FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20364

FusionGeneSummary for LTBP1_ZDHHC2

check button Fusion gene summary
Fusion gene informationFusion gene name: LTBP1_ZDHHC2
Fusion gene ID: 20364
HgeneTgene
Gene symbol

LTBP1

ZDHHC2

Gene ID

4052

51201

Gene namelatent transforming growth factor beta binding protein 1zinc finger DHHC-type containing 2
Synonyms-DHHC2|ZNF372
Cytomap

2p22.3

8p22

Type of geneprotein-codingprotein-coding
Descriptionlatent-transforming growth factor beta-binding protein 1LTBP-1TGF-beta1-BP-1transforming growth factor beta-1-binding protein 1palmitoyltransferase ZDHHC2DHHC-2reamrecreduced expression associated with metastasis proteinreduced expression in cancer proteintestis tissue sperm-binding protein Li 56ezinc finger DHHC domain-containing protein 2zinc finger protein 372zinc fin
Modification date2018052220180523
UniProtAcc

Q14766

Q9UIJ5

Ensembl transtripts involved in fusion geneENST00000404816, ENST00000354476, 
ENST00000390003, ENST00000418533, 
ENST00000402934, ENST00000404525, 
ENST00000407925, ENST00000272273, 
ENST00000498013, 
ENST00000262096, 
Fusion gene scores* DoF score8 X 7 X 9=5045 X 5 X 4=100
# samples 155
** MAII scorelog2(15/504*10)=-1.74846123300404
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LTBP1 [Title/Abstract] AND ZDHHC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneZDHHC2

GO:0018345

protein palmitoylation

23034182


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AR-A0TU-01ALTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000404816ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000354476ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000390003ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000418533ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000402934ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000404525ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000407925ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
In-frameENST00000272273ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+
intron-3CDSENST00000498013ENST00000262096LTBP1chr2

33540336

+ZDHHC2chr8

17042298

+

Top

FusionProtFeatures for LTBP1_ZDHHC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LTBP1

Q14766

ZDHHC2

Q9UIJ5

May be involved in the assembly, secretion and targetingof TGFB1 to sites at which it is stored and/or activated. May playcritical roles in controlling and directing the activity of TGFB1.May have a structural role in the extracellular matrix (ECM). Palmitoyltransferase specific for GAP43 and DLG4/PSD95.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434100_13012441723Compositional biasNote=Pro-rich
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030100_1309181397Compositional biasNote=Pro-rich
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030100_1308641343Compositional biasNote=Pro-rich
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434100_13012431722Compositional biasNote=Pro-rich
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030100_1309171396Compositional biasNote=Pro-rich
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341038_107812441723DomainEGF-like 8%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341079_111912441723DomainEGF-like 9%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341120_116012441723DomainEGF-like 10%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341161_120112441723DomainEGF-like 11%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341202_124312441723DomainEGF-like 12%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434187_21912441723DomainEGF-like 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434399_43112441723DomainEGF-like 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434557_60912441723DomainTB 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434626_66312441723DomainEGF-like 3%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434677_72912441723DomainTB 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434873_91012441723DomainEGF-like 4%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434915_95612441723DomainEGF-like 5%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434957_99712441723DomainEGF-like 6%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+2434998_103712441723DomainEGF-like 7%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030187_2199181397DomainEGF-like 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030399_4319181397DomainEGF-like 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030557_6099181397DomainTB 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030626_6639181397DomainEGF-like 3%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030677_7299181397DomainTB 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030873_9109181397DomainEGF-like 4%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030187_2198641343DomainEGF-like 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030399_4318641343DomainEGF-like 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030557_6098641343DomainTB 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030626_6638641343DomainEGF-like 3%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030677_7298641343DomainTB 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341038_107812431722DomainEGF-like 8%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341079_111912431722DomainEGF-like 9%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341120_116012431722DomainEGF-like 10%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341161_120112431722DomainEGF-like 11%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341202_124312431722DomainEGF-like 12%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434187_21912431722DomainEGF-like 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434399_43112431722DomainEGF-like 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434557_60912431722DomainTB 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434626_66312431722DomainEGF-like 3%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434677_72912431722DomainTB 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434873_91012431722DomainEGF-like 4%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434915_95612431722DomainEGF-like 5%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434957_99712431722DomainEGF-like 6%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+2434998_103712431722DomainEGF-like 7%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030187_2199171396DomainEGF-like 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030399_4319171396DomainEGF-like 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030557_6099171396DomainTB 1
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030626_6639171396DomainEGF-like 3%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030677_7299171396DomainTB 2
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030873_9109171396DomainEGF-like 4%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341174_117612441723MotifCell attachment site
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341174_117612431722MotifCell attachment site
TgeneZDHHC2chr2:33540336chr8:17042298ENST00000262096+013127_177431607DomainDHHC
TgeneZDHHC2chr2:33540336chr8:17042298ENST00000262096+013171_191431607TransmembraneHelical
TgeneZDHHC2chr2:33540336chr8:17042298ENST00000262096+013209_229431607TransmembraneHelical
TgeneZDHHC2chr2:33540336chr8:17042298ENST00000262096+01355_75431607TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341244_128112441723DomainEGF-like 13%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341286_132812441723DomainEGF-like 14%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341347_140112441723DomainTB 3
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341424_146612441723DomainEGF-like 15%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341467_150312441723DomainEGF-like 16%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341524_157712441723DomainTB 4
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341621_165712441723DomainEGF-like 17
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341662_170612441723DomainEGF-like 18%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301038_10789181397DomainEGF-like 8%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301079_11199181397DomainEGF-like 9%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301120_11609181397DomainEGF-like 10%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301161_12019181397DomainEGF-like 11%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301202_12439181397DomainEGF-like 12%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301244_12819181397DomainEGF-like 13%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301286_13289181397DomainEGF-like 14%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301347_14019181397DomainTB 3
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301424_14669181397DomainEGF-like 15%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301467_15039181397DomainEGF-like 16%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301524_15779181397DomainTB 4
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301621_16579181397DomainEGF-like 17
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301662_17069181397DomainEGF-like 18%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030915_9569181397DomainEGF-like 5%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030957_9979181397DomainEGF-like 6%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+2030998_10379181397DomainEGF-like 7%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301038_10788641343DomainEGF-like 8%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301079_11198641343DomainEGF-like 9%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301120_11608641343DomainEGF-like 10%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301161_12018641343DomainEGF-like 11%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301202_12438641343DomainEGF-like 12%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301244_12818641343DomainEGF-like 13%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301286_13288641343DomainEGF-like 14%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301347_14018641343DomainTB 3
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301424_14668641343DomainEGF-like 15%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301467_15038641343DomainEGF-like 16%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301524_15778641343DomainTB 4
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301621_16578641343DomainEGF-like 17
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301662_17068641343DomainEGF-like 18%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030873_9108641343DomainEGF-like 4%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030915_9568641343DomainEGF-like 5%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030957_9978641343DomainEGF-like 6%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+2030998_10378641343DomainEGF-like 7%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341244_128112431722DomainEGF-like 13%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341286_132812431722DomainEGF-like 14%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341347_140112431722DomainTB 3
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341424_146612431722DomainEGF-like 15%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341467_150312431722DomainEGF-like 16%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341524_157712431722DomainTB 4
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341621_165712431722DomainEGF-like 17
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341662_170612431722DomainEGF-like 18%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301038_10789171396DomainEGF-like 8%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301079_11199171396DomainEGF-like 9%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301120_11609171396DomainEGF-like 10%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301161_12019171396DomainEGF-like 11%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301202_12439171396DomainEGF-like 12%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301244_12819171396DomainEGF-like 13%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301286_13289171396DomainEGF-like 14%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301347_14019171396DomainTB 3
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301424_14669171396DomainEGF-like 15%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301467_15039171396DomainEGF-like 16%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301524_15779171396DomainTB 4
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301621_16579171396DomainEGF-like 17
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301662_17069171396DomainEGF-like 18%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030915_9569171396DomainEGF-like 5%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030957_9979171396DomainEGF-like 6%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+2030998_10379171396DomainEGF-like 7%3B calcium-binding
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301174_11769181397MotifCell attachment site
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301174_11768641343MotifCell attachment site
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301174_11769171396MotifCell attachment site
HgeneLTBP1chr2:33540336chr8:17042298ENST00000354476+24341507_172112441723RegionC-terminal domain
HgeneLTBP1chr2:33540336chr8:17042298ENST00000390003+20301507_17219181397RegionC-terminal domain
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404525+20301507_17218641343RegionC-terminal domain
HgeneLTBP1chr2:33540336chr8:17042298ENST00000404816+24341507_172112431722RegionC-terminal domain
HgeneLTBP1chr2:33540336chr8:17042298ENST00000407925+20301507_17219171396RegionC-terminal domain
TgeneZDHHC2chr2:33540336chr8:17042298ENST00000262096+01317_37431607TransmembraneHelical


Top

FusionGeneSequence for LTBP1_ZDHHC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LTBP1_ENST00000404816_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1568aa
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNARYSRSSAAAGAPSRASPGVPSERTRRTSKP
GGAALQGLRPPPPPPPEPARPAVPGGQLHPNPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMT
LTLKPKPSVGLPQQIHSQVTPLSSQSVVIHHGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRTVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPG
KALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSTHGYNQMMECLPGTKRVