FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20702

FusionGeneSummary for MAML2_CRTC1

check button Fusion gene summary
Fusion gene informationFusion gene name: MAML2_CRTC1
Fusion gene ID: 20702
HgeneTgene
Gene symbol

MAML2

CRTC1

Gene ID

84441

23373

Gene namemastermind like transcriptional coactivator 2CREB regulated transcription coactivator 1
SynonymsMAM-3|MAM2|MAM3|MLL-MAML2MECT1|TORC-1|TORC1|WAMTP1
Cytomap

11q21

19p13.11

Type of geneprotein-codingprotein-coding
Descriptionmastermind-like protein 2mam-2mastermind-like 2CREB-regulated transcription coactivator 1mucoepidermoid carcinoma translocated protein 1transducer of regulated cAMP response element-binding protein (CREB) 1
Modification date2018052320180523
UniProtAcc

Q8IZL2

Q6UUV9

Ensembl transtripts involved in fusion geneENST00000524717, ENST00000321949, 
ENST00000338797, ENST00000594658, 
ENST00000601916, 
Fusion gene scores* DoF score11 X 8 X 5=4405 X 3 X 4=60
# samples 125
** MAII scorelog2(12/440*10)=-1.87446911791614
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MAML2 [Title/Abstract] AND CRTC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMAML2

GO:0007219

Notch signaling pathway

12370315

HgeneMAML2

GO:0045944

positive regulation of transcription by RNA polymerase II

12370315

TgeneCRTC1

GO:0045944

positive regulation of transcription by RNA polymerase II

14536081


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AY186998MAML2chr11

96074547

-CRTC1chr19

18853719

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000524717ENST00000321949MAML2chr11

96074547

-CRTC1chr19

18853719

+
In-frameENST00000524717ENST00000338797MAML2chr11

96074547

-CRTC1chr19

18853719

+
In-frameENST00000524717ENST00000594658MAML2chr11

96074547

-CRTC1chr19

18853719

+
In-frameENST00000524717ENST00000601916MAML2chr11

96074547

-CRTC1chr19

18853719

+

Top

FusionProtFeatures for MAML2_CRTC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAML2

Q8IZL2

CRTC1

Q6UUV9

Acts as a transcriptional coactivator for NOTCHproteins. Has been shown to amplify NOTCH-induced transcription ofHES1. Potentiates activation by NOTCH3 and NOTCH4 more efficientlythan MAML1 or MAML3. {ECO:0000269|PubMed:12370315,ECO:0000269|PubMed:12386158, ECO:0000269|PubMed:12539049}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCRTC1chr11:96074547chr19:18853719ENST00000321949+014299_36642635Compositional biasNote=Ser-rich
TgeneCRTC1chr11:96074547chr19:18853719ENST00000338797+015299_36642651Compositional biasNote=Ser-rich
TgeneCRTC1chr11:96074547chr19:18853719ENST00000321949+014242_25842635MotifNuclear export signal
TgeneCRTC1chr11:96074547chr19:18853719ENST00000338797+015242_25842651MotifNuclear export signal

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MAML2_CRTC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000321949_chr19_18853719_+_764aa
MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTLQLLSLVQHGQGARKAG
KHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLNSSNNGGSGGINGEQQPPASTPGDQRNSALIALQLQKSQYL
QLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPP
ADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQEN
TTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEAR
RQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPP
PLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANAL
SHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDS

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000338797_chr19_18853719_+_780aa
MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTLQLLSLVQHGQGARKAG
KHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLNSSNNGGSGGINGEQQPPASTPGDQRNSALIALQLQKSQYL
QLGPSRGQYYGGSLPNVNQIGSGTMDLPFQPSGFLGEALAAAPVSLTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHG
RQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKS
CEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQ
HRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPG
GPLLPSASLTRGPQPPPLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFG
DAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSK

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000594658_chr19_18853719_+_764aa
MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTLQLLSLVQHGQGARKAG
KHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLNSSNNGGSGGINGEQQPPASTPGDQRNSALIALQLQKSQYL
QLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPP
ADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQEN
TTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEAR
RQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPP
PLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANAL
SHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDS

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000601916_chr19_18853719_+_597aa
MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTLQLLSLVQHGQGARKAG
KHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLNSSNNGGSGGINGEQQPPASTPGDQRNSALIALQLQKSQYL
QLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPP
ADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQEN
TTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEAR
RQQASPTLSPLSPITQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000321949_chr19_18853719_+_2292nt
ATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCTCCTTGGAGGGGGCTCAGTCACCCCG
AGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCTGAGCTGTGAAGGACGATATGAACGA
GGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCATGGCCAGGGGGCAAGGAAAGCTGGC
AAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCCTCCTGCGGCCTCCCAAGCAGCAGCA
ACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAGCAATAATGGTGGCAGTGGTGGGATA
AACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCTCCAGCTCCAGAAATCCCAGTACCTG
CAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAGTGGCACCATGGACCTGCCCTTCCAG
ACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTC
GGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCACCC
GCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGG
TCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAG
CAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAAC
ACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCCCTCCCCGCTCCCGACCCCG
CTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGT
GGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGG
CGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTGCCC
TACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCCTCCACCCGCGTCCCAGCAGCCACCA
CCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGTGGCCCCCTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCC
CCGCTTGCAGTCACGGTACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATCGATGGGGATCGACATCGCCTCGGCG
CCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGGCTTCTCCCCAGGG
AGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGATGGCGGCCAGGCAGGCCAATGCTCTG
TCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAG
GCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATC
ATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCC
GACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCC

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000338797_chr19_18853719_+_2340nt
ATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCTCCTTGGAGGGGGCTCAGTCACCCCG
AGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCTGAGCTGTGAAGGACGATATGAACGA
GGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCATGGCCAGGGGGCAAGGAAAGCTGGC
AAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCCTCCTGCGGCCTCCCAAGCAGCAGCA
ACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAGCAATAATGGTGGCAGTGGTGGGATA
AACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCTCCAGCTCCAGAAATCCCAGTACCTG
CAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAGTGGCACCATGGACCTGCCCTTCCAG
CCCAGCGGATTTCTGGGGGAGGCCCTGGCAGCGGCTCCTGTCTCTCTGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACC
CGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGA
CGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCACCCGCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTG
CACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTC
CCAGGAATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCC
TGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCC
CTGCCCGACCTGACCAACATCCACTTCCCCTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCC
AGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAG
CACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATC
ACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTGCCCTACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCG
CAGCCCCAGCCCCCGCCGCCTCCTCCACCCGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGT
GGCCCCCTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGTCACGGTACCGTCCTCTCTCCCCCAGTCCCCC
CCAGAGAACCCTGGCCAGCCATCGATGGGGATCGACATCGCCTCGGCGCCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGCC
AACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGGCTTCTCCCCAGGGAGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGG
GACGCGTACTATGAGCAGCAGATGGCGGCCAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATC
AGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCG
GACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAA
GAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTG
ACCCTCGACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCGGATGGACCGCCTGTGA

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000594658_chr19_18853719_+_2292nt
ATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCTCCTTGGAGGGGGCTCAGTCACCCCG
AGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCTGAGCTGTGAAGGACGATATGAACGA
GGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCATGGCCAGGGGGCAAGGAAAGCTGGC
AAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCCTCCTGCGGCCTCCCAAGCAGCAGCA
ACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAGCAATAATGGTGGCAGTGGTGGGATA
AACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCTCCAGCTCCAGAAATCCCAGTACCTG
CAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAGTGGCACCATGGACCTGCCCTTCCAG
ACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTC
GGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCACCC
GCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGG
TCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAG
CAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAAC
ACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCCCTCCCCGCTCCCGACCCCG
CTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGT
GGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGG
CGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTGCCC
TACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCCTCCACCCGCGTCCCAGCAGCCACCA
CCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGTGGCCCCCTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCC
CCGCTTGCAGTCACGGTACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATCGATGGGGATCGACATCGCCTCGGCG
CCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGGCTTCTCCCCAGGG
AGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGATGGCGGCCAGGCAGGCCAATGCTCTG
TCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAG
GCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATC
ATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCC
GACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCC

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000601916_chr19_18853719_+_1791nt
ATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCTCCTTGGAGGGGGCTCAGTCACCCCG
AGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCTGAGCTGTGAAGGACGATATGAACGA
GGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCATGGCCAGGGGGCAAGGAAAGCTGGC
AAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCCTCCTGCGGCCTCCCAAGCAGCAGCA
ACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAGCAATAATGGTGGCAGTGGTGGGATA
AACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCTCCAGCTCCAGAAATCCCAGTACCTG
CAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAGTGGCACCATGGACCTGCCCTTCCAG
ACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTC
GGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCACCC
GCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGG
TCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAG
CAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAAC
ACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCCCTCCCCGCTCCCGACCCCG
CTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGT
GGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGG
CGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGC
AGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAG
CAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACC
AGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000321949_chr19_18853719_+_4147nt
CTCCCTCTCCTATCGGAGCACAATGAAAGCCTGTGTATCGCCGTGACTCCGGGCGCGAGCCAGTGTCAGCAAAGCGGCTAACAACAGACG
AGAAAGAGAAAGGAAAATACAAGCTACTTTTTTTTTCCATCTATAAAGCGGAGCAAATACAGGAGATAGAACCAGATTGCTTATTGCGAG
TCCAGACCCTCAGATCCACTGGCCGGGGATGGAATGTACAAAAGTGGACAGAAAAGTGGCTGGACATGACTCGGTGCAATTTGCTGGAAG
TTTGTAAGTTTGACCATCGTTTGTAAATTACTCTCGGAAGAGTTTGTCTCTCTTGATACTGTATTAGAATAGAGCCGGGGGTGAGGAATA
GAAACGTAAGCGGGAAAGAAAAAAATGTGTTGAAGGATCTCTCTCAGTGGCTAGCGACTTAAGATTGCTTTTCATTTAAGGCTAGGAAAC
CTTAGAGGGAGTGAGGATTTTACCGGTGATTGGATTAGCTGAAGAAAAAAGCATGGTCCAAAAGTCCAATTACTGACATTGTTAACAGTT
GAAAAGCTGTCTCCCTCTTTTGGGAGAAGACAACATCCTACAGTACCCCAAAGAGGAGAAAACACCGGAGCGAAAGGAAAGGGAGGAAAA
ATTAAAAGCCAAAAGACAGTCTCCCTTGATTTTTGCACATTTTGAACAGTGACTTAAACATCTTCTGAAACAGCACTGTTTTGTTTTGTT
TTGGTTTTTTATTTAACCTGAGGAAAAGTCAAGGCTGCTGGTTACATAGACATGGTAGAAATGTGTTTCTCTGCAGAAACATCCCCATAA
AGAATTGTCGGAAACAACTAGGTGAGGGGGAGTCCTCTCTATTAATACCTCTCTCAATACCTTTTGCTGTGTGTTTCTGTCTCTTGCTGG
ACAATCCCTGAATTCTTGATCTAACCCCCAGATCGTGTGTTTACAAAGTACCTAGTGGCTCTTGTCAGCTTGGTGGAGGAAAAAAAATCC
ACCAACTCTGTCCAACTTCTCCAGAGCTGTCAAATGCAATTAGAGTAAGTTAATCAGGGTTTGTTTCCAACTTATCCTCCCCCCAGTTGG
TTTCTATTCTTTCTCCCCACCCTCTTTTTACTAACTCCCCTCCCCCACAACTTCTCCACGGCTCCCCCACAACCTCTGAAGACCTCTATT
CATGTGGCCCTGAACACTGAGCTCACATTGTCAAAAACAGACTTGCCTGCAATAGCCAGCAGTAGCCTCTTTCCACCTCACCATCCCAGA
GGCAGCAATCATTGTGTCCGGTAAGATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCT
CCTTGGAGGGGGCTCAGTCACCCCGAGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCT
GAGCTGTGAAGGACGATATGAACGAGGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCA
TGGCCAGGGGGCAAGGAAAGCTGGCAAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCC
TCCTGCGGCCTCCCAAGCAGCAGCAACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAG
CAATAATGGTGGCAGTGGTGGGATAAACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCT
CCAGCTCCAGAAATCCCAGTACCTGCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAG
TGGCACCATGGACCTGCCCTTCCAGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAG
GGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTA
TGGCACCATGTACCTCTCACCACCCGCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCAC
GCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATC
AGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACAT
CTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCA
CTTCCCCTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGC
CAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCC
CCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGC
CCTGTCTCTGGAGCAGCAGCTGCCCTACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCC
TCCACCCGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGTGGCCCCCTGTTGCCCAGCGCCAG
CCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGTCACGGTACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATC
GATGGGGATCGACATCGCCTCGGCGCCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGT
CTCCAATCAAGGCTTCTCCCCAGGGAGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGAT
GGCGGCCAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCC
GGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGC
CAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGG
GGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCT
CAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCGGATGGACCGCCTGTGAGCGGGCACGCCGGCACCCTGCCG
CTCAGCCGTCCCGACGGCGCCTCCCCAGCCCGGGGACGGCCGTGCTCCGTCCCTCGCCAACGGCCGAGCTTGTGATTCTGAGCTTGCAAT
GCCGCCAAGCGCCCCCCGCCAGCCCGCCCCCGGTTGTCCACCTCCCGCGAAGCCCAATCGCGAGGCCGCGAGCCGGGCCGTCCACCCACC
CGCCCGCCCAGGGCTGGGCTGGGATCGGAGGCCGTGAGCCTCCCGCCCCTGCAGACCCTCCCTGCACTGGCTCCCTCGCCCCCAGCCCCG
GGGCCTGAGCCGTCCCCTGTAAGATGCGGGAAGTGTCAGCTCCCGGCGTGGCGGGCAGGCTCAGGGGAGGGGCGCGCATGGTCCGCCAGG
GCTGTGGGCCGTGGCGCATTTTCCGACTGTTTGTCCAGCTCTCACTGCCTTCCTTGGTTCCCGGTCCCCCAGCCCATCCGCCATCCCCAG
CCCGTGGTCAGGTAGAGAGTGAGCCCCACGCCGCCCCAGGGAGGAGGCGCCAGAGCGCGGGGCAGACGCAAAGTGAAATAAACACTATTT

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000338797_chr19_18853719_+_8437nt
CTCCCTCTCCTATCGGAGCACAATGAAAGCCTGTGTATCGCCGTGACTCCGGGCGCGAGCCAGTGTCAGCAAAGCGGCTAACAACAGACG
AGAAAGAGAAAGGAAAATACAAGCTACTTTTTTTTTCCATCTATAAAGCGGAGCAAATACAGGAGATAGAACCAGATTGCTTATTGCGAG
TCCAGACCCTCAGATCCACTGGCCGGGGATGGAATGTACAAAAGTGGACAGAAAAGTGGCTGGACATGACTCGGTGCAATTTGCTGGAAG
TTTGTAAGTTTGACCATCGTTTGTAAATTACTCTCGGAAGAGTTTGTCTCTCTTGATACTGTATTAGAATAGAGCCGGGGGTGAGGAATA
GAAACGTAAGCGGGAAAGAAAAAAATGTGTTGAAGGATCTCTCTCAGTGGCTAGCGACTTAAGATTGCTTTTCATTTAAGGCTAGGAAAC
CTTAGAGGGAGTGAGGATTTTACCGGTGATTGGATTAGCTGAAGAAAAAAGCATGGTCCAAAAGTCCAATTACTGACATTGTTAACAGTT
GAAAAGCTGTCTCCCTCTTTTGGGAGAAGACAACATCCTACAGTACCCCAAAGAGGAGAAAACACCGGAGCGAAAGGAAAGGGAGGAAAA
ATTAAAAGCCAAAAGACAGTCTCCCTTGATTTTTGCACATTTTGAACAGTGACTTAAACATCTTCTGAAACAGCACTGTTTTGTTTTGTT
TTGGTTTTTTATTTAACCTGAGGAAAAGTCAAGGCTGCTGGTTACATAGACATGGTAGAAATGTGTTTCTCTGCAGAAACATCCCCATAA
AGAATTGTCGGAAACAACTAGGTGAGGGGGAGTCCTCTCTATTAATACCTCTCTCAATACCTTTTGCTGTGTGTTTCTGTCTCTTGCTGG
ACAATCCCTGAATTCTTGATCTAACCCCCAGATCGTGTGTTTACAAAGTACCTAGTGGCTCTTGTCAGCTTGGTGGAGGAAAAAAAATCC
ACCAACTCTGTCCAACTTCTCCAGAGCTGTCAAATGCAATTAGAGTAAGTTAATCAGGGTTTGTTTCCAACTTATCCTCCCCCCAGTTGG
TTTCTATTCTTTCTCCCCACCCTCTTTTTACTAACTCCCCTCCCCCACAACTTCTCCACGGCTCCCCCACAACCTCTGAAGACCTCTATT
CATGTGGCCCTGAACACTGAGCTCACATTGTCAAAAACAGACTTGCCTGCAATAGCCAGCAGTAGCCTCTTTCCACCTCACCATCCCAGA
GGCAGCAATCATTGTGTCCGGTAAGATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCT
CCTTGGAGGGGGCTCAGTCACCCCGAGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCT
GAGCTGTGAAGGACGATATGAACGAGGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCA
TGGCCAGGGGGCAAGGAAAGCTGGCAAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCC
TCCTGCGGCCTCCCAAGCAGCAGCAACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAG
CAATAATGGTGGCAGTGGTGGGATAAACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCT
CCAGCTCCAGAAATCCCAGTACCTGCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAG
TGGCACCATGGACCTGCCCTTCCAGCCCAGCGGATTTCTGGGGGAGGCCCTGGCAGCGGCTCCTGTCTCTCTGACCCCCTTCCAATCCTC
GGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAGGGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCG
GCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTATGGCACCATGTACCTCTCACCACCCGCGGACACCAGCTGGAG
AAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCACGCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCA
GAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATCAGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAA
GAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACATCTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCTGATCCC
CGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCACTTCCCCTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCC
CACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGCCAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAAT
GAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCCCCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCC
CACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGCCCTGTCTCTGGAGCAGCAGCTGCCCTACGCCTTCTTCACCCA
GGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCCTCCACCCGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACA
GGCGCCCGTCCGCCTGCCCCCTGGTGGCCCCCTGTTGCCCAGCGCCAGCCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGTCACGGT
ACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATCGATGGGGATCGACATCGCCTCGGCGCCGGCTCTGCAGCAGTA
CCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGTCTCCAATCAAGGCTTCTCCCCAGGGAGCTCCCCGCAACACAC
TTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGATGGCGGCCAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCA
GTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCT
CACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGG
AGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCT
GGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGA
CACCTTCCGGATGGACCGCCTGTGAGCGGGCACGCCGGCACCCTGCCGCTCAGCCGTCCCGACGGCGCCTCCCCAGCCCGGGGACGGCCG
TGCTCCGTCCCTCGCCAACGGCCGAGCTTGTGATTCTGAGCTTGCAATGCCGCCAAGCGCCCCCCGCCAGCCCGCCCCCGGTTGTCCACC
TCCCGCGAAGCCCAATCGCGAGGCCGCGAGCCGGGCCGTCCACCCACCCGCCCGCCCAGGGCTGGGCTGGGATCGGAGGCCGTGAGCCTC
CCGCCCCTGCAGACCCTCCCTGCACTGGCTCCCTCGCCCCCAGCCCCGGGGCCTGAGCCGTCCCCTGTAAGATGCGGGAAGTGTCAGCTC
CCGGCGTGGCGGGCAGGCTCAGGGGAGGGGCGCGCATGGTCCGCCAGGGCTGTGGGCCGTGGCGCATTTTCCGACTGTTTGTCCAGCTCT
CACTGCCTTCCTTGGTTCCCGGTCCCCCAGCCCATCCGCCATCCCCAGCCCGTGGTCAGGTAGAGAGTGAGCCCCACGCCGCCCCAGGGA
GGAGGCGCCAGAGCGCGGGGCAGACGCAAAGTGAAATAAACACTATTTTGACGGCTGTCTTTTATATTTCTGAGCACACACAGAGCCCTG
GCGTCCACCGGGGCAGGCGCAAAGTGGACAGAGCATGCAGGGCGGCGGACCCCCCCACGACCCTCCTCGCCCTGTCTCCATCCCCTCGAA
GCCCTGCCTCACCGCAGGCAGGCCCATCGGTGGCCACCTTTGCCGGGAAGTGACCGGAAGGCCCCGTGAGGGGTCGAACGCGGAGGCAGG
GGTTACCTCTTGGGGCTTTACAATCCGTGGCCCCTCCTGTCCTGCACTGTGGTCACCGGTCCTGTCATAGATGCTGTTAATTTAAGGTAC
AGGCAGAGGTGGCCAGGGGAGTTTCATTGTGGTTTTTTTTTCCTTTTAGTTTCTAGTTACATTTTGGTTGTAGATGACTCGCTTAATCTT
TTAAGCCAACACTTGCCTGAGAGCATGTTTTTATTTCAGAAATCCAACTTTACCTATTTTTTAAGCTAACTGGAAATGGAGGCCATGCGC
CCCAAAGCAGCCCGCCACCCACCTGAGTGTAAGAAGTGAGTCCGGCTTTTGGGTTTCACCCCAAGTTATCTCAAAACAAAAGGGCTGGTC
AGGCTGGGCAGGGCCTTGTCAGGAGCTCACGGTAGGCAGAGGTGCCTCTGCCAGGGCCACAGAACAGACTTCCGGGAAGGGGCCTTGGCT
TTTATTGAGGGTCTCTCAAAGACCCAGCCTGCCAGCCTCTCCCAGAGGTGCCTGCTAGTCCTTAGAGTGTGTGTGTGAAGATGCCATGAC
CAGTGGCAGCTGAGACCTCTCTGCCCCAAGAGTGTGGGGGACTGGCAGGGAGCGAGGGTCCCCGAGACGAGGACCACGGTCCTCCCTGAG
AACCTGGGTGGAACTGGCATTTCATCCCCTCTCCACCCTACCCTCTGGCTCCTAGCCCACACCCCCTCTCTTGGGCAGCGTGGTCTGCTG
GCTGCCCCTTCTTGGCAGCTCAGGGTCGTGGCAGGTGGACTTGGAGACACACAGCAGTGTGTGTTTTAGTGGCAGGTTTCAGGAGCACCT
CTAAGACCAGGGTGACAGGGTACTTGGGAGCTGTCCTGGACCCTCCCCATACCACGGGCCCTGCAAGGGAGGCATCAGGGCTGGCTTTGT
TTTCTGCTGTTCTTGGAATAGGAACTGCTGTTCTGATCCCCCCAAAACTGCATTGCGGCTCTCGCTCGCTCCTGCCTGCCGGGACAGCGC
CTTCTGCTGAGTCCGTTTATTTGTAGTGTCATGGCTGCTGCTTTCACTGGGGTCCTGGGCACCCTGGCTTCTGTCCTCAGAGCTGGGTTT
GATCCTAGCAACCATCCCTTCCTCTCTTTGCCCGGCAATGCCTTTGGCATGTGTCTGAGCAGCCAAGTGGCCACTCATAGGAGAAGGCTC
CCTGGTCACGTTGCTCCTGCTGCCGTCTTGTTCCAAGGTGCGGGGGGGACACTGTTGGTCTGTCCAGGTCAAGGTCCCTTTCTCTTACCA
TGACAGAGGCTGGGGGCAGACAGCGGGGACTTTTTTTTTTTTTTAAGAAAAACTACATGTACATAGGAGAGTTTCATTACCATTAGACTT
GTATGTAGGACTTAAAAAAAAATGGCCTTAATAAAATTACAAGCAACCCGCCTGGATGCGGTTTTCAAAAGAAGGCATTGAGGACCATGC
TAGGAAACCTCATACCCCATCCGTCCAACCTCCGGCGGGCGCCACTGCTTGTCCTCTGGTCTTCGGTGTGGACAGATAGGAGAGGAGGGA
TGCCCACCTCGGAGCATCCCAGGCCCGTGGCCCATTTTCAGCATCCTGAAGCCAGATTCACAGTGACATTGTGTTAACGTGACGACCTTG
GTCCATTATGGAGTTCTTTTTCCAATAAGAACCTGGTGGACCGAGGTCCGAGCTTGCCAGGGACAGTGGGGCCCACGCGAGTACCCGGGG
CCCAGCCAGGAGCCAGCAGCCAGGCGTCCCTGTGTTCCAGAAGGATTCACGCCCCTCCTGGACCTGGGCGGGCCTCCCAGGGGGTCTGTA
TCACGGCCTTTTGTGTGTGCGTACGTGTGGTTTTTTTAAATATCACTACTACATATTCTTGAATTGCCAAGACTTTCTGAAACAAGACAG
CTTAAGGGAATCAGCCTTTTGCTTTGTGATGTGAAAATACTGTGATTTGACGAGCCGCTTCCTGAGGGGCAGGCCCACGTGGGGAGGTTG
CGCCGTGTACATAGACCCGCCGTCTGTGTCCTTGGTCAGGCCCGGATGCTTGGTCTACACTGGGTTAGAGGCTGCTCTCCCCACGCACCC
ATGTGCTCATGGCTTCTGCAGACCCTCTGCTGGGTACATCGGTCCCCTACGGCGAAGTTCAGCCAGGGCTCTCCCTCCTGAGAGCATGGC
GTCCCCACCTTCCTGTTTCGCCGACGTCACTACCCAGGGTGGCAAGTCTTGCAGGCAGAGGGTGTAGCCCAAGTTCAGCCTCTCTCTGTG
TCCTCCAGAGAAGAGGGTTCTTTGCCCTCATCAGGGCCCTGCTTGTGGGTTTTCGGCTCTGGGGAGGAGAGTGTTGGCATCAGTGTGTTT
GGCCTGATTTCTTCAGGGGGCCAAGCTCCCGGGAGGACCCCTAGCCAGGAGGGCCCCCCATGTCCATCCATCCCTCCTGCTGGGGCTTGG
ATGTCAGGCTTGGGGGCTGTGAGCTGGGACCTCGCCTGAGCCCGGTCAGGTGGGACAGGAGCCTGCCAGAAGCCCATGGGGGGCCAGGCC
GGGTGGCTTCTATTTTATTTTTTTAGAGATGGGGTCTTGCTGTGTTGCCCAGGCTGGTCTCGGACTCCTGGGCTCAAGCAGTCCTCCCTC
CTCGGCCTCCCAAAGTTCTGGGGCTACAGGTGTGAGCCACTTCTGCCCAGCATCCCAGGCCTGAACAGCCTTGGCAGGACCCGTCCCTAG
AGGGGGCTCTGGTGCCTCCCTTAGGTGGGCCTTGAGCTGGTTTTTAACCAAACATCCTTCCAAACTCGGGCTGCGACCTGCTTCCTGAGT
TTTCTGTATTTCCAAGGAGCCCTCCGACCAGGGAGAGGCTGGTGGAGTAAGGTCCAGCGGTATTCGGGGGTCCTCTGTCACCTCGCCCTG
AAAACAGCAGCTCCCATCACCTTCACTGGGTCCCGATGGAGCCGTCTCAGAGGCCGAGGGGCCCTCTGTGTGGGGGTGGGACGCAGGGGC
TCTCAGAGCAAGGGCCACAAAGCCGATGGCACAGATGTGCCCCTGGGCCTGGCCCGTCACCCACATGTGGTGCCCTGGGCCAGGGCGTGC
GGGCGCCAGAGCCTTCCCTACACAGCCTAAGAGCAGGGGCAAGACTCGGCCCCTCACTCACCCTGGGAGGCCTGCCTGGGCTACATGGAC
ACCTGGGTCTCTTTCTACCCCCATTCACCATGGACCAGGGGCCTCCATTTCCTGGGGGCTCTTGCGGCATGTGATTTGGGGGTCCCTGGG
ACATTCTCCCGTCAGCTCCACCTGAGCCAAGTGTCCTGTTCCCTGCGGCCCTTGGCCTTCCAGGGTCCTGGCCAGGCAGGGGTCAGGCAC
CCCATACTCTTCCGTGTGGCACAGGTGTCCACCCACCCCCACTGGCCACAGACACCATTCTCCCCCTGGGAGCAGGAGGTGGAGTAAGTT
GTACCCCCAGGCCTGGGTGCTGGGGAGTTCCTGAGGGCATGGGTGGGGCAGGAGTGAGTGCCTCGTGATCCCAGCCTCAGTTTCTCTCTT
GTCACTTTCTCAAACCTGCAGGTCTCAGGGCCCCGGGCTCCTCCTGGGCAGGATGGGGGGCAGGGGCTGGGCCTTGGGGTGGTGCTGGCT
CTGATGATTCCAGAGCCTGTATCCACCTTCTGGGCTCCTGGCCAGCACCCCACCCCCAGGAGCCAGGGACAGGTGGCATGTGTTGGGGTC
GGGGGATGGCCCCCATCTCGAAGTGTTCTGGAATTTGGGGGCAACCCTTGCCCAGCCCAGCCATCAAGAACTTCTGATCTCCTGCCCACC
AGGAGGGGACTTAGCCATGGACTTGGCCAGTAGGCCTGGGGAGGGAGGGCTTTGGCAGCCAAAGTCCACTGGCCCTGCCGTGCCCCTGAG
TAGGAAACTGTCCCCTAGGGGCTGGGTGGCCCCACTGATATATGCAAACCCGCCGGTCCGAGCCCTGTTCCTGCCTGTGCTCCTCTGTGC

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000594658_chr19_18853719_+_4147nt
CTCCCTCTCCTATCGGAGCACAATGAAAGCCTGTGTATCGCCGTGACTCCGGGCGCGAGCCAGTGTCAGCAAAGCGGCTAACAACAGACG
AGAAAGAGAAAGGAAAATACAAGCTACTTTTTTTTTCCATCTATAAAGCGGAGCAAATACAGGAGATAGAACCAGATTGCTTATTGCGAG
TCCAGACCCTCAGATCCACTGGCCGGGGATGGAATGTACAAAAGTGGACAGAAAAGTGGCTGGACATGACTCGGTGCAATTTGCTGGAAG
TTTGTAAGTTTGACCATCGTTTGTAAATTACTCTCGGAAGAGTTTGTCTCTCTTGATACTGTATTAGAATAGAGCCGGGGGTGAGGAATA
GAAACGTAAGCGGGAAAGAAAAAAATGTGTTGAAGGATCTCTCTCAGTGGCTAGCGACTTAAGATTGCTTTTCATTTAAGGCTAGGAAAC
CTTAGAGGGAGTGAGGATTTTACCGGTGATTGGATTAGCTGAAGAAAAAAGCATGGTCCAAAAGTCCAATTACTGACATTGTTAACAGTT
GAAAAGCTGTCTCCCTCTTTTGGGAGAAGACAACATCCTACAGTACCCCAAAGAGGAGAAAACACCGGAGCGAAAGGAAAGGGAGGAAAA
ATTAAAAGCCAAAAGACAGTCTCCCTTGATTTTTGCACATTTTGAACAGTGACTTAAACATCTTCTGAAACAGCACTGTTTTGTTTTGTT
TTGGTTTTTTATTTAACCTGAGGAAAAGTCAAGGCTGCTGGTTACATAGACATGGTAGAAATGTGTTTCTCTGCAGAAACATCCCCATAA
AGAATTGTCGGAAACAACTAGGTGAGGGGGAGTCCTCTCTATTAATACCTCTCTCAATACCTTTTGCTGTGTGTTTCTGTCTCTTGCTGG
ACAATCCCTGAATTCTTGATCTAACCCCCAGATCGTGTGTTTACAAAGTACCTAGTGGCTCTTGTCAGCTTGGTGGAGGAAAAAAAATCC
ACCAACTCTGTCCAACTTCTCCAGAGCTGTCAAATGCAATTAGAGTAAGTTAATCAGGGTTTGTTTCCAACTTATCCTCCCCCCAGTTGG
TTTCTATTCTTTCTCCCCACCCTCTTTTTACTAACTCCCCTCCCCCACAACTTCTCCACGGCTCCCCCACAACCTCTGAAGACCTCTATT
CATGTGGCCCTGAACACTGAGCTCACATTGTCAAAAACAGACTTGCCTGCAATAGCCAGCAGTAGCCTCTTTCCACCTCACCATCCCAGA
GGCAGCAATCATTGTGTCCGGTAAGATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCT
CCTTGGAGGGGGCTCAGTCACCCCGAGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCT
GAGCTGTGAAGGACGATATGAACGAGGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCA
TGGCCAGGGGGCAAGGAAAGCTGGCAAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCC
TCCTGCGGCCTCCCAAGCAGCAGCAACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAG
CAATAATGGTGGCAGTGGTGGGATAAACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCT
CCAGCTCCAGAAATCCCAGTACCTGCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAG
TGGCACCATGGACCTGCCCTTCCAGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAG
GGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTA
TGGCACCATGTACCTCTCACCACCCGCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCAC
GCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATC
AGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACAT
CTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCA
CTTCCCCTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGC
CAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCC
CCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGGCTGTAGCCATGGACGC
CCTGTCTCTGGAGCAGCAGCTGCCCTACGCCTTCTTCACCCAGGCGGGCTCCCAGCAGCCACCGCCGCAGCCCCAGCCCCCGCCGCCTCC
TCCACCCGCGTCCCAGCAGCCACCACCCCCGCCACCCCCACAGGCGCCCGTCCGCCTGCCCCCTGGTGGCCCCCTGTTGCCCAGCGCCAG
CCTGACTCGTGGGCCACAGCCGCCCCCGCTTGCAGTCACGGTACCGTCCTCTCTCCCCCAGTCCCCCCCAGAGAACCCTGGCCAGCCATC
GATGGGGATCGACATCGCCTCGGCGCCGGCTCTGCAGCAGTACCGCACTAGCGCCGGCTCCCCGGCCAACCAGTCTCCCACCTCGCCAGT
CTCCAATCAAGGCTTCTCCCCAGGGAGCTCCCCGCAACACACTTCCACCCTGGGCAGCGTGTTTGGGGACGCGTACTATGAGCAGCAGAT
GGCGGCCAGGCAGGCCAATGCTCTGTCCCACCAGCTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCC
GGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCTCACGGGCAGCCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGC
CAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCCCCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGG
GGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACTCAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCT
CAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCGGATGGACCGCCTGTGAGCGGGCACGCCGGCACCCTGCCG
CTCAGCCGTCCCGACGGCGCCTCCCCAGCCCGGGGACGGCCGTGCTCCGTCCCTCGCCAACGGCCGAGCTTGTGATTCTGAGCTTGCAAT
GCCGCCAAGCGCCCCCCGCCAGCCCGCCCCCGGTTGTCCACCTCCCGCGAAGCCCAATCGCGAGGCCGCGAGCCGGGCCGTCCACCCACC
CGCCCGCCCAGGGCTGGGCTGGGATCGGAGGCCGTGAGCCTCCCGCCCCTGCAGACCCTCCCTGCACTGGCTCCCTCGCCCCCAGCCCCG
GGGCCTGAGCCGTCCCCTGTAAGATGCGGGAAGTGTCAGCTCCCGGCGTGGCGGGCAGGCTCAGGGGAGGGGCGCGCATGGTCCGCCAGG
GCTGTGGGCCGTGGCGCATTTTCCGACTGTTTGTCCAGCTCTCACTGCCTTCCTTGGTTCCCGGTCCCCCAGCCCATCCGCCATCCCCAG
CCCGTGGTCAGGTAGAGAGTGAGCCCCACGCCGCCCCAGGGAGGAGGCGCCAGAGCGCGGGGCAGACGCAAAGTGAAATAAACACTATTT

>In-frame_MAML2_ENST00000524717_chr11_96074547_-_CRTC1_ENST00000601916_chr19_18853719_+_3632nt
CTCCCTCTCCTATCGGAGCACAATGAAAGCCTGTGTATCGCCGTGACTCCGGGCGCGAGCCAGTGTCAGCAAAGCGGCTAACAACAGACG
AGAAAGAGAAAGGAAAATACAAGCTACTTTTTTTTTCCATCTATAAAGCGGAGCAAATACAGGAGATAGAACCAGATTGCTTATTGCGAG
TCCAGACCCTCAGATCCACTGGCCGGGGATGGAATGTACAAAAGTGGACAGAAAAGTGGCTGGACATGACTCGGTGCAATTTGCTGGAAG
TTTGTAAGTTTGACCATCGTTTGTAAATTACTCTCGGAAGAGTTTGTCTCTCTTGATACTGTATTAGAATAGAGCCGGGGGTGAGGAATA
GAAACGTAAGCGGGAAAGAAAAAAATGTGTTGAAGGATCTCTCTCAGTGGCTAGCGACTTAAGATTGCTTTTCATTTAAGGCTAGGAAAC
CTTAGAGGGAGTGAGGATTTTACCGGTGATTGGATTAGCTGAAGAAAAAAGCATGGTCCAAAAGTCCAATTACTGACATTGTTAACAGTT
GAAAAGCTGTCTCCCTCTTTTGGGAGAAGACAACATCCTACAGTACCCCAAAGAGGAGAAAACACCGGAGCGAAAGGAAAGGGAGGAAAA
ATTAAAAGCCAAAAGACAGTCTCCCTTGATTTTTGCACATTTTGAACAGTGACTTAAACATCTTCTGAAACAGCACTGTTTTGTTTTGTT
TTGGTTTTTTATTTAACCTGAGGAAAAGTCAAGGCTGCTGGTTACATAGACATGGTAGAAATGTGTTTCTCTGCAGAAACATCCCCATAA
AGAATTGTCGGAAACAACTAGGTGAGGGGGAGTCCTCTCTATTAATACCTCTCTCAATACCTTTTGCTGTGTGTTTCTGTCTCTTGCTGG
ACAATCCCTGAATTCTTGATCTAACCCCCAGATCGTGTGTTTACAAAGTACCTAGTGGCTCTTGTCAGCTTGGTGGAGGAAAAAAAATCC
ACCAACTCTGTCCAACTTCTCCAGAGCTGTCAAATGCAATTAGAGTAAGTTAATCAGGGTTTGTTTCCAACTTATCCTCCCCCCAGTTGG
TTTCTATTCTTTCTCCCCACCCTCTTTTTACTAACTCCCCTCCCCCACAACTTCTCCACGGCTCCCCCACAACCTCTGAAGACCTCTATT
CATGTGGCCCTGAACACTGAGCTCACATTGTCAAAAACAGACTTGCCTGCAATAGCCAGCAGTAGCCTCTTTCCACCTCACCATCCCAGA
GGCAGCAATCATTGTGTCCGGTAAGATGGGGGACACAGCGCCCCCGCAGGCCCCCGCAGGAGGGCTAGGGGGGGCCTCTGGGGCGGGGCT
CCTTGGAGGGGGCTCAGTCACCCCGAGAGTGCACAGTGCTATCGTGGAGCGCCTCCGGGCTCGGATCGCTGTCTGCCGCCAACACCACCT
GAGCTGTGAAGGACGATATGAACGAGGTAGGGCCGAGAGCTCAGACCGGGAAAGAGAAAGCACCTTGCAGCTCCTGAGCCTTGTACAGCA
TGGCCAGGGGGCAAGGAAAGCTGGCAAACACACCAAGGCCACCGCCACTGCTGCCACCACTACAGCCCCTCCACCGCCCCCTGCTGCCCC
TCCTGCGGCCTCCCAAGCAGCAGCAACAGCAGCCCCACCGCCCCCACCAGACTATCACCATCACCACCAGCAGCACCTGCTGAACAGTAG
CAATAATGGTGGCAGTGGTGGGATAAACGGAGAGCAGCAGCCGCCCGCTTCAACCCCAGGGGACCAGAGGAACTCAGCCCTGATTGCGCT
CCAGCTCCAGAAATCCCAGTACCTGCAACTGGGCCCCAGCCGAGGCCAGTACTATGGCGGGTCCCTGCCCAACGTGAACCAGATCGGGAG
TGGCACCATGGACCTGCCCTTCCAGACCCCCTTCCAATCCTCGGGCCTGGACACCAGCCGGACCACCCGGCACCATGGGCTGGTGGACAG
GGTGTACCGGGAGCGTGGCCGGCTCGGCTCCCCACACCGCCGGCCCCTGTCAGTGGACAAACACGGACGGCAGGCCGACAGCTGCCCCTA
TGGCACCATGTACCTCTCACCACCCGCGGACACCAGCTGGAGAAGGACCAATTCTGACTCCGCCCTGCACCAGAGCACAATGACGCCCAC
GCAGCCAGAATCCTTTAGCAGTGGGTCCCAGGACGTGCACCAGAAAAGAGTCTTACTGTTAACAGTCCCAGGAATGGAAGAGACCACATC
AGAGGCAGACAAAAACCTTTCCAAGCAAGCATGGGACACCAAGAAGACGGGGTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAACAT
CTTCCCGTCTGCCGACCAGGAAAACACTACAGCCCTGATCCCCGCCACCCACAACACAGGGGGGTCCCTGCCCGACCTGACCAACATCCA
CTTCCCCTCCCCGCTCCCGACCCCGCTGGACCCCGAGGAGCCCACCTTCCCTGCACTGAGCAGCTCCAGCAGCACCGGCAACCTCGCGGC
CAACCTGACGCACCTGGGCATCGGTGGCGCCGGCCAGGGAATGAGCACACCTGGCTCCTCTCCACAGCACCGCCCAGCTGGCGTCAGCCC
CCTGTCCCTGAGCACAGAGGCAAGGCGTCAGCAGGCATCGCCCACCCTGTCCCCGCTGTCACCCATCACTCAGCTGGAGCAGTTCAACAT
GATGGAGAACGCCATCAGCTCCAGCAGCCTGTACAGCCCGGGCTCCACACTCAACTACTCGCAGGCGGCCATGATGGGCCTCACGGGCAG
CCACGGGAGCCTGCCGGACTCGCAGCAACTGGGATACGCCAGCCACAGTGGCATCCCCAACATCATCCTCACAGTGACAGGAGAGTCCCC
CCCCAGCCTCTCTAAAGAACTGACCAGCTCTCTGGCCGGGGTCGGCGACGTCAGCTTCGACTCCGACAGCCAGTTTCCCCTGGACGAACT
CAAGATCGACCCCCTGACCCTCGACGGACTGCACATGCTCAACGACCCCGACATGGTTCTGGCCGACCCAGCCACCGAGGACACCTTCCG
GATGGACCGCCTGTGAGCGGGCACGCCGGCACCCTGCCGCTCAGCCGTCCCGACGGCGCCTCCCCAGCCCGGGGACGGCCGTGCTCCGTC
CCTCGCCAACGGCCGAGCTTGTGATTCTGAGCTTGCAATGCCGCCAAGCGCCCCCCGCCAGCCCGCCCCCGGTTGTCCACCTCCCGCGAA
GCCCAATCGCGAGGCCGCGAGCCGGGCCGTCCACCCACCCGCCCGCCCAGGGCTGGGCTGGGATCGGAGGCCGTGAGCCTCCCGCCCCTG
CAGACCCTCCCTGCACTGGCTCCCTCGCCCCCAGCCCCGGGGCCTGAGCCGTCCCCTGTAAGATGCGGGAAGTGTCAGCTCCCGGCGTGG
CGGGCAGGCTCAGGGGAGGGGCGCGCATGGTCCGCCAGGGCTGTGGGCCGTGGCGCATTTTCCGACTGTTTGTCCAGCTCTCACTGCCTT
CCTTGGTTCCCGGTCCCCCAGCCCATCCGCCATCCCCAGCCCGTGGTCAGGTAGAGAGTGAGCCCCACGCCGCCCCAGGGAGGAGGCGCC


Top

FusionGenePPI for MAML2_CRTC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAML2MAML1, NOTCH1, DIABLO, CREBBP, EP300, RBPJCRTC1CREB1, MAP3K1, MEIS1, YWHAE, CREBBP, EP300, SRPK2, XPO1, KCTD3, KIF13B, CBY1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAML2_CRTC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAML2_CRTC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMAML2C3495559Juvenile arthritis1CTD_human
TgeneCRTC1C0279628Adenocarcinoma Of Esophagus1CTD_human
TgeneCRTC1C0525045Mood Disorders1PSYGENET