCCTCTT
CCTGCTCCTGATCCAGTGTCCTCGCAGGCTCAGTGGCCCGGCTCTGCCCACGGTGTGGTCCTGAGGCCTCCTGAGAACCACAACGCGGGG
GAGCGAGAACTCTTGGAGTGCGAGCTCAAACCCAAGCCAAGGCCGGCCAACCTGCGTCATGCCATTGCCACTGTCATCATCACTGGCGTT
GTGTGTGGGATTGTGTGTCTCATGATGTTGGCAGCTGCCATCTATGGCTGCACCTATGCGGCAATCACAGCCCAGTACCATGGGGGACCC
TTGGCTCAAACCAATGATCCTGGGAAGGTGGAAGAAAAAGAGCGATTTGACAGCTCACCAGCCTGAGAGCTTTTGTCTCAAATAGGATTG
GTCATTGCAGGCCAGAAGATAGTGTCTGAGTAGGGCTGATGTGTTTCCTGTTAGTCTGATTTTGCTTTTGCCAAAAGACAAAAAAAAAAA
AAAAAAAAAAAAGAAAAAAAAAAGATGTGTCTGTAAAAAATATTTCTGGGGAGGAATTTATGTTGCGATTTTTAAAATACTATAGGTAAA


Top

FusionGenePPI for MAML3_MED24


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAML3MAML1, NOTCH1, NFX1, SUPT5H, RAI1, ZBTB1, SCMH1, ZZZ3, RBPJMED24MED10, MED9, MED29, MED19, MED28, MED26, CDK8, THRA, VDR, PPARA, PPARG, RXRA, MED1, HNF4A, ESR1, ESR2, MED30, BRD4, RPAP2, AR, PARP1, SMAD1, SMAD2, SMAD3, TRRAP, SREBF1, MED12, MED18, ZC3H13, TRIP4, OBFC1, QKI, TRA, MED14, GSK3B, TNFSF11, RPS6KA6, CTDP1, APP, MED13, MED8, MED16, MED17, MED4, MED11, MED21, MED22, PPP6R1, TFIP11, FBXW7, EPAS1, CDK19, MED7, CCNC, NR1I3, TCL1B, MED15, MED20, MED23, MED6, MED25, MED27, KPNB1, XRCC3, EMC2, PPP4R1, ZWINT, KIFAP3, MMGT1, SUCO, LMO2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAML3_MED24


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAML3_MED24


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMAML3C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneMAML3C0018798Congenital Heart Defects1CTD_human
HgeneMAML3C1261473Sarcoma1CTD_human
HgeneMAML3C1710096Sinonasal undifferentiated carcinoma1CTD_human