FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20367

FusionGeneSummary for LTBP2_NEK9

check button Fusion gene summary
Fusion gene informationFusion gene name: LTBP2_NEK9
Fusion gene ID: 20367
HgeneTgene
Gene symbol

LTBP2

NEK9

Gene ID

4054

91754

Gene namelatent transforming growth factor beta binding protein 3NIMA related kinase 9
SynonymsDASS|GPHYSD3|LTBP-3|LTBP2|STHAG6|pp6425APUG|LCCS10|NC|NERCC|NERCC1
Cytomap

11q13.1

14q24.3

Type of geneprotein-codingprotein-coding
Descriptionlatent-transforming growth factor beta-binding protein 3latent TGF beta binding protein 3serine/threonine-protein kinase Nek9NIMA (never in mitosis gene a)- related kinase 9nercc1 kinasenimA-related protein kinase 9
Modification date2018052220180522
UniProtAcc

Q14767

Q8TD19

Ensembl transtripts involved in fusion geneENST00000261978, ENST00000556690, 
ENST00000557425, 
ENST00000238616, 
ENST00000555763, 
Fusion gene scores* DoF score4 X 4 X 2=322 X 5 X 2=20
# samples 55
** MAII scorelog2(5/32*10)=0.643856189774725
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(5/20*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: LTBP2 [Title/Abstract] AND NEK9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-1315-01ALTBP2chr14

74999129

-NEK9chr14

75558181

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261978ENST00000238616LTBP2chr14

74999129

-NEK9chr14

75558181

-
5CDS-intronENST00000261978ENST00000555763LTBP2chr14

74999129

-NEK9chr14

75558181

-
In-frameENST00000556690ENST00000238616LTBP2chr14

74999129

-NEK9chr14

75558181

-
5CDS-intronENST00000556690ENST00000555763LTBP2chr14

74999129

-NEK9chr14

75558181

-
intron-3CDSENST00000557425ENST00000238616LTBP2chr14

74999129

-NEK9chr14

75558181

-
intron-intronENST00000557425ENST00000555763LTBP2chr14

74999129

-NEK9chr14

75558181

-

Top

FusionProtFeatures for LTBP2_NEK9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LTBP2

Q14767

NEK9

Q8TD19

May play an integral structural role in elastic-fiberarchitectural organization and/or assembly. Pleiotropic regulator of mitotic progression,participating in the control of spindle dynamics and chromosomeseparation. Phosphorylates different histones, myelin basicprotein, beta-casein, and BICD2. Phosphorylates histone H3 onserine and threonine residues and beta-casein on serine residues.Important for G1/S transition and S phase progression.Phosphorylates NEK6 and NEK7 and stimulates their activity byreleasing the autoinhibitory functions of Tyr-108 and Tyr-97respectively. {ECO:0000269|PubMed:12840024,ECO:0000269|PubMed:14660563, ECO:0000269|PubMed:19941817}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036187_2196621822DomainEGF-like 1
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036396_4286621822DomainEGF-like 2
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036552_6046621822DomainTB 1
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036622_6626621822DomainEGF-like 3%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036375_3776621822MotifCell attachment site
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036232_2496621822RegionNote=Heparin-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036344_3546621822RegionNote=Heparin-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-103694_1156621822RegionNote=Heparin-binding
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722892_939744980Coiled coilOntology_term=ECO:0000255
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722752_760744980Compositional biasNote=Poly-Gly
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722765_888744980Compositional biasNote=Pro/Ser/Thr-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036856_13726621822Compositional biasNote=Cys-rich
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361010_10506621822DomainEGF-like 8%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361051_10926621822DomainEGF-like 9%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361093_11346621822DomainEGF-like 10%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361135_11756621822DomainEGF-like 11%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361176_12176621822DomainEGF-like 12%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361218_12586621822DomainEGF-like 13%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361259_13026621822DomainEGF-like 14%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361303_13446621822DomainEGF-like 15%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361345_13876621822DomainEGF-like 16%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361411_14636621822DomainTB 3
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361485_15276621822DomainEGF-like 17%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361528_15676621822DomainEGF-like 18%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361584_16366621822DomainTB 4
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361733_17736621822DomainEGF-like 19%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361774_18186621822DomainEGF-like 20%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036672_7246621822DomainTB 2
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036844_8866621822DomainEGF-like 4
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036887_9296621822DomainEGF-like 5%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036930_9696621822DomainEGF-like 6%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-1036970_10096621822DomainEGF-like 7%3B calcium-binding
HgeneLTBP2chr14:74999129chr14:75558181ENST00000261978-10361639_18216621822RegionC-terminal domain
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-172252_308744980DomainProtein kinase
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-172258_66744980Nucleotide bindingATP
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722388_444744980RepeatNote=RCC1 1
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722445_498744980RepeatNote=RCC1 2
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722499_550744980RepeatNote=RCC1 3
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722551_615744980RepeatNote=RCC1 4
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722616_668744980RepeatNote=RCC1 5
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722669_726744980RepeatNote=RCC1 6


Top

FusionGeneSequence for LTBP2_NEK9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LTBP2_ENST00000261978_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_898aa
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSYPAAAAAKVYSLFREQDAPVAGLQPVERAQP
GWGSPRRPTEAEARRPSRAQQSRRVQPPAQTRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWAERSPNLRRSSAAGEGTLARAQPPAPQSPPA
PQSPPAGTLSGLSQTHPSQQHVGLSRTVRLHPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFCHLPIPQPDREPPGRGSRPRALLE
APLKQSTFTLPLSNQLASVNPSLVKVHIHHPPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLECPQGYKRLNLTHCQDINECLTLG
LCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVLFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSN
GASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACAC

>In-frame_LTBP2_ENST00000556690_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_898aa
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSYPAAAAAKVYSLFREQDAPVAGLQPVERAQP
GWGSPRRPTEAEARRPSRAQQSRRVQPPAQTRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWAERSPNLRRSSAAGEGTLARAQPPAPQSPPA
PQSPPAGTLSGLSQTHPSQQHVGLSRTVRLHPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFCHLPIPQPDREPPGRGSRPRALLE
APLKQSTFTLPLSNQLASVNPSLVKVHIHHPPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPVIENGQLECPQGYKRLNLTHCQDINECLTLG
LCKDAECVNTRGSYLCTCRPGLMLDPSRSRCVLFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSN
GASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACAC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LTBP2_ENST00000261978_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_2694nt
ATGAGGCCGCGGACCAAAGCCCGCAGCCCGGGGCGCGCCCTGCGGAACCCCTGGAGAGGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTG
GGCGCGGGTCATGCCCAAAGGGACCCCGTAGGGAGATACGAGCCGGCTGGTGGAGACGCGAATCGACTGCGGCGCCCTGGGGGCAGCTAC
CCGGCAGCGGCTGCAGCCAAGGTGTACAGTCTGTTCCGGGAGCAGGACGCGCCTGTCGCGGGCTTGCAGCCCGTGGAGCGGGCCCAGCCG
GGCTGGGGGAGCCCCAGGAGGCCCACCGAGGCGGAGGCCAGGAGGCCGTCCCGCGCGCAGCAGTCGCGGCGTGTCCAGCCACCTGCGCAG
ACCCGGAGAAGCACTCCCCTGGGCCAGCAGCAACCAGCACCCCGGACCCGGGCCGCGCCGGCTCTCCCACGCCTGGGGACCCCACAGCGG
TCTGGGGCTGCGCCCCCAACCCCGCCGCGAGGGCGGCTCACGGGGAGGAACGTCTGCGGGGGACAGTGCTGCCCAGGATGGACAACAGCA
AACAGCACCAACCACTGTATCAAACCCGTTTGCGAGCCGCCGTGCCAGAACCGGGGCTCCTGCAGCCGCCCGCAGCTCTGTGTCTGCCGC
TCTGGTTTCCGTGGAGCCCGCTGCGAGGAGGTCATTCCCGATGAGGAATTTGACCCCCAGAACTCCAGGCTGGCACCTCGACGCTGGGCC
GAGCGTTCACCCAACCTGCGCAGGAGCAGTGCGGCTGGAGAGGGCACCTTGGCCAGAGCACAGCCGCCAGCACCACAGTCGCCGCCCGCA
CCACAGTCGCCACCAGCTGGGACCCTGAGTGGCCTCAGCCAGACCCACCCTTCCCAGCAGCACGTGGGGTTGTCCCGCACTGTCCGACTT
CACCCGACTGCCACGGCCAGTAGCCAGCTCTCTTCCAACGCCCTGCCCCCGGGACCAGGCCTTGAGCAGAGAGATGGCACCCAACAGGCG
GTACCTCTGGAGCACCCCTCATCCCCCTGGGGGCTGAACCTCACGGAGAAAATCAAGAAGATCAAGATCGTCTTCACTCCCACCATCTGC
AAGCAGACCTGTGCCCGTGGACACTGTGCCAACAGCTGTGAGAGGGGCGACACCACCACCCTGTACAGCCAGGGCGGCCATGGGCACGAT
CCCAAGTCTGGCTTCCGCATCTATTTCTGCCAGATCCCCTGCCTGAACGGAGGCCGCTGCATCGGCAGGGACGAATGCTGGTGCCCCGCC
AACTCCACCGGGAAGTTCTGCCACCTGCCTATCCCGCAGCCGGACAGGGAGCCTCCAGGGAGGGGGTCCCGCCCCAGGGCCTTGCTGGAA
GCCCCACTGAAGCAGTCCACTTTCACACTGCCGCTCTCCAACCAGCTGGCCTCCGTGAACCCCTCCCTGGTGAAGGTGCACATTCACCAC
CCACCCGAGGCCTCAGTGCAGATCCACCAGGTGGCCCAGGTGCGGGGCGGGGTGGAGGAGGCCCTAGTGGAGAACAGCGTGGAGACCAGA
CCCCCGCCCTGGCTGCCTGCCAGCCCTGGCCACAGCCTCTGGGACAGCAACAACATCCCTGCTCGGTCTGGAGAGCCCCCTCGGCCACTG
CCCCCAGCAGCACCCAGGCCTCGAGGACTGCTGGGCCGGTGTTACCTGAACACTGTGAACGGACAGTGTGCCAACCCTCTGCTGGAGCTG
ACTACCCAGGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACTTTGTGTGCCCCATGCCCACCCAGACCAGCCTCCCCGGTG
ATTGAGAATGGCCAGCTGGAGTGTCCTCAGGGGTACAAGAGACTGAACCTCACTCACTGCCAAGATATCAACGAGTGCTTGACCCTGGGC
CTGTGCAAGGACGCGGAGTGTGTGAATACCAGGGGCAGCTACCTGTGCACATGCAGACCTGGCCTCATGCTGGATCCATCGCGGAGCCGC
TGTGTGTTGTTTCAGAGCTCTAGCCCGGGAGGAGGCGGCGGGGGCGGCGGTGGTGAAGAAGAGGACAGTCAGCAGGAATCTGAAACTCCT
GACCCAAGTGGAGGCTTCCGAGGAACAATGGAAGCAGACCGAGGAATGGAAGGTTTAATCAGTCCCACAGAGGCCATGGGGAACAGTAAT
GGGGCCAGCAGCTCCTGTCCTGGCTGGCTTCGAAAGGAGCTGGAAAATGCAGAATTTATCCCCATGCCTGACAGCCCATCTCCTCTCAGT
GCAGCGTTTTCAGAATCTGAGAAAGATACCCTGCCCTATGAAGAGCTGCAAGGACTCAAAGTGGCCTCTGAAGCTCCTTTGGAACACAAA
CCCCAAGTAGAAGCCTCGTCACCTCGGCTGAATCCTGCAGTAACCTGTGCTGGGAAGGGAACACCACTGACTCCTCCTGCGTGTGCGTGC
AGCTCTCTGCAGGTGGAGGTTGAGAGATTGCAGGGTCTGGTGTTAAAGTGTCTGGCTGAACAACAGAAGCTACAGCAAGAAAACCTCCAG
ATTTTTACCCAACTGCAGAAGTTGAACAAGAAATTAGAAGGAGGGCAGCAGGTGGGGATGCATTCCAAAGGAACTCAGACAGCAAAGGAA

>In-frame_LTBP2_ENST00000556690_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_2694nt
ATGAGGCCGCGGACCAAAGCCCGCAGCCCGGGGCGCGCCCTGCGGAACCCCTGGAGAGGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTG
GGCGCGGGTCATGCCCAAAGGGACCCCGTAGGGAGATACGAGCCGGCTGGTGGAGACGCGAATCGACTGCGGCGCCCTGGGGGCAGCTAC
CCGGCAGCGGCTGCAGCCAAGGTGTACAGTCTGTTCCGGGAGCAGGACGCGCCTGTCGCGGGCTTGCAGCCCGTGGAGCGGGCCCAGCCG
GGCTGGGGGAGCCCCAGGAGGCCCACCGAGGCGGAGGCCAGGAGGCCGTCCCGCGCGCAGCAGTCGCGGCGTGTCCAGCCACCTGCGCAG
ACCCGGAGAAGCACTCCCCTGGGCCAGCAGCAACCAGCACCCCGGACCCGGGCCGCGCCGGCTCTCCCACGCCTGGGGACCCCACAGCGG
TCTGGGGCTGCGCCCCCAACCCCGCCGCGAGGGCGGCTCACGGGGAGGAACGTCTGCGGGGGACAGTGCTGCCCAGGATGGACAACAGCA
AACAGCACCAACCACTGTATCAAACCCGTTTGCGAGCCGCCGTGCCAGAACCGGGGCTCCTGCAGCCGCCCGCAGCTCTGTGTCTGCCGC
TCTGGTTTCCGTGGAGCCCGCTGCGAGGAGGTCATTCCCGATGAGGAATTTGACCCCCAGAACTCCAGGCTGGCACCTCGACGCTGGGCC
GAGCGTTCACCCAACCTGCGCAGGAGCAGTGCGGCTGGAGAGGGCACCTTGGCCAGAGCACAGCCGCCAGCACCACAGTCGCCGCCCGCA
CCACAGTCGCCACCAGCTGGGACCCTGAGTGGCCTCAGCCAGACCCACCCTTCCCAGCAGCACGTGGGGTTGTCCCGCACTGTCCGACTT
CACCCGACTGCCACGGCCAGTAGCCAGCTCTCTTCCAACGCCCTGCCCCCGGGACCAGGCCTTGAGCAGAGAGATGGCACCCAACAGGCG
GTACCTCTGGAGCACCCCTCATCCCCCTGGGGGCTGAACCTCACGGAGAAAATCAAGAAGATCAAGATCGTCTTCACTCCCACCATCTGC
AAGCAGACCTGTGCCCGTGGACACTGTGCCAACAGCTGTGAGAGGGGCGACACCACCACCCTGTACAGCCAGGGCGGCCATGGGCACGAT
CCCAAGTCTGGCTTCCGCATCTATTTCTGCCAGATCCCCTGCCTGAACGGAGGCCGCTGCATCGGCAGGGACGAATGCTGGTGCCCCGCC
AACTCCACCGGGAAGTTCTGCCACCTGCCTATCCCGCAGCCGGACAGGGAGCCTCCAGGGAGGGGGTCCCGCCCCAGGGCCTTGCTGGAA
GCCCCACTGAAGCAGTCCACTTTCACACTGCCGCTCTCCAACCAGCTGGCCTCCGTGAACCCCTCCCTGGTGAAGGTGCACATTCACCAC
CCACCCGAGGCCTCAGTGCAGATCCACCAGGTGGCCCAGGTGCGGGGCGGGGTGGAGGAGGCCCTAGTGGAGAACAGCGTGGAGACCAGA
CCCCCGCCCTGGCTGCCTGCCAGCCCTGGCCACAGCCTCTGGGACAGCAACAACATCCCTGCTCGGTCTGGAGAGCCCCCTCGGCCACTG
CCCCCAGCAGCACCCAGGCCTCGAGGACTGCTGGGCCGGTGTTACCTGAACACTGTGAACGGACAGTGTGCCAACCCTCTGCTGGAGCTG
ACTACCCAGGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACTTTGTGTGCCCCATGCCCACCCAGACCAGCCTCCCCGGTG
ATTGAGAATGGCCAGCTGGAGTGTCCTCAGGGGTACAAGAGACTGAACCTCACTCACTGCCAAGATATCAACGAGTGCTTGACCCTGGGC
CTGTGCAAGGACGCGGAGTGTGTGAATACCAGGGGCAGCTACCTGTGCACATGCAGACCTGGCCTCATGCTGGATCCATCGCGGAGCCGC
TGTGTGTTGTTTCAGAGCTCTAGCCCGGGAGGAGGCGGCGGGGGCGGCGGTGGTGAAGAAGAGGACAGTCAGCAGGAATCTGAAACTCCT
GACCCAAGTGGAGGCTTCCGAGGAACAATGGAAGCAGACCGAGGAATGGAAGGTTTAATCAGTCCCACAGAGGCCATGGGGAACAGTAAT
GGGGCCAGCAGCTCCTGTCCTGGCTGGCTTCGAAAGGAGCTGGAAAATGCAGAATTTATCCCCATGCCTGACAGCCCATCTCCTCTCAGT
GCAGCGTTTTCAGAATCTGAGAAAGATACCCTGCCCTATGAAGAGCTGCAAGGACTCAAAGTGGCCTCTGAAGCTCCTTTGGAACACAAA
CCCCAAGTAGAAGCCTCGTCACCTCGGCTGAATCCTGCAGTAACCTGTGCTGGGAAGGGAACACCACTGACTCCTCCTGCGTGTGCGTGC
AGCTCTCTGCAGGTGGAGGTTGAGAGATTGCAGGGTCTGGTGTTAAAGTGTCTGGCTGAACAACAGAAGCTACAGCAAGAAAACCTCCAG
ATTTTTACCCAACTGCAGAAGTTGAACAAGAAATTAGAAGGAGGGCAGCAGGTGGGGATGCATTCCAAAGGAACTCAGACAGCAAAGGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LTBP2_ENST00000261978_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_5526nt
CCTCGCTCCCTCTCCGGTAATGAGGGGGCTGAGCTGTCCCTCCGAGGAGGGGGCCTGGTGTGGATAAAAGAGACGAAAAAGCCGGGGGAG
GTTTCCAAAAATAAAACCGTCCGGGTCCCCTTCAGACGGCTGCAGGCACAGGGAGGAGGCGCGAAGGTGCAGCAGCCGTGCGAGCCCAGC
TGGAGTAGGAGCGCGGACTCGAGGCTCGGGGCGCGCAGCCCTCGTTCCGCCGAGAGCCGGGCCCCCAGTCGGCCGCTTCAGGGCCCCCTA
GACTCAGAGAAGCTGGCCGCCGGGCGGGGCCGGGAGAACAGCCCGCGGGCGTCCAGCGTGCCGACCACAAAGCTCTTCGCGGTGCCCGCG
CGCACCACTCTCCAGCCGCCCCGCGCCATGAGGCCGCGGACCAAAGCCCGCAGCCCGGGGCGCGCCCTGCGGAACCCCTGGAGAGGCTTC
CTGCCGCTCACCCTGGCTCTCTTCGTGGGCGCGGGTCATGCCCAAAGGGACCCCGTAGGGAGATACGAGCCGGCTGGTGGAGACGCGAAT
CGACTGCGGCGCCCTGGGGGCAGCTACCCGGCAGCGGCTGCAGCCAAGGTGTACAGTCTGTTCCGGGAGCAGGACGCGCCTGTCGCGGGC
TTGCAGCCCGTGGAGCGGGCCCAGCCGGGCTGGGGGAGCCCCAGGAGGCCCACCGAGGCGGAGGCCAGGAGGCCGTCCCGCGCGCAGCAG
TCGCGGCGTGTCCAGCCACCTGCGCAGACCCGGAGAAGCACTCCCCTGGGCCAGCAGCAACCAGCACCCCGGACCCGGGCCGCGCCGGCT
CTCCCACGCCTGGGGACCCCACAGCGGTCTGGGGCTGCGCCCCCAACCCCGCCGCGAGGGCGGCTCACGGGGAGGAACGTCTGCGGGGGA
CAGTGCTGCCCAGGATGGACAACAGCAAACAGCACCAACCACTGTATCAAACCCGTTTGCGAGCCGCCGTGCCAGAACCGGGGCTCCTGC
AGCCGCCCGCAGCTCTGTGTCTGCCGCTCTGGTTTCCGTGGAGCCCGCTGCGAGGAGGTCATTCCCGATGAGGAATTTGACCCCCAGAAC
TCCAGGCTGGCACCTCGACGCTGGGCCGAGCGTTCACCCAACCTGCGCAGGAGCAGTGCGGCTGGAGAGGGCACCTTGGCCAGAGCACAG
CCGCCAGCACCACAGTCGCCGCCCGCACCACAGTCGCCACCAGCTGGGACCCTGAGTGGCCTCAGCCAGACCCACCCTTCCCAGCAGCAC
GTGGGGTTGTCCCGCACTGTCCGACTTCACCCGACTGCCACGGCCAGTAGCCAGCTCTCTTCCAACGCCCTGCCCCCGGGACCAGGCCTT
GAGCAGAGAGATGGCACCCAACAGGCGGTACCTCTGGAGCACCCCTCATCCCCCTGGGGGCTGAACCTCACGGAGAAAATCAAGAAGATC
AAGATCGTCTTCACTCCCACCATCTGCAAGCAGACCTGTGCCCGTGGACACTGTGCCAACAGCTGTGAGAGGGGCGACACCACCACCCTG
TACAGCCAGGGCGGCCATGGGCACGATCCCAAGTCTGGCTTCCGCATCTATTTCTGCCAGATCCCCTGCCTGAACGGAGGCCGCTGCATC
GGCAGGGACGAATGCTGGTGCCCCGCCAACTCCACCGGGAAGTTCTGCCACCTGCCTATCCCGCAGCCGGACAGGGAGCCTCCAGGGAGG
GGGTCCCGCCCCAGGGCCTTGCTGGAAGCCCCACTGAAGCAGTCCACTTTCACACTGCCGCTCTCCAACCAGCTGGCCTCCGTGAACCCC
TCCCTGGTGAAGGTGCACATTCACCACCCACCCGAGGCCTCAGTGCAGATCCACCAGGTGGCCCAGGTGCGGGGCGGGGTGGAGGAGGCC
CTAGTGGAGAACAGCGTGGAGACCAGACCCCCGCCCTGGCTGCCTGCCAGCCCTGGCCACAGCCTCTGGGACAGCAACAACATCCCTGCT
CGGTCTGGAGAGCCCCCTCGGCCACTGCCCCCAGCAGCACCCAGGCCTCGAGGACTGCTGGGCCGGTGTTACCTGAACACTGTGAACGGA
CAGTGTGCCAACCCTCTGCTGGAGCTGACTACCCAGGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACTTTGTGTGCCCCA
TGCCCACCCAGACCAGCCTCCCCGGTGATTGAGAATGGCCAGCTGGAGTGTCCTCAGGGGTACAAGAGACTGAACCTCACTCACTGCCAA
GATATCAACGAGTGCTTGACCCTGGGCCTGTGCAAGGACGCGGAGTGTGTGAATACCAGGGGCAGCTACCTGTGCACATGCAGACCTGGC
CTCATGCTGGATCCATCGCGGAGCCGCTGTGTGTTGTTTCAGAGCTCTAGCCCGGGAGGAGGCGGCGGGGGCGGCGGTGGTGAAGAAGAG
GACAGTCAGCAGGAATCTGAAACTCCTGACCCAAGTGGAGGCTTCCGAGGAACAATGGAAGCAGACCGAGGAATGGAAGGTTTAATCAGT
CCCACAGAGGCCATGGGGAACAGTAATGGGGCCAGCAGCTCCTGTCCTGGCTGGCTTCGAAAGGAGCTGGAAAATGCAGAATTTATCCCC
ATGCCTGACAGCCCATCTCCTCTCAGTGCAGCGTTTTCAGAATCTGAGAAAGATACCCTGCCCTATGAAGAGCTGCAAGGACTCAAAGTG
GCCTCTGAAGCTCCTTTGGAACACAAACCCCAAGTAGAAGCCTCGTCACCTCGGCTGAATCCTGCAGTAACCTGTGCTGGGAAGGGAACA
CCACTGACTCCTCCTGCGTGTGCGTGCAGCTCTCTGCAGGTGGAGGTTGAGAGATTGCAGGGTCTGGTGTTAAAGTGTCTGGCTGAACAA
CAGAAGCTACAGCAAGAAAACCTCCAGATTTTTACCCAACTGCAGAAGTTGAACAAGAAATTAGAAGGAGGGCAGCAGGTGGGGATGCAT
TCCAAAGGAACTCAGACAGCAAAGGAAGAGATGGAAATGGATCCAAAGCCTGACTTAGATTCAGATTCCTGGTGCCTCCTGGGAACAGAC
TCCTGTAGACCCAGCCTCTAGTCTCCTGAGCCTGTAGAGCCCCCAGGAGACTGGGACCCAAAGAACTTCACAGCACACTTACCGAATGCA
GAGAGCAGCTTTCCTGGCTTTGTTCACTTGCAGAAAAGGAGCGCAAGGCAGAGGCTCTGAAGCACTTTCCTTGTACATTTGGAGAGTGGC
ATTGCCTTTTAGATAGGATCTAGGAGTGATTTTATTGTTTTGGAGAATGGAAGGGCCCCCATGGCCCTGGCTTTGTCATCAGTGACTGCC
ATAGCAACAGCAGCTCTGTACCTCATCTGTTGATCCCACCTTTGAAGAGGAGACACAGTGCTCACCTTAATTGCGCTGGTAGCAGCTTAT
ATCCCATGTATCATTTTCACCATTGATTGGAAGCTGCCTTGGGAATTCAGTACCAGGCATTACCCCTCTGGGTGGGAGAGGGAGAAGTGT
AAAGTTGGAGTGGGCTGGAATCAGGTGTGGCCCGCCCAGTGTCCTCTGCAGAGTGGTGAAGTAGTCTGGCCCTCTTGGGAGCCCTGAGTC
CAGGAAAATATGTCTGATGGAGTCAATCTAGGGCTTGTTTCGAAAAAGTTCAGTTACTCTGTGCAGCTAAATGCTTTAGGAGGAAAGGTA
GGCTTAGGTTGCTTTTCCTCTGAGGGTTGATTGAAATTTCTTCAGTGAGGAATAGAGAAAGGGCAGGACCCTCCTCATCACACAGCTGGT
GTTTCAGGCTGTGACCAATGCAGGGTGGGATTTCCTAACTGTGGATGAGGGGATGAGGTGTCTCTGAGGGATGAGGTGTCTCAGAGAATT
GAGTCCATGGGGCAGTCAGAATAGCCTTAAGAGAAAATCATGAAGGAGAAGAGGTCCTCCTTTAGCTGCCTCTACTTGGTATCTTAGAGA
GGGCTTAGAGGGCTCTCAGTCTTCTGCCCATGAAAAGACTTCTTTGAGCCTCTGCCTTCATGGCTCTTAGGGTTCTGATCTTGATATCAG
CAGCCCCAACCACTTTCTTTCTGAATGTCTAGTCAGTATTTTTCCCCTTTTGGTGTTTTATGAAGCCATGTGGTAACGAATGAATCTGTA
TCATTTTTCCTACCTGAGTGGCCCAAAGCCAGCACCAAACCCTGGGAGTCCCTGAAGCCTAACAGAACAGGTAGAACTTGCAAAAGGAAT
TTGGCTGAGAGCTCACTTCTAATCCTGTACTCACTGTGTCTTTGTAGATAGAAACAAGCTAGCTTTACCAAAGAGAAATAGTGTCATAGA
AGAACAAAACTTCATATAGAAAGTTCTAGGCAAGTATTTGATGGTTTCCTTAAGGATGTGAGCTTTGTATTTCCACCTAGCCTTGTAAAA
TGTTCCTGTGGTATTTTGTGTCACACATCCTACCTTTGATGAGTCTCACATCCCACCTTCCTATAAACAGCTAAATTAATTTTGTTTCAT
CTTCCCCAGACCAAAATGTTTGATAATCTTATCAACATTGTGGGAGGTCTTGTGCAATGGAAATTTTGCCATTTCTCCAAAACTGGTGGC
ATAAAGGCTGATGCTTGGGGAGAACCCCATTGCTCGGGACAGGCAACTCTGTTCAATGGGATCTTCTTTGGTTTGATGTTCCCATTGTTT
TCTCAGTTCTGGGAAGCCTAGTACATTAGTACTAATGTAATCACTGAAACCTTTTCTTGAAATAAGGGAAGCAGCCAAACTTTGATTAAA
GTTGCAAGTTCTGGGGACTTGCGGGGGTTGTCATAAACTGTAACAGTGGGTTTTGGTTCAGCATGTAAATGCAACTTTGATTTTCTTGAG
GACCGATTGACCTGTCATGTCCCTGTATCCTCATGCTCATCATCTCAGCAGGCCTGAGAGGCTGGGTCAGTTTGGGTGTTCATCATGAGG
ATTGCTTCTGCCATGGAGCTGATGGACATGGGCAGGTTGCTGAGAAGGTGGGGTGAAAGTGAGTGCCGGGGGTGGGTGAGTGCCCTGGTC
TTGTTCATAGGGGAGCCTTTCCCTAGCAGTGGAACGCTGTGGTCATTTTCTCTAGCATATTCCCTTGGGAAGTCTAGATTTGCTATTAAT
CTGGCTGAGAATCTAAGTTCTGTGCCTTAGAGACAGTTTGCACTTTCCCATATTGTGCCTGGGACAGCCATATGATTTTTTTTCCCACCA
AACAAGTATGCAAACAGAAACCAGTTCAAAGGGGGATGGAGTAAAAGATGAGGCAGTAGAAATGCCTTTGAATGGTTTTCTGTAGCTAAT
TCTCTTTAAATTTTGTCCTGCTTTTTTTCTTTATGCAGTGCTAGGTGTTTTAAGTTTTCTAGTAGTATTGCTTTTGAGTTACAGTATAAC
CTGAGTTACTCCTCTGCTCTAACATTGTTGCAGAAGAACTAGTTTATTGTTAGCCAGGTTGCTTGAAAGGTTGAGAGTGGAGTGGTTTGG

>In-frame_LTBP2_ENST00000556690_chr14_74999129_-_NEK9_ENST00000238616_chr14_75558181_-_5267nt
AGGGCCCCCTAGACTCAGAGAAGCTGGCCGCCGGGCGGGGCCGGGAGAACAGCCCGCGGGCGTCCAGCGTGCCGACCACAAAGCTCTTCG
CGGTGCCCGCGCGCACCACTCTCCAGCCGCCCCGCGCCATGAGGCCGCGGACCAAAGCCCGCAGCCCGGGGCGCGCCCTGCGGAACCCCT
GGAGAGGCTTCCTGCCGCTCACCCTGGCTCTCTTCGTGGGCGCGGGTCATGCCCAAAGGGACCCCGTAGGGAGATACGAGCCGGCTGGTG
GAGACGCGAATCGACTGCGGCGCCCTGGGGGCAGCTACCCGGCAGCGGCTGCAGCCAAGGTGTACAGTCTGTTCCGGGAGCAGGACGCGC
CTGTCGCGGGCTTGCAGCCCGTGGAGCGGGCCCAGCCGGGCTGGGGGAGCCCCAGGAGGCCCACCGAGGCGGAGGCCAGGAGGCCGTCCC
GCGCGCAGCAGTCGCGGCGTGTCCAGCCACCTGCGCAGACCCGGAGAAGCACTCCCCTGGGCCAGCAGCAACCAGCACCCCGGACCCGGG
CCGCGCCGGCTCTCCCACGCCTGGGGACCCCACAGCGGTCTGGGGCTGCGCCCCCAACCCCGCCGCGAGGGCGGCTCACGGGGAGGAACG
TCTGCGGGGGACAGTGCTGCCCAGGATGGACAACAGCAAACAGCACCAACCACTGTATCAAACCCGTTTGCGAGCCGCCGTGCCAGAACC
GGGGCTCCTGCAGCCGCCCGCAGCTCTGTGTCTGCCGCTCTGGTTTCCGTGGAGCCCGCTGCGAGGAGGTCATTCCCGATGAGGAATTTG
ACCCCCAGAACTCCAGGCTGGCACCTCGACGCTGGGCCGAGCGTTCACCCAACCTGCGCAGGAGCAGTGCGGCTGGAGAGGGCACCTTGG
CCAGAGCACAGCCGCCAGCACCACAGTCGCCGCCCGCACCACAGTCGCCACCAGCTGGGACCCTGAGTGGCCTCAGCCAGACCCACCCTT
CCCAGCAGCACGTGGGGTTGTCCCGCACTGTCCGACTTCACCCGACTGCCACGGCCAGTAGCCAGCTCTCTTCCAACGCCCTGCCCCCGG
GACCAGGCCTTGAGCAGAGAGATGGCACCCAACAGGCGGTACCTCTGGAGCACCCCTCATCCCCCTGGGGGCTGAACCTCACGGAGAAAA
TCAAGAAGATCAAGATCGTCTTCACTCCCACCATCTGCAAGCAGACCTGTGCCCGTGGACACTGTGCCAACAGCTGTGAGAGGGGCGACA
CCACCACCCTGTACAGCCAGGGCGGCCATGGGCACGATCCCAAGTCTGGCTTCCGCATCTATTTCTGCCAGATCCCCTGCCTGAACGGAG
GCCGCTGCATCGGCAGGGACGAATGCTGGTGCCCCGCCAACTCCACCGGGAAGTTCTGCCACCTGCCTATCCCGCAGCCGGACAGGGAGC
CTCCAGGGAGGGGGTCCCGCCCCAGGGCCTTGCTGGAAGCCCCACTGAAGCAGTCCACTTTCACACTGCCGCTCTCCAACCAGCTGGCCT
CCGTGAACCCCTCCCTGGTGAAGGTGCACATTCACCACCCACCCGAGGCCTCAGTGCAGATCCACCAGGTGGCCCAGGTGCGGGGCGGGG
TGGAGGAGGCCCTAGTGGAGAACAGCGTGGAGACCAGACCCCCGCCCTGGCTGCCTGCCAGCCCTGGCCACAGCCTCTGGGACAGCAACA
ACATCCCTGCTCGGTCTGGAGAGCCCCCTCGGCCACTGCCCCCAGCAGCACCCAGGCCTCGAGGACTGCTGGGCCGGTGTTACCTGAACA
CTGTGAACGGACAGTGTGCCAACCCTCTGCTGGAGCTGACTACCCAGGAGGACTGCTGTGGCAGTGTGGGAGCCTTCTGGGGGGTGACTT
TGTGTGCCCCATGCCCACCCAGACCAGCCTCCCCGGTGATTGAGAATGGCCAGCTGGAGTGTCCTCAGGGGTACAAGAGACTGAACCTCA
CTCACTGCCAAGATATCAACGAGTGCTTGACCCTGGGCCTGTGCAAGGACGCGGAGTGTGTGAATACCAGGGGCAGCTACCTGTGCACAT
GCAGACCTGGCCTCATGCTGGATCCATCGCGGAGCCGCTGTGTGTTGTTTCAGAGCTCTAGCCCGGGAGGAGGCGGCGGGGGCGGCGGTG
GTGAAGAAGAGGACAGTCAGCAGGAATCTGAAACTCCTGACCCAAGTGGAGGCTTCCGAGGAACAATGGAAGCAGACCGAGGAATGGAAG
GTTTAATCAGTCCCACAGAGGCCATGGGGAACAGTAATGGGGCCAGCAGCTCCTGTCCTGGCTGGCTTCGAAAGGAGCTGGAAAATGCAG
AATTTATCCCCATGCCTGACAGCCCATCTCCTCTCAGTGCAGCGTTTTCAGAATCTGAGAAAGATACCCTGCCCTATGAAGAGCTGCAAG
GACTCAAAGTGGCCTCTGAAGCTCCTTTGGAACACAAACCCCAAGTAGAAGCCTCGTCACCTCGGCTGAATCCTGCAGTAACCTGTGCTG
GGAAGGGAACACCACTGACTCCTCCTGCGTGTGCGTGCAGCTCTCTGCAGGTGGAGGTTGAGAGATTGCAGGGTCTGGTGTTAAAGTGTC
TGGCTGAACAACAGAAGCTACAGCAAGAAAACCTCCAGATTTTTACCCAACTGCAGAAGTTGAACAAGAAATTAGAAGGAGGGCAGCAGG
TGGGGATGCATTCCAAAGGAACTCAGACAGCAAAGGAAGAGATGGAAATGGATCCAAAGCCTGACTTAGATTCAGATTCCTGGTGCCTCC
TGGGAACAGACTCCTGTAGACCCAGCCTCTAGTCTCCTGAGCCTGTAGAGCCCCCAGGAGACTGGGACCCAAAGAACTTCACAGCACACT
TACCGAATGCAGAGAGCAGCTTTCCTGGCTTTGTTCACTTGCAGAAAAGGAGCGCAAGGCAGAGGCTCTGAAGCACTTTCCTTGTACATT
TGGAGAGTGGCATTGCCTTTTAGATAGGATCTAGGAGTGATTTTATTGTTTTGGAGAATGGAAGGGCCCCCATGGCCCTGGCTTTGTCAT
CAGTGACTGCCATAGCAACAGCAGCTCTGTACCTCATCTGTTGATCCCACCTTTGAAGAGGAGACACAGTGCTCACCTTAATTGCGCTGG
TAGCAGCTTATATCCCATGTATCATTTTCACCATTGATTGGAAGCTGCCTTGGGAATTCAGTACCAGGCATTACCCCTCTGGGTGGGAGA
GGGAGAAGTGTAAAGTTGGAGTGGGCTGGAATCAGGTGTGGCCCGCCCAGTGTCCTCTGCAGAGTGGTGAAGTAGTCTGGCCCTCTTGGG
AGCCCTGAGTCCAGGAAAATATGTCTGATGGAGTCAATCTAGGGCTTGTTTCGAAAAAGTTCAGTTACTCTGTGCAGCTAAATGCTTTAG
GAGGAAAGGTAGGCTTAGGTTGCTTTTCCTCTGAGGGTTGATTGAAATTTCTTCAGTGAGGAATAGAGAAAGGGCAGGACCCTCCTCATC
ACACAGCTGGTGTTTCAGGCTGTGACCAATGCAGGGTGGGATTTCCTAACTGTGGATGAGGGGATGAGGTGTCTCTGAGGGATGAGGTGT
CTCAGAGAATTGAGTCCATGGGGCAGTCAGAATAGCCTTAAGAGAAAATCATGAAGGAGAAGAGGTCCTCCTTTAGCTGCCTCTACTTGG
TATCTTAGAGAGGGCTTAGAGGGCTCTCAGTCTTCTGCCCATGAAAAGACTTCTTTGAGCCTCTGCCTTCATGGCTCTTAGGGTTCTGAT
CTTGATATCAGCAGCCCCAACCACTTTCTTTCTGAATGTCTAGTCAGTATTTTTCCCCTTTTGGTGTTTTATGAAGCCATGTGGTAACGA
ATGAATCTGTATCATTTTTCCTACCTGAGTGGCCCAAAGCCAGCACCAAACCCTGGGAGTCCCTGAAGCCTAACAGAACAGGTAGAACTT
GCAAAAGGAATTTGGCTGAGAGCTCACTTCTAATCCTGTACTCACTGTGTCTTTGTAGATAGAAACAAGCTAGCTTTACCAAAGAGAAAT
AGTGTCATAGAAGAACAAAACTTCATATAGAAAGTTCTAGGCAAGTATTTGATGGTTTCCTTAAGGATGTGAGCTTTGTATTTCCACCTA
GCCTTGTAAAATGTTCCTGTGGTATTTTGTGTCACACATCCTACCTTTGATGAGTCTCACATCCCACCTTCCTATAAACAGCTAAATTAA
TTTTGTTTCATCTTCCCCAGACCAAAATGTTTGATAATCTTATCAACATTGTGGGAGGTCTTGTGCAATGGAAATTTTGCCATTTCTCCA
AAACTGGTGGCATAAAGGCTGATGCTTGGGGAGAACCCCATTGCTCGGGACAGGCAACTCTGTTCAATGGGATCTTCTTTGGTTTGATGT
TCCCATTGTTTTCTCAGTTCTGGGAAGCCTAGTACATTAGTACTAATGTAATCACTGAAACCTTTTCTTGAAATAAGGGAAGCAGCCAAA
CTTTGATTAAAGTTGCAAGTTCTGGGGACTTGCGGGGGTTGTCATAAACTGTAACAGTGGGTTTTGGTTCAGCATGTAAATGCAACTTTG
ATTTTCTTGAGGACCGATTGACCTGTCATGTCCCTGTATCCTCATGCTCATCATCTCAGCAGGCCTGAGAGGCTGGGTCAGTTTGGGTGT
TCATCATGAGGATTGCTTCTGCCATGGAGCTGATGGACATGGGCAGGTTGCTGAGAAGGTGGGGTGAAAGTGAGTGCCGGGGGTGGGTGA
GTGCCCTGGTCTTGTTCATAGGGGAGCCTTTCCCTAGCAGTGGAACGCTGTGGTCATTTTCTCTAGCATATTCCCTTGGGAAGTCTAGAT
TTGCTATTAATCTGGCTGAGAATCTAAGTTCTGTGCCTTAGAGACAGTTTGCACTTTCCCATATTGTGCCTGGGACAGCCATATGATTTT
TTTTCCCACCAAACAAGTATGCAAACAGAAACCAGTTCAAAGGGGGATGGAGTAAAAGATGAGGCAGTAGAAATGCCTTTGAATGGTTTT
CTGTAGCTAATTCTCTTTAAATTTTGTCCTGCTTTTTTTCTTTATGCAGTGCTAGGTGTTTTAAGTTTTCTAGTAGTATTGCTTTTGAGT
TACAGTATAACCTGAGTTACTCCTCTGCTCTAACATTGTTGCAGAAGAACTAGTTTATTGTTAGCCAGGTTGCTTGAAAGGTTGAGAGTG


Top

FusionGenePPI for LTBP2_NEK9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LTBP2NEK9NEK6, GABARAPL2, SSRP1, NEK7, RAN, GABARAPL1, DYNLL1, CHEK1, NSMAF, MYC, HSP90AA1, CAP1, SPDL1, MCM5, REPIN1, MDM2, HUWE1, MAFF, NTRK1, CSN2, NEK8, BICD2, MED4, XPO1, BAG3, TUBA1C, ATOH1, RNF19B, DYNLL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneNEK9chr14:74999129chr14:75558181ENST00000238616-1722732_891744980NEK6


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LTBP2_NEK9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LTBP2_NEK9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLTBP2C0017601Glaucoma2CTD_human;HPO
HgeneLTBP2C3553785WEILL-MARCHESANI SYNDROME 31UNIPROT
TgeneNEK9C3280309ARTHROGRYPOSIS, PERTHES DISEASE, AND UPWARD GAZE PALSY1UNIPROT