FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20576

FusionGeneSummary for MAGI1_MITF

check button Fusion gene summary
Fusion gene informationFusion gene name: MAGI1_MITF
Fusion gene ID: 20576
HgeneTgene
Gene symbol

MAGI1

MITF

Gene ID

154043

4286

Gene nameCNKSR family member 3melanogenesis associated transcription factor
SynonymsCNK3|CNK3/IPCEF1|MAGI1CMM8|COMMAD|MI|WS2|WS2A|bHLHe32
Cytomap

6q25.2

3p13

Type of geneprotein-codingprotein-coding
Descriptionconnector enhancer of kinase suppressor of ras 3CNK homolog protein 3connector enhancer of KSR 3maguin-like proteinmembrane associated guanylate kinase, WW and PDZ domain containing 1membrane-associated guanylate kinase-interacting protein-like 1microphthalmia-associated transcription factorclass E basic helix-loop-helix protein 32microphtalmia-associated transcription factor
Modification date2018052220180527
UniProtAcc

Q96QZ7

O75030

Ensembl transtripts involved in fusion geneENST00000330909, ENST00000402939, 
ENST00000483466, ENST00000497477, 
ENST00000470990, 
ENST00000352241, 
ENST00000448226, ENST00000472437, 
ENST00000328528, ENST00000314589, 
ENST00000394355, ENST00000314557, 
ENST00000394351, ENST00000531774, 
ENST00000394348, 
Fusion gene scores* DoF score10 X 6 X 6=3602 X 1 X 2=4
# samples 102
** MAII scorelog2(10/360*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: MAGI1 [Title/Abstract] AND MITF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMITF

GO:0010628

positive regulation of gene expression

22234890

TgeneMITF

GO:0045893

positive regulation of transcription, DNA-templated

9647758

TgeneMITF

GO:0045944

positive regulation of transcription by RNA polymerase II

20530484|21209915

TgeneMITF

GO:0065003

protein-containing complex assembly

20530484

TgeneMITF

GO:2000144

positive regulation of DNA-templated transcription, initiation

8995290|12204775

TgeneMITF

GO:2001141

regulation of RNA biosynthetic process

16411896


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHYMTCGA-ZB-A969-01AMAGI1chr3

66023671

-MITFchr3

69998202

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000330909ENST00000352241MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000448226MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000472437MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000328528MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000314589MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000394355MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000314557MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000394351MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000330909ENST00000531774MAGI1chr3

66023671

-MITFchr3

69998202

+
5CDS-intronENST00000330909ENST00000394348MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000352241MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000448226MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000472437MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000328528MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000314589MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000394355MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000314557MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000394351MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000402939ENST00000531774MAGI1chr3

66023671

-MITFchr3

69998202

+
5CDS-intronENST00000402939ENST00000394348MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000352241MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000448226MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000472437MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000328528MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000314589MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000394355MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000314557MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000394351MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000483466ENST00000531774MAGI1chr3

66023671

-MITFchr3

69998202

+
5CDS-intronENST00000483466ENST00000394348MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000352241MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000448226MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000472437MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000328528MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000314589MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000394355MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000314557MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000394351MAGI1chr3

66023671

-MITFchr3

69998202

+
In-frameENST00000497477ENST00000531774MAGI1chr3

66023671

-MITFchr3

69998202

+
5CDS-intronENST00000497477ENST00000394348MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000352241MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000448226MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000472437MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000328528MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000314589MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000394355MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000314557MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000394351MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-3CDSENST00000470990ENST00000531774MAGI1chr3

66023671

-MITFchr3

69998202

+
intron-intronENST00000470990ENST00000394348MAGI1chr3

66023671

-MITFchr3

69998202

+

Top

FusionProtFeatures for MAGI1_MITF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAGI1

Q96QZ7

MITF

O75030

May play a role as scaffolding protein at cell-celljunctions. May regulate acid-induced ASIC3 currents by modulatingits expression at the cell surface (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-12517_1051041288DomainPDZ 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-12317_1051041463DomainPDZ 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-12317_1051041257DomainPDZ 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-12117_1051041161DomainPDZ 1
TgeneMITFchr3:66023671chr3:69998202ENST00000314557+39355_402147414Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000314589+410355_402238505Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000328528+410355_402253520Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000352241+410355_402254521Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000394351+39355_402147420Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000394355+39355_402229496Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000448226+410355_402254527Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000472437+410355_402202469Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000531774+39355_40291358Coiled coilOntology_term=ECO:0000305
TgeneMITFchr3:66023671chr3:69998202ENST00000314557+39311_364147414DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000314589+410311_364238505DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000328528+410311_364253520DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000352241+410311_364254521DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000394351+39311_364147420DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000394355+39311_364229496DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000448226+410311_364254527DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000472437+410311_364202469DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000531774+39311_36491358DomainbHLH
TgeneMITFchr3:66023671chr3:69998202ENST00000314557+39224_295147414RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000314557+39374_395147414RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000314557+39401_431147414RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000314589+410374_395238505RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000314589+410401_431238505RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000328528+410374_395253520RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000328528+410401_431253520RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000352241+410374_395254521RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000352241+410401_431254521RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000394351+39224_295147420RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000394351+39374_395147420RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000394351+39401_431147420RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000394355+39374_395229496RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000394355+39401_431229496RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000448226+410374_395254527RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000448226+410401_431254527RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000472437+410224_295202469RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000472437+410374_395202469RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000472437+410401_431202469RegionNote=DNA binding regulation
TgeneMITFchr3:66023671chr3:69998202ENST00000531774+39224_29591358RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000531774+39374_39591358RegionLeucine-zipper
TgeneMITFchr3:66023671chr3:69998202ENST00000531774+39401_43191358RegionNote=DNA binding regulation

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-1251341_13441041288Compositional biasNote=Poly-Ala
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-1251398_14011041288Compositional biasNote=Poly-Arg
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125402_4211041288Compositional biasNote=Poly-Gln
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125662_6651041288Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125978_9881041288Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-1231341_13441041463Compositional biasNote=Poly-Ala
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-1231398_14011041463Compositional biasNote=Poly-Arg
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123402_4211041463Compositional biasNote=Poly-Gln
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123662_6651041463Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123978_9881041463Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-1231341_13441041257Compositional biasNote=Poly-Ala
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-1231398_14011041257Compositional biasNote=Poly-Arg
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123402_4211041257Compositional biasNote=Poly-Gln
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123662_6651041257Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123978_9881041257Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-1211341_13441041161Compositional biasNote=Poly-Ala
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-1211398_14011041161Compositional biasNote=Poly-Arg
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121402_4211041161Compositional biasNote=Poly-Gln
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121662_6651041161Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121978_9881041161Compositional biasNote=Poly-Gly
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-1251124_12061041288DomainPDZ 6
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125300_3331041288DomainWW 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125359_3921041288DomainWW 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125472_5541041288DomainPDZ 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125643_7211041288DomainPDZ 3
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125813_8951041288DomainPDZ 4
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-12596_2871041288DomainGuanylate kinase-like
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-1231124_12061041463DomainPDZ 6
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123300_3331041463DomainWW 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123359_3921041463DomainWW 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123472_5541041463DomainPDZ 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123643_7211041463DomainPDZ 3
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123813_8951041463DomainPDZ 4
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-12396_2871041463DomainGuanylate kinase-like
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-1231124_12061041257DomainPDZ 6
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123300_3331041257DomainWW 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123359_3921041257DomainWW 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123472_5541041257DomainPDZ 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123643_7211041257DomainPDZ 3
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123813_8951041257DomainPDZ 4
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-12396_2871041257DomainGuanylate kinase-like
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-1211124_12061041161DomainPDZ 6
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121300_3331041161DomainWW 1
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121359_3921041161DomainWW 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121472_5541041161DomainPDZ 2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121643_7211041161DomainPDZ 3
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121813_8951041161DomainPDZ 4
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-12196_2871041161DomainGuanylate kinase-like
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125103_1101041288Nucleotide bindingATP
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123103_1101041463Nucleotide bindingATP
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123103_1101041257Nucleotide bindingATP
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121103_1101041161Nucleotide bindingATP
TgeneMITFchr3:66023671chr3:69998202ENST00000314589+410224_295238505RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000328528+410224_295253520RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000352241+410224_295254521RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000394355+39224_295229496RegionNote=Transactivation
TgeneMITFchr3:66023671chr3:69998202ENST00000448226+410224_295254527RegionNote=Transactivation


Top

FusionGeneSequence for MAGI1_MITF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_377aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHSVTFSHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_P
H_RTRYFDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGES
DHQARTRS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQN

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_371aa
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRTDVLGVI
DSCKEAVTFKAVRQVACLGKLD_SLWKPRSAPTRPHHQQLLSSQPSQHKKGAHRV_SKSTGQREAEKGQSQPD_TKKKI_HK_PH_RTRY
FDSQVK_SRHALEQGNHLKSIRGLTPKVATRTATRKRT_KPTEETGARQPAFVAQNTGT_NAGSSSWTFPTSIHGSLLSRFGESDHQART
RS_ELQPRPPSASCRPNLYNNSRSHGWHHHLQQQPRNWD_GQPSL_CPHKNGIQTGRHPDGRHPFSRRCH_STPFLSVPRSFQNKQPEEQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1132nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_4202nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1913nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC
TTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATG
CGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAG
TCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAA

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_4203nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_4199nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1534nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1708nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC

>In-frame_MAGI1_ENST00000330909_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_4202nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1913nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC
TTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATG
CGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAG
TCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAA

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_4203nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_4199nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1534nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1708nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC

>In-frame_MAGI1_ENST00000402939_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_4444nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC
TTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACT
AACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCA
AACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACC
AACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCAT
CAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCTCAAAGTAAAATATTGAGGAGCACTGAAA
GTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATATTTCTAATTGGCTTTACTATTTTTATTTT
TAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAATATATTTGTATTAATTTGTAAGAATATG
CATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTGTACACCCATGAAAGAAAACTTTTATGCA
AGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACTGTTTTTGGACACATTTAAGGTGTAGTAT
TAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGAAAATAGCAATATTCTTGGAGATTGATAA
CCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTGAATTTATTTTTAAGAAAGAAATACTGTA
TTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTTTCAGTGCATTATCTACTTGTGTAGTCCT
ATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTGTTATGAGCCAGGCTGTTGAATGGAATTT
CTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTGCCTTAAATATAGCAGTAGTCTTTTTTGG
ACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACGAACATGTAGCATGGTGCCTATGTAGACA
ATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAGTGCCAACTTCTTTCATCAGGAAACCTTA
TTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGGGTTCAGAGAGGAGTGATCGTCAGATGTG
TGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAGAATCCTTGGAAACATTGGTGATGCTATC
AGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCTTAACTGTATAGCTCTTTTCCTAGAATAG
TGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATTGTCTATTTTTCTCTTCATATTTATATGG
GGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGCTGATTTTGAGGGTTTTTAAAAATAAAGC
AAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTTTGTTGAAAGAAAGTATGGCATCTTGTAC
CACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCTTAAGAGACAATTTCTGCAGGTGGCAGGT
GAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAATAGAGTGTGGATTCATTTCAGGGGCTAG
CTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTCCCCCGATTCCCGGGTGCAGAATTGTAAC
TCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTAGGGCAATGGAAATACCAAACCTTCTGAC
TTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGTTTTTAAACAATAAAGCAATAAGAACAAA
TACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCACTGGGAAAAAGTTGATGTCAATAACAGT
ATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTACTGTAATGTTAATAATAGTCACCTGCTG
TTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATGTATCCAATGAAATAATCGACTTGTTCTT

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_2155nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAG
AGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCC
AAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAA
CGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCT
CGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAG
AACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAAC
AACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACC
CTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATG
GAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTA
CCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAAT
TTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAAT
TCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATT
TTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAAGA
GGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCCTCTAGCTTTG
TTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGATCGTCTGGTTA
GAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTTTATTCTGTGC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1755nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_4445nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC
TTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACT
AACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCA
AACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACC
AACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCAT
CAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCTCAAAGTAAAATATTGAGGAGCACTGAAA
GTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATATTTCTAATTGGCTTTACTATTTTTATTTT
TAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAATATATTTGTATTAATTTGTAAGAATATG
CATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTGTACACCCATGAAAGAAAACTTTTATGCA
AGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACTGTTTTTGGACACATTTAAGGTGTAGTAT
TAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGAAAATAGCAATATTCTTGGAGATTGATAA
CCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTGAATTTATTTTTAAGAAAGAAATACTGTA
TTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTTTCAGTGCATTATCTACTTGTGTAGTCCT
ATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTGTTATGAGCCAGGCTGTTGAATGGAATTT
CTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTGCCTTAAATATAGCAGTAGTCTTTTTTGG
ACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACGAACATGTAGCATGGTGCCTATGTAGACA
ATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAGTGCCAACTTCTTTCATCAGGAAACCTTA
TTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGGGTTCAGAGAGGAGTGATCGTCAGATGTG
TGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAGAATCCTTGGAAACATTGGTGATGCTATC
AGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCTTAACTGTATAGCTCTTTTCCTAGAATAG
TGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATTGTCTATTTTTCTCTTCATATTTATATGG
GGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGCTGATTTTGAGGGTTTTTAAAAATAAAGC
AAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTTTGTTGAAAGAAAGTATGGCATCTTGTAC
CACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCTTAAGAGACAATTTCTGCAGGTGGCAGGT
GAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAATAGAGTGTGGATTCATTTCAGGGGCTAG
CTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTCCCCCGATTCCCGGGTGCAGAATTGTAAC
TCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTAGGGCAATGGAAATACCAAACCTTCTGAC
TTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGTTTTTAAACAATAAAGCAATAAGAACAAA
TACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCACTGGGAAAAAGTTGATGTCAATAACAGT
ATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTACTGTAATGTTAATAATAGTCACCTGCTG
TTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATGTATCCAATGAAATAATCGACTTGTTCTT

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1755nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_4441nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC
TTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACT
AACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCA
AACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACC
AACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCAT
CAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCTCAAAGTAAAATATTGAGGAGCACTGAAA
GTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATATTTCTAATTGGCTTTACTATTTTTATTTT
TAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAATATATTTGTATTAATTTGTAAGAATATG
CATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTGTACACCCATGAAAGAAAACTTTTATGCA
AGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACTGTTTTTGGACACATTTAAGGTGTAGTAT
TAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGAAAATAGCAATATTCTTGGAGATTGATAA
CCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTGAATTTATTTTTAAGAAAGAAATACTGTA
TTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTTTCAGTGCATTATCTACTTGTGTAGTCCT
ATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTGTTATGAGCCAGGCTGTTGAATGGAATTT
CTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTGCCTTAAATATAGCAGTAGTCTTTTTTGG
ACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACGAACATGTAGCATGGTGCCTATGTAGACA
ATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAGTGCCAACTTCTTTCATCAGGAAACCTTA
TTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGGGTTCAGAGAGGAGTGATCGTCAGATGTG
TGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAGAATCCTTGGAAACATTGGTGATGCTATC
AGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCTTAACTGTATAGCTCTTTTCCTAGAATAG
TGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATTGTCTATTTTTCTCTTCATATTTATATGG
GGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGCTGATTTTGAGGGTTTTTAAAAATAAAGC
AAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTTTGTTGAAAGAAAGTATGGCATCTTGTAC
CACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCTTAAGAGACAATTTCTGCAGGTGGCAGGT
GAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAATAGAGTGTGGATTCATTTCAGGGGCTAG
CTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTCCCCCGATTCCCGGGTGCAGAATTGTAAC
TCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTAGGGCAATGGAAATACCAAACCTTCTGAC
TTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGTTTTTAAACAATAAAGCAATAAGAACAAA
TACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCACTGGGAAAAAGTTGATGTCAATAACAGT
ATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTACTGTAATGTTAATAATAGTCACCTGCTG
TTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATGTATCCAATGAAATAATCGACTTGTTCTT

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1776nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT
TGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTG
ATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGT
ATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCT
TTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCC

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1950nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAG
AGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCC
AAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAA
CGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCT
CGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAG
AACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAAC
AACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACC
CTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATG
GAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATTTAATAACTTA
CCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTATTTTTAGAAT
TTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTGTGAACTGAAT
TCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTGATTTGAGATT
TTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAAGAAAGAAAGA
GGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCCTCTAGCTTTG

>In-frame_MAGI1_ENST00000483466_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1356nt
CGGAATGCAAACAAAGCTCGCGGGCGCCTGTGCGGGGCTCGCGGGGAAGCCCAGAAAGTTTGTTTTATGATGGCTTGAGTGCGCGAGCGT
GTGCAGGGGAGCGAGGCTGCCAAGTTTCTCTCTCCTGTTTTGTGATTTGGGGAGAGATGTTTCTCCCATGAACAAGCGGAGGCTTGGGGG
CTCGTGCTGTGGGGGGCACCTGTCTCTCGTTTTATTTTTTTGGAGGAGGGGTGTAACTCATCATGTCCAAAGTGATCCAGAAGAAGAACC
ACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTGACGGTGCTGGGAGGCGCGGAGCACGGGG
AGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAGGGCCCGAGGCTGGGCGAAGGGGAGCTGC
TTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATCGACAGCTGCAAGGAGGCCGTCACCTTCA
AGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGGCCTCACCATCAGCAAC
TCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAAT
CACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGAC
ATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAA
AACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCC
CTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTC
CTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACT
GAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTC
ACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACT

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000352241_chr3_69998202_+_4202nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000448226_chr3_69998202_+_1913nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC
TTAAAGATACAGTACCCCTCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATG
CGGCCTTTTCATGAGGATCGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAG
TCTAATCTTGCTCTCTTTTATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAA

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000472437_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000328528_chr3_69998202_+_4203nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314589_chr3_69998202_+_1513nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394355_chr3_69998202_+_4199nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA
GAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCCTTAAAGATACAGTACCCC
TCTAGCTTTGTTTAGTCTTTATACTGCAAACTATTTAAAGAAATATGTATTCTGTAAAAGAAAAAAAAAATGCGGCCTTTTCATGAGGAT
CGTCTGGTTAGAAAACATAACTGATACCAACCGAAACTGAAGGGAGTTAGACCAAGGCTCTGAAATATAAAGTCTAATCTTGCTCTCTTT
TATTCTGTGCTGTTACAGTTTTCTTCATCAATGAGTGTGATCCAGTTTTTCATAAGATATTTTATTTTGAAATGGAAATTAATGTCCTCT
CAAAGTAAAATATTGAGGAGCACTGAAAGTATGTTTTACTTTTTTTTTATTTTATTTTTGCTTTTGATAAGAAAACCGAACTGGGCATAT
TTCTAATTGGCTTTACTATTTTTATTTTTAAATTATGTTTTACTGTTCATTTGATTTGTACAGATTCTTTATTATCATTGTTCTTTTCAA
TATATTTGTATTAATTTGTAAGAATATGCATCTTAAAATGGCAAGTTTTCCATATTTTTACAACTCACTGGTGGTTTTCCGCATTCTTTG
TACACCCATGAAAGAAAACTTTTATGCAAGGTCTTGCATTTAAAAGACAGCTTTGCGAATATTTTGTAAATTACAGTCTCACTCAGAACT
GTTTTTGGACACATTTAAGGTGTAGTATTAATAGGTTAAAACCAGGCTTTCTAGAAAGAATAAACTTACATATTTATTTTTAGGACATGA
AAATAGCAATATTCTTGGAGATTGATAACCATAGCATTAATACGCCCATTATGGTCATTTAAATTGGGGTTTATTTCAGCAAACTTGTTG
AATTTATTTTTAAGAAAGAAATACTGTATTGGGAAGTTACTGTTACTTGATAACAATGTTTTAACAAGAAGCAATGTTATAAAGTTAGTT
TCAGTGCATTATCTACTTGTGTAGTCCTATGCAATAACAGTAGTGTTACATGTATCAAGCCTAGATGTTTTATACAGATGCCATATAGTG
TTATGAGCCAGGCTGTTGAATGGAATTTCTCAGTAGCAGCCTACAACTGAATAGCAAGTGGCATAAAGCATATCCATTCAGAATGAAGTG
CCTTAAATATAGCAGTAGTCTTTTTTGGACTAGCACTGACTGAACTGTAATGTAGGGGAAAGTTTCATGATGGTATCTATAGTCAAGACG
AACATGTAGCATGGTGCCTATGTAGACAATATAAGAGCTTCCAATTTTCCTTCAGATATTTTTAATATTAAATATATTTTAGTGACAGAG
TGCCAACTTCTTTCATCAGGAAACCTTATTCAGGAGGGTTTTTAAAAAGTGTTTAAATGTCAAATGTGAATTGGTGATGGGTGATGGAGG
GTTCAGAGAGGAGTGATCGTCAGATGTGTGAATGGACGGTTTAGGTGAAAATAATCAACTGCATAGTTCCCATGCACGCTGGGCAATGAG
AATCCTTGGAAACATTGGTGATGCTATCAGTTTTATAGCTTTATTTCTTAAGGGGGTAGGGAAAATTAGTTCCCATTCTTTCAACCCCCT
TAACTGTATAGCTCTTTTCCTAGAATAGTGACGCAAATCTGCATGAACAGCTAATTGTACCATAGTGTTCATTGATACAATCATAGCATT
GTCTATTTTTCTCTTCATATTTATATGGGGGGGAGGGCGCTGGATGCAAAAGTTGAAGATCGTGATGCTATGATGTTAGTTTTCCTTAGC
TGATTTTGAGGGTTTTTAAAAATAAAGCAAGGTTGACTAACCTACGGCCACGGGAACAGGACCATGGTTAAGCAACCATATAGAAAGCTT
TGTTGAAAGAAAGTATGGCATCTTGTACCACTGCCCTGACTGTCACAACTCCTAACCTTGCCATTGCCTGCCTCCCCCTCCCCTTCTCCT
TAAGAGACAATTTCTGCAGGTGGCAGGTGAGCAAGCCCAGGAGAATGCTGCAATCTTGGGGGTGGTTTTATTTATTTCTTTTTTGCCAAA
TAGAGTGTGGATTCATTTCAGGGGCTAGCTAAGCCAAGAGGCAGTGGTTTGGGCTTGTTGTTTGTAACAAGAAAATGATCCACACCACTC
CCCCGATTCCCGGGTGCAGAATTGTAACTCGGGGTTGGGCCTCTATATGGAGTGACCAAAATGCCAAAATTGTCCATCTGCCTCTGAGTA
GGGCAATGGAAATACCAAACCTTCTGACTTTGCCAAAAAGCATACAAGCAACCTGGTCATACATAGGATGACAAAATTCTTTCTGGTTGT
TTTTAAACAATAAAGCAATAAGAACAAATACAATACATAGGAAGTTAAAAGCACAAAGGAATGAACTTATTAATATTTTTGAAAAATGCA
CTGGGAAAAAGTTGATGTCAATAACAGTATAAAACAGCCCTATTTCTTGATAAAAAATGACAAATGACTGTCTCTTGCGGATGCTTGGTA
CTGTAATGTTAATAATAGTCACCTGCTGTTGGATGCAGCAATAATTTCTGTATGGTCCATAGCACTGTATATTATGGATCGATATTAATG

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000314557_chr3_69998202_+_1534nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG
TATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCCTTTCTTGATTCGTAGATT
TAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAATAGCCCAGGATATATTTTA
TTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAAATAAGTGTGCAGTATCTG
TGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTTTTATTCAGGGGAAACTTG
ATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAACCAAAAAGAAAAAAAAAAA

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000394351_chr3_69998202_+_1708nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGCGTGTATTTTTCCCACAGA
GTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTA
TATCCGAAAGTTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCT
CAGAATACAGGAACTTGAAATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCG
GATCATCAAGCAAGAACCCGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCT
CACGGATGGCACCATCACCTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAAC
AAGCAGCCGGAGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTAGCGAATCCTCCCTGCACTGCATTCGCACAAACTGCTTCC
TTTCTTGATTCGTAGATTTAATAACTTACCTGAAGGGGTTTTCTTGATAATTTTCCTTTAATATGAAATTTTTTTTCATGCTTTATCAAT
AGCCCAGGATATATTTTATTTTTAGAATTTTGTGAAACAGACTTGTATATTCTATTTTACAACTACAAATGCCTCCAAAGTATTGTACAA
ATAAGTGTGCAGTATCTGTGAACTGAATTCACCACAGACTTTAGCTTTCTGAGCAAGAGGATTTTGCGTCAGAGAAATGTCTGTCCATTT
TTATTCAGGGGAAACTTGATTTGAGATTTTTATGCCTGTGACTTCCTTGGAAATCAAATGTAAAGTTTAATTGAAAGAATGTAAAGCAAC
CAAAAAGAAAAAAAAAAAGAAAGAAAGAGGAAAAGAAATCCATACTAACCCTTTTCCATTTTATAAATGTATTGATTCATTGGTACTGCC

>In-frame_MAGI1_ENST00000497477_chr3_66023671_-_MITF_ENST00000531774_chr3_69998202_+_1114nt
ATGTCCAAAGTGATCCAGAAGAAGAACCACTGGACTAGCAGGGTTCACGAATGCACCGTGAAGCGGGGACCCCAGGGCGAGCTGGGGGTG
ACGGTGCTGGGAGGCGCGGAGCACGGGGAGTTTCCGTACGTCGGAGCGGTGGCGGCGGTCGAGGCAGCGGGGCTTCCCGGCGGCGGCGAG
GGCCCGAGGCTGGGCGAAGGGGAGCTGCTTCTGGAGGTGCAGGGGGTCCGGGTGTCCGGCTTGCCCCGCTATGACGTGCTGGGGGTCATC
GACAGCTGCAAGGAGGCCGTCACCTTCAAGGCCGTCAGACAAGTTGCCTGTCTCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCT
GCCCCCACCAGGCCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGGAGCTCACAGAGTCTGAAGCAAGAGCACT
GGCCAAAGAGAGGCAGAAAAAGGACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCGCATTAAAGAACTAGGTAC
TTTGATTCCCAAGTCAAATGATCCAGACATGCGCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAGTTGCAACG
AGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAAACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGA
AATGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGCTCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACC
CGTTCTTGAGAACTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAACTCTCGATCTCACGGATGGCACCATCAC
CTTCAACAACAACCTCGGAACTGGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAAACTGGAAGACATCCTGAT
GGACGACACCCTTTCTCCCGTCGGTGTCACTGATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGGAGGAGCAG


Top

FusionGenePPI for MAGI1_MITF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAGI1CTNNB1, LRP2, ASIC3, BZW1, SFN, FCHSD2, WBP1, WBP2, CDH1, NET1, SYNPO, ACTN4, ATN1, BAI1, RAC1, DDN, SSTR3, IGSF5, LATS1, LATS2, RAPGEF2, MOV10, NXF1, CYYR1, LDLRAD4, PTPN14, KCTD3, KIF13B, ZBTB21, KSR1, GIGYF1, LRFN1, DENND1A, SH3PXD2A, SRGAP2, EIF4E2, SIPA1L1, LIMA1, TESK2, DCLK1, ZNF638, RTKN, MAST3, SRSF12, PPM1H, SYDE1, DENND4C, AGAP1, CDC25B, CDK16, FAM110B, USP21, MAPKAP1, FAM53C, ANKRD34A, CGN, FAM110A, HDAC4, NF1, TBC1D25, NADK, CBY1, TIAM1, PHLDB2, KIAA1804, RASAL2, CAMSAP2, LPIN3, GAB2, CDC25C, MELK, PLEKHA7, KIF1C, GIGYF2, DEPDC1B, NAV1, DENND4A, MLLT4, STARD13, RPTOR, SH3RF3, PLEKHA5, SH3BP4, HDAC7, EDC3, LARP1, RAB3IP, INPP5EMITFLEF1, PIAS3, PATZ1, UBE2I, TFE3, FOS, SPI1, PAX6, TFEC, SUMO1, PIAS1, PIAS2, PSMD14, MARK3, CDK2, ELAVL1, HINT1, APP, EPAS1, STUB1, HK3, EBP, EP300, XPO1, TFEB, RBM6, KLHL20, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneMAGI1chr3:66023671chr3:69998202ENST00000330909-125970_10661041288FCHSD2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000402939-123970_10661041463FCHSD2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000483466-123970_10661041257FCHSD2
HgeneMAGI1chr3:66023671chr3:69998202ENST00000497477-121970_10661041161FCHSD2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAGI1_MITF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAGI1_MITF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMAGI1C0005586Bipolar Disorder2PSYGENET
HgeneMAGI1C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneMAGI1C0036341Schizophrenia1PSYGENET
HgeneMAGI1C1839839MAJOR AFFECTIVE DISORDER 21PSYGENET
TgeneMITFC3152204MELANOMA, CUTANEOUS MALIGNANT, SUSCEPTIBILITY TO, 82CTD_human;ORPHANET;UNIPROT
TgeneMITFC0007134Renal Cell Carcinoma1CTD_human
TgeneMITFC0007621Neoplastic Cell Transformation1CTD_human
TgeneMITFC0011053Deafness1CTD_human
TgeneMITFC0025202melanoma1CTD_human;HPO
TgeneMITFC0078918Albinism, Oculocutaneous1CTD_human
TgeneMITFC0151779Cutaneous Melanoma1CTD_human
TgeneMITFC0391816Tietz syndrome1CTD_human;ORPHANET;UNIPROT
TgeneMITFC0549567Pigmentation Disorders1CTD_human
TgeneMITFC1860339WAARDENBURG SYNDROME, TYPE IIA1CTD_human;UNIPROT
TgeneMITFC2700265Waardenburg Syndrome Type 21CTD_human;ORPHANET