FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20528

FusionGeneSummary for MACROD2_DCLK2

check button Fusion gene summary
Fusion gene informationFusion gene name: MACROD2_DCLK2
Fusion gene ID: 20528
HgeneTgene
Gene symbol

MACROD2

DCLK2

Gene ID

140733

166614

Gene nameMACRO domain containing 2doublecortin like kinase 2
SynonymsC20orf133|C2orf133CL2|CLICK-II|CLICK2|CLIK2|DCAMKL2|DCDC3|DCDC3B|DCK2
Cytomap

20p12.1

4q31.23-q31.3

Type of geneprotein-codingprotein-coding
DescriptionO-acetyl-ADP-ribose deacetylase MACROD2MACRO domain-containing protein 2[Protein ADP-ribosylglutamate] hydrolaseserine/threonine-protein kinase DCLK2CaMK-like CREB regulatory kinase 2doublecortin and CaM kinase-like 2doublecortin domain-containing protein 3Bdoublecortin-like and CAM kinase-like 2
Modification date2018051920180523
UniProtAcc

A1Z1Q3

Q8N568

Ensembl transtripts involved in fusion geneENST00000217246, ENST00000310348, 
ENST00000464883, ENST00000402914, 
ENST00000378058, ENST00000407045, 
ENST00000296550, ENST00000506325, 
ENST00000302176, ENST00000507694, 
Fusion gene scores* DoF score10 X 10 X 8=8002 X 1 X 2=4
# samples 112
** MAII scorelog2(11/800*10)=-2.86249647625006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: MACROD2 [Title/Abstract] AND DCLK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMACROD2

GO:0042278

purine nucleoside metabolic process

21257746

HgeneMACROD2

GO:0051725

protein de-ADP-ribosylation

23474712


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A1HN-01AMACROD2chr20

13983050

+DCLK2chr4

151023630

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000217246ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
In-frameENST00000217246ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
In-frameENST00000217246ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
5CDS-intronENST00000217246ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+
In-frameENST00000310348ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
In-frameENST00000310348ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
In-frameENST00000310348ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
5CDS-intronENST00000310348ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000464883ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000464883ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000464883ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-intronENST00000464883ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000402914ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000402914ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000402914ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-intronENST00000402914ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000378058ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000378058ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000378058ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-intronENST00000378058ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000407045ENST00000296550MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000407045ENST00000506325MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-3CDSENST00000407045ENST00000302176MACROD2chr20

13983050

+DCLK2chr4

151023630

+
intron-intronENST00000407045ENST00000507694MACROD2chr20

13983050

+DCLK2chr4

151023630

+

Top

FusionProtFeatures for MACROD2_DCLK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MACROD2

A1Z1Q3

DCLK2

Q8N568

Removes ADP-ribose from glutamate residues in proteinsbearing a single ADP-ribose moiety. Inactive towards proteinsbearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, asignaling molecule generated by the deacetylation of acetylatedlysine residues in histones and other proteins.{ECO:0000269|PubMed:21257746, ECO:0000269|PubMed:23474712}. Protein kinase with a significantly reduced C(a2+)/CAMaffinity and dependence compared to other members of the CaMKfamily. May play a role in the down-regulation of CRE-dependentgene activation probably by phosphorylation of the CREBcoactivator CRTC2/TORC2 and the resulting retention of TORC2 inthe cytoplasm (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+2176_954426Compositional biasNote=Poly-Lys
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+2186_954449Compositional biasNote=Poly-Lys
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+016293_362140767Compositional biasNote=Ser-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+016713_753140767Compositional biasNote=Pro-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+017293_362140784Compositional biasNote=Ser-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+017713_753140784Compositional biasNote=Pro-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+016293_362140766Compositional biasNote=Ser-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+016713_753140766Compositional biasNote=Pro-rich
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+016197_280140767DomainDoublecortin 2
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+016394_651140767DomainProtein kinase
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+017197_280140784DomainDoublecortin 2
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+017394_651140784DomainProtein kinase
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+016197_280140766DomainDoublecortin 2
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+016394_651140766DomainProtein kinase
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+016400_408140767Nucleotide bindingATP
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+017400_408140784Nucleotide bindingATP
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+016400_408140766Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+217247_38854426Compositional biasNote=Glu-rich
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+218247_38854449Compositional biasNote=Glu-rich
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+110247_3880214Compositional biasNote=Glu-rich
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+1106_90214Compositional biasNote=Poly-Lys
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+114247_388-154214Compositional biasNote=Glu-rich
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+1146_9-154214Compositional biasNote=Poly-Lys
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+16247_388-7999Compositional biasNote=Glu-rich
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+166_9-7999Compositional biasNote=Poly-Lys
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+21759_24054426DomainMacro
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+21859_24054449DomainMacro
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+11059_2400214DomainMacro
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+11459_240-154214DomainMacro
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+1659_240-7999DomainMacro
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+217185_19154426RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+21777_7954426RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+21790_9254426RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000217246+21797_10254426RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+218185_19154449RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+21877_7954449RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+21890_9254449RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000310348+21897_10254449RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+110185_1910214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+11077_790214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+11090_920214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000378058+11097_1020214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+114185_191-154214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+11477_79-154214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+11490_92-154214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000402914+11497_102-154214RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+16185_191-7999RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+1677_79-7999RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+1690_92-7999RegionNote=Substrate binding
HgeneMACROD2chr20:13983050chr4:151023630ENST00000407045+1697_102-7999RegionNote=Substrate binding
TgeneDCLK2chr20:13983050chr4:151023630ENST00000296550+01672_158140767DomainDoublecortin 1
TgeneDCLK2chr20:13983050chr4:151023630ENST00000302176+01772_158140784DomainDoublecortin 1
TgeneDCLK2chr20:13983050chr4:151023630ENST00000506325+01672_158140766DomainDoublecortin 1


Top

FusionGeneSequence for MACROD2_DCLK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_681aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISA
HGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRR
VKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLG
DFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKE
LISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGME

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_680aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKISAH
GRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRV
KHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGD
FGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKEL
ISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEP

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_698aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVKRGGHYSSAYSTAKSPVNGTPSSQLSTPKSTKSSS
SSPTSPGSFRGLKQISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAK
CCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPE
NLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGK
LEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEG

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_681aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISA
HGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRR
VKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLG
DFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKE
LISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGME

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_680aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKISAH
GRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRV
KHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGD
FGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKEL
ISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEP

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_698aa
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRA
LAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVF
IACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSAVKYSGSKSPGPSRRSKSPASVKRGGHYSSAYSTAKSPVNGTPSSQLSTPKSTKSSS
SSPTSPGSFRGLKQISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAK
CCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPE
NLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGK
LEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_2043nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCT
CATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAA
TCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACT
GGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGA
GTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGAT
CTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTC
CATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGA
GACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACT
GGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAAT
CTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAA
TTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCC
CAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGG
GTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAG
CCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCC

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_2040nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGATTTCTGCTCAT
GGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCA
TCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGA
AAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTG
AAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTC
TTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCAT
GGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGAC
TTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGC
TATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTC
CAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTA
ATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAG
GAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTC
TCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCC
ATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCAC

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_2094nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTAAAGCGGGGTGGCCAC
TACTCCAGTGCCTATTCTACAGCCAAATCCCCAGTTAATGGAACTCCCAGCAGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGT
TCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCTCATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAG
CTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTC
ATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAA
TGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATG
GAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAG
AGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAG
AATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATAC
ACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTG
ATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAG
CTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGG
TGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTA
AAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGG
CAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCT
GTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGA

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_2043nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCT
CATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAA
TCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACT
GGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGA
GTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGAT
CTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTC
CATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGA
GACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACT
GGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAAT
CTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAA
TTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCC
CAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGG
GTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAG
CCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCC

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_2040nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGATTTCTGCTCAT
GGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCA
TCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGA
AAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTG
AAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTC
TTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCAT
GGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGAC
TTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGC
TATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTC
CAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTA
ATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAG
GAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTC
TCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCC
ATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCAC

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_2094nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTAAAGCGGGGTGGCCAC
TACTCCAGTGCCTATTCTACAGCCAAATCCCCAGTTAATGGAACTCCCAGCAGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGT
TCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCTCATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAG
CTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTC
ATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAA
TGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATG
GAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAG
AGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAG
AATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATAC
ACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTG
ATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAG
CTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGG
TGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTA
AAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGG
CAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCT
GTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_3648nt
GCGTGCGCCCTGGGGCCCAAGTTGGGGCGCGCCGTGGCTAGAACACGGAGAGCGGCGGGCAGTGCAGCCAATGGGAGGCGGCGCTGCCTA
GCGGCTGGTAGGCGGTGCCTGCGCGGGTGTTAGGTTAGCGCGAGGCGTGACCTAGTTGACAGGCTCTGAGGTGCTGCTGTGGCGGCGTCC
GCGGGGCTGAGGCGGGTGGGAGCCGGAGCCGAGCGCGGGCTGAGGGAGGAGGGCGGCGACTGGAGAGCGGCGAGCGGCGAGCAGCGCAGG
ACGCAGAGCCTCTTTCACTTTTTCCCTGCTGAGTGCCCCCTCCCACCCCTCCCACTCCACACACACCCTGTTTGCCCGTGAGCCTGGGGA
ACTTGCAGCTTAAAGCCAGCCACCCCCACGGCAACATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTAT
TGAAGATGACCTTAGAAGAGAGACGCAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGG
GCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGTGCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACT
GGTCTGTGAACATCAAGGGTGGGACATCCCGAGCGCTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCA
AACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTGAAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTG
AACAAGTCTTAACAGATATCACCGAAGCCATTAAACTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTT
GTCTGCAAGACTTTTTTGGTGATGACGATGTTTTTATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATC
ATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCTCGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCA
GCAAATCACCAGCTTCAGTTAATGGAACTCCCAGCAGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTC
CAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCTCATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAA
GTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATT
TTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAAC
ACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGC
TCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCA
TGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTG
AATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACAC
CCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTC
TCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCC
CCTACTGGGATAACATCACGGACTCTGCCAAGGAATTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAA
TCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATA
ATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCA
AGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAG
TCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGAACCTGGCGCCGCCACC
GAGACTGAGCCTCCTGCAGACGGGCGAAGCCGCCTGCTGCAGCCCAGGAAGCCAGCCCTCTGCTCGGCCTCGCCGGCCTCCCTGCTGCAG
GCCTCCCTCTCTTCACCGCCTGCGCCTGAGTTCGCGGGTCCTCCGCAGGCCGCCTGGGAACCGGAGCCTGGCGTGCCGGAGCCTGGCCTG
GTGCTCTGGGCTCTGCCTTCTGGTTCCTGGAGGCATCAAAGGCTGCATCCGTTCTGCCAACAGCTGTTCGGAGAGACTCGTTCCAGATCA
TCCCGTCATTTTCAGTTTGTTGGACATTTTACAGCTTCACCAGGAGAATGTGCAACTTTATTCCAGCATTCGATGCATTTTTATAGAAAC
ACTTTGGAAACACTTTGGATGAACCAAGGCCTTTTCCTTATTTAAGTAGACTCAGAACACTCCCTTTCTTTTCTTTTCTCTCTCTCTCTC
TCTTTTTTTTTTACGAAAGACTTAGAATTGCATTTGTCCTTTTGTGGGTGTCCTGTGAGAGGTGATATGGGGGCTAAGAGGACTGGCTTT
CTAATAGAAGAAGTGAGCGCCTGAGAGGACAATTTGGTCATTGGACACGGATTGCAGGCTTTGAGAAGCGCTCAGAGGCCCAGGGCGGCG
GGCTCAGCCATTCGGCTTGGGGCACCAGGCTCCCCAGAGACAATGCTCAGTATTCATTCATACACAGACGATGGAAGAAGCCACTTCTTC
CCTGGGCGGTGTGGGTTTCCCCCAGCTCTTCCCACACGTGTGTTAGGAAATGCCCGTGAACTTGCCCTCTGGGCTTTTTAATGAGAGGCT
TGGCGCATGCGGCACCCAGCGGCTGCTTCCCTGCAAGCCAGCGACTTGCCGAGCAGAATGAGCTCTGCTCCTGAGCCCCGGTAGCTGCTT
CCTCATCTGCATTTCATCTGGAGCAGGGCAGGTAACCACAGGAGGAGGCATGCCCGAGGCAGCCAGGACTGGGCGGGAAGGTGCTCCCTG
GATATACTCTGTGAACCTTCTGGAAGGCTGCTGGCAGTTTTTCCTTTTTGTCCACCACCCTGCTCTTTTTAATAATTGTACATAATCCGT
GTATTTGTTTTACCTGCTCATCTTCTAAACTGGCGAGCCCTATAGTTCGTTCTCATTGTTAGATTTTGCCTTTTACAAGTGTCCCCAACC

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_2435nt
GCGTGCGCCCTGGGGCCCAAGTTGGGGCGCGCCGTGGCTAGAACACGGAGAGCGGCGGGCAGTGCAGCCAATGGGAGGCGGCGCTGCCTA
GCGGCTGGTAGGCGGTGCCTGCGCGGGTGTTAGGTTAGCGCGAGGCGTGACCTAGTTGACAGGCTCTGAGGTGCTGCTGTGGCGGCGTCC
GCGGGGCTGAGGCGGGTGGGAGCCGGAGCCGAGCGCGGGCTGAGGGAGGAGGGCGGCGACTGGAGAGCGGCGAGCGGCGAGCAGCGCAGG
ACGCAGAGCCTCTTTCACTTTTTCCCTGCTGAGTGCCCCCTCCCACCCCTCCCACTCCACACACACCCTGTTTGCCCGTGAGCCTGGGGA
ACTTGCAGCTTAAAGCCAGCCACCCCCACGGCAACATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTAT
TGAAGATGACCTTAGAAGAGAGACGCAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGG
GCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGTGCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACT
GGTCTGTGAACATCAAGGGTGGGACATCCCGAGCGCTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCA
AACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTGAAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTG
AACAAGTCTTAACAGATATCACCGAAGCCATTAAACTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTT
GTCTGCAAGACTTTTTTGGTGATGACGATGTTTTTATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATC
ATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCTCGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCA
GCAAATCACCAGCTTCAGTTAATGGAACTCCCAGCAGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTC
CAGGAAGTTTCAGAGGATTAAAGATTTCTGCTCATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTC
CTGAAGGTGTGAATGGAAACAGATGCTCTGAATCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTG
CAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACC
TGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCT
TTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGG
TGTACAACTTAGCCAATGCCCTCAGGTATCTCCATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAAT
ATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCA
CTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCT
GTGGATTCCCACCATTCCGAAGTGAGAACAATCTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCT
ACTGGGATAACATCACGGACTCTGCCAAGGAATTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCC
TGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATG
CGCTCCCCAAACAGAACAGCACTACCACCGGGGTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGC
ACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCC
CGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGAACCTGGCGCCGCCACCGAG

>In-frame_MACROD2_ENST00000217246_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_3680nt
GCGTGCGCCCTGGGGCCCAAGTTGGGGCGCGCCGTGGCTAGAACACGGAGAGCGGCGGGCAGTGCAGCCAATGGGAGGCGGCGCTGCCTA
GCGGCTGGTAGGCGGTGCCTGCGCGGGTGTTAGGTTAGCGCGAGGCGTGACCTAGTTGACAGGCTCTGAGGTGCTGCTGTGGCGGCGTCC
GCGGGGCTGAGGCGGGTGGGAGCCGGAGCCGAGCGCGGGCTGAGGGAGGAGGGCGGCGACTGGAGAGCGGCGAGCGGCGAGCAGCGCAGG
ACGCAGAGCCTCTTTCACTTTTTCCCTGCTGAGTGCCCCCTCCCACCCCTCCCACTCCACACACACCCTGTTTGCCCGTGAGCCTGGGGA
ACTTGCAGCTTAAAGCCAGCCACCCCCACGGCAACATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTAT
TGAAGATGACCTTAGAAGAGAGACGCAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGG
GCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGTGCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACT
GGTCTGTGAACATCAAGGGTGGGACATCCCGAGCGCTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCA
AACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTGAAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTG
AACAAGTCTTAACAGATATCACCGAAGCCATTAAACTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTT
GTCTGCAAGACTTTTTTGGTGATGACGATGTTTTTATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATC
ATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCTCGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCA
GCAAATCACCAGCTTCAGTAAAGCGGGGTGGCCACTACTCCAGTGCCTATTCTACAGCCAAATCCCCAGTTAATGGAACTCCCAGCAGCC
AACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCTCATG
GCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCAT
CAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAA
AGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGA
AACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCT
TTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCATG
GCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACT
TTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCT
ATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTCC
AGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTAA
TCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGG
AGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTCT
CCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCA
TCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACC
CTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGAACCTGGCGCCGCCACCGAGACTGAGCCTCCTGCAGACGGGCGAAGCCGCCTGCTG
CAGCCCAGGAAGCCAGCCCTCTGCTCGGCCTCGCCGGCCTCCCTGCTGCAGGCCTCCCTCTCTTCACCGCCTGCGCCTGAGTTCGCGGGT
CCTCCGCAGGCCGCCTGGGAACCGGAGCCTGGCGTGCCGGAGCCTGGCCTGGTGCTCTGGGCTCTGCCTTCTGGTTCCTGGAGGCATCAA
AGGCTGCATCCGTTCTGCCAACAGCTGTTCGGAGAGACTCGTTCCAGATCATCCCGTCATTTTCAGTTTGTTGGACATTTTACAGCTTCA
CCAGGAGAATGTGCAACTTTATTCCAGCATTCGATGCATTTTTATAGAAACACTTTGGAAACACTTTGGATGAACCAAGGCCTTTTCCTT
ATTTAAGTAGACTCAGAACACTCCCTTTCTTTTCTTTTCTCTCTCTCTCTCTCTTTTTTTTTTACGAAAGACTTAGAATTGCATTTGTCC
TTTTGTGGGTGTCCTGTGAGAGGTGATATGGGGGCTAAGAGGACTGGCTTTCTAATAGAAGAAGTGAGCGCCTGAGAGGACAATTTGGTC
ATTGGACACGGATTGCAGGCTTTGAGAAGCGCTCAGAGGCCCAGGGCGGCGGGCTCAGCCATTCGGCTTGGGGCACCAGGCTCCCCAGAG
ACAATGCTCAGTATTCATTCATACACAGACGATGGAAGAAGCCACTTCTTCCCTGGGCGGTGTGGGTTTCCCCCAGCTCTTCCCACACGT
GTGTTAGGAAATGCCCGTGAACTTGCCCTCTGGGCTTTTTAATGAGAGGCTTGGCGCATGCGGCACCCAGCGGCTGCTTCCCTGCAAGCC
AGCGACTTGCCGAGCAGAATGAGCTCTGCTCCTGAGCCCCGGTAGCTGCTTCCTCATCTGCATTTCATCTGGAGCAGGGCAGGTAACCAC
AGGAGGAGGCATGCCCGAGGCAGCCAGGACTGGGCGGGAAGGTGCTCCCTGGATATACTCTGTGAACCTTCTGGAAGGCTGCTGGCAGTT
TTTCCTTTTTGTCCACCACCCTGCTCTTTTTAATAATTGTACATAATCCGTGTATTTGTTTTACCTGCTCATCTTCTAAACTGGCGAGCC

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000296550_chr4_151023630_+_3253nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCT
CATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAA
TCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACT
GGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGA
GTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGAT
CTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTC
CATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGA
GACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACT
GGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAAT
CTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAA
TTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCC
CAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGG
GTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAG
CCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCC
CACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGAACCTGGCGCCGCCACCGAGACTGAGCCTCCTGCAGACGGGCGAAGCCGCCT
GCTGCAGCCCAGGAAGCCAGCCCTCTGCTCGGCCTCGCCGGCCTCCCTGCTGCAGGCCTCCCTCTCTTCACCGCCTGCGCCTGAGTTCGC
GGGTCCTCCGCAGGCCGCCTGGGAACCGGAGCCTGGCGTGCCGGAGCCTGGCCTGGTGCTCTGGGCTCTGCCTTCTGGTTCCTGGAGGCA
TCAAAGGCTGCATCCGTTCTGCCAACAGCTGTTCGGAGAGACTCGTTCCAGATCATCCCGTCATTTTCAGTTTGTTGGACATTTTACAGC
TTCACCAGGAGAATGTGCAACTTTATTCCAGCATTCGATGCATTTTTATAGAAACACTTTGGAAACACTTTGGATGAACCAAGGCCTTTT
CCTTATTTAAGTAGACTCAGAACACTCCCTTTCTTTTCTTTTCTCTCTCTCTCTCTCTTTTTTTTTTACGAAAGACTTAGAATTGCATTT
GTCCTTTTGTGGGTGTCCTGTGAGAGGTGATATGGGGGCTAAGAGGACTGGCTTTCTAATAGAAGAAGTGAGCGCCTGAGAGGACAATTT
GGTCATTGGACACGGATTGCAGGCTTTGAGAAGCGCTCAGAGGCCCAGGGCGGCGGGCTCAGCCATTCGGCTTGGGGCACCAGGCTCCCC
AGAGACAATGCTCAGTATTCATTCATACACAGACGATGGAAGAAGCCACTTCTTCCCTGGGCGGTGTGGGTTTCCCCCAGCTCTTCCCAC
ACGTGTGTTAGGAAATGCCCGTGAACTTGCCCTCTGGGCTTTTTAATGAGAGGCTTGGCGCATGCGGCACCCAGCGGCTGCTTCCCTGCA
AGCCAGCGACTTGCCGAGCAGAATGAGCTCTGCTCCTGAGCCCCGGTAGCTGCTTCCTCATCTGCATTTCATCTGGAGCAGGGCAGGTAA
CCACAGGAGGAGGCATGCCCGAGGCAGCCAGGACTGGGCGGGAAGGTGCTCCCTGGATATACTCTGTGAACCTTCTGGAAGGCTGCTGGC
AGTTTTTCCTTTTTGTCCACCACCCTGCTCTTTTTAATAATTGTACATAATCCGTGTATTTGTTTTACCTGCTCATCTTCTAAACTGGCG
AGCCCTATAGTTCGTTCTCATTGTTAGATTTTGCCTTTTACAAGTGTCCCCAACCTGCAATAAACTTTTCCCTCTTGAAAAAAAGTAATC

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000506325_chr4_151023630_+_2040nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTTAATGGAACTCCCAGC
AGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGTTCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGATTTCTGCTCAT
GGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAGCTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCA
TCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTCATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGA
AAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAATGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTG
AAACATCCCAATATCATTATGCTGGTCGAGGAGATGGAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTC
TTTGATGCAATTACTTCGTCGACCAAGTACACTGAGAGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCAT
GGCCTCAGCATCGTGCACAGAGACATCAAACCAGAGAATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGAC
TTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATACACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGC
TATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTGATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTC
CAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAGCTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTA
ATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGGTGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAG
GAGAATAACATGCAAGCTGAGGTGACAGGTAAACTAAAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTC
TCCGTCATCATGAACACGGCTCTAGATAAGGAGGGGCAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCC
ATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCTGTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCAC

>In-frame_MACROD2_ENST00000310348_chr20_13983050_+_DCLK2_ENST00000302176_chr4_151023630_+_3285nt
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACGCAAAGAATAC
CTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATGATGGTGAGAGTTACGTGTGT
GCATCCAATGAACCATTTCGTAAAGTCGATTACACCAAAAATATTAATCCAAACTGGTCTGTGAACATCAAGGGTGGGACATCCCGAGCG
CTGGCTGCTGCCTCCTCTGTGAAAAGTGAAGTAAAAGAAAGTAAAGATTTCATCAAACCCAAGTTAGTGACTGTGATTCGAAGTGGAGTG
AAGCCTAGAAAAGCCGTGCGGATCCTTCTGAATAAAAAGACTGCTCATTCCTTTGAACAAGTCTTAACAGATATCACCGAAGCCATTAAA
CTAGACTCAGGAGTCGTCAAGAGGCTCTGCACCCTGGATGGAAAGCAGGTTACTTGTCTGCAAGACTTTTTTGGTGATGACGATGTTTTT
ATTGCATGTGGACCAGAAAAATTTCGTTATGCCCAAGATGACTTTGTCCTGGATCATAGTGAATGTCGTGTCCTGAAGTCATCTTATTCT
CGATCCTCAGCTGTTAAGTATTCTGGATCCAAAAGCCCTGGGCCCTCTCGACGCAGCAAATCACCAGCTTCAGTAAAGCGGGGTGGCCAC
TACTCCAGTGCCTATTCTACAGCCAAATCCCCAGTTAATGGAACTCCCAGCAGCCAACTTTCTACTCCTAAATCTACGAAATCCTCCAGT
TCCTCTCCAACTAGTCCAGGAAGTTTCAGAGGATTAAAGCAGATTTCTGCTCATGGCAGATCTTCTTCCAATGTAAACGGTGGACCTGAG
CTTGACCGTTGCATAAGTCCTGAAGGTGTGAATGGAAACAGATGCTCTGAATCATCAACTCTTCTTGAGAAATACAAAATTGGAAAGGTC
ATTGGTGATGGCAATTTTGCAGTAGTCAAAGAGTGTATAGACAGGTCCACTGGAAAGGAGTTTGCCCTAAAGATTATAGACAAAGCCAAA
TGTTGTGGAAAGGAACACCTGATTGAGAATGAAGTGTCAATACTGCGCCGAGTGAAACATCCCAATATCATTATGCTGGTCGAGGAGATG
GAAACAGCAACTGAGCTCTTTCTGGTGATGGAATTGGTCAAAGGTGGAGATCTCTTTGATGCAATTACTTCGTCGACCAAGTACACTGAG
AGAGATGGCAGTGCCATGGTGTACAACTTAGCCAATGCCCTCAGGTATCTCCATGGCCTCAGCATCGTGCACAGAGACATCAAACCAGAG
AATCTCTTGGTGTGTGAATATCCTGATGGAACCAAGTCTTTGAAACTGGGAGACTTTGGGCTTGCGACTGTGGTAGAAGGCCCTTTATAC
ACAGTCTGTGGCACACCCACTTATGTGGCTCCAGAAATCATTGCTGAAACTGGCTATGGCCTGAAGGTGGACATTTGGGCAGCTGGTGTG
ATCACATACATACTTCTCTGTGGATTCCCACCATTCCGAAGTGAGAACAATCTCCAGGAAGATCTCTTCGACCAGATCTTGGCTGGGAAG
CTGGAGTTTCCGGCCCCCTACTGGGATAACATCACGGACTCTGCCAAGGAATTAATCAGTCAAATGCTTCAGGTAAATGTTGAAGCTCGG
TGTACCGCGGGACAAATCCTGAGTCACCCCTGGGTGTCAGATGATGCCTCCCAGGAGAATAACATGCAAGCTGAGGTGACAGGTAAACTA
AAACAGCACTTTAATAATGCGCTCCCCAAACAGAACAGCACTACCACCGGGGTCTCCGTCATCATGAACACGGCTCTAGATAAGGAGGGG
CAGATTTTCTGCAGCAAGCACTGTCAAGACAGCGGCAGGCCTGGGATGGAGCCCATCTCTCCAGTTCCTCCCTCAGTGGAGGAGATCCCT
GTGCCTGGGGAAGCAGTCCCGGCCCCCACCCCTCCGGAATCTCCCACCCCCCACCCTCCTCCCGCTGCCCCGGGTGGTGAGCGGGCAGGA
ACCTGGCGCCGCCACCGAGACTGAGCCTCCTGCAGACGGGCGAAGCCGCCTGCTGCAGCCCAGGAAGCCAGCCCTCTGCTCGGCCTCGCC
GGCCTCCCTGCTGCAGGCCTCCCTCTCTTCACCGCCTGCGCCTGAGTTCGCGGGTCCTCCGCAGGCCGCCTGGGAACCGGAGCCTGGCGT
GCCGGAGCCTGGCCTGGTGCTCTGGGCTCTGCCTTCTGGTTCCTGGAGGCATCAAAGGCTGCATCCGTTCTGCCAACAGCTGTTCGGAGA
GACTCGTTCCAGATCATCCCGTCATTTTCAGTTTGTTGGACATTTTACAGCTTCACCAGGAGAATGTGCAACTTTATTCCAGCATTCGAT
GCATTTTTATAGAAACACTTTGGAAACACTTTGGATGAACCAAGGCCTTTTCCTTATTTAAGTAGACTCAGAACACTCCCTTTCTTTTCT
TTTCTCTCTCTCTCTCTCTTTTTTTTTTACGAAAGACTTAGAATTGCATTTGTCCTTTTGTGGGTGTCCTGTGAGAGGTGATATGGGGGC
TAAGAGGACTGGCTTTCTAATAGAAGAAGTGAGCGCCTGAGAGGACAATTTGGTCATTGGACACGGATTGCAGGCTTTGAGAAGCGCTCA
GAGGCCCAGGGCGGCGGGCTCAGCCATTCGGCTTGGGGCACCAGGCTCCCCAGAGACAATGCTCAGTATTCATTCATACACAGACGATGG
AAGAAGCCACTTCTTCCCTGGGCGGTGTGGGTTTCCCCCAGCTCTTCCCACACGTGTGTTAGGAAATGCCCGTGAACTTGCCCTCTGGGC
TTTTTAATGAGAGGCTTGGCGCATGCGGCACCCAGCGGCTGCTTCCCTGCAAGCCAGCGACTTGCCGAGCAGAATGAGCTCTGCTCCTGA
GCCCCGGTAGCTGCTTCCTCATCTGCATTTCATCTGGAGCAGGGCAGGTAACCACAGGAGGAGGCATGCCCGAGGCAGCCAGGACTGGGC
GGGAAGGTGCTCCCTGGATATACTCTGTGAACCTTCTGGAAGGCTGCTGGCAGTTTTTCCTTTTTGTCCACCACCCTGCTCTTTTTAATA
ATTGTACATAATCCGTGTATTTGTTTTACCTGCTCATCTTCTAAACTGGCGAGCCCTATAGTTCGTTCTCATTGTTAGATTTTGCCTTTT


Top

FusionGenePPI for MACROD2_DCLK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MACROD2TERF1, TERF2DCLK2HSP90AA1, TSC22D3, ENO1, KRAS, DCTN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MACROD2_DCLK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MACROD2_DCLK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMACROD2C0004352Autistic Disorder1CTD_human
HgeneMACROD2C0023903Liver neoplasms1CTD_human
HgeneMACROD2C0236969Substance-Related Disorders1CTD_human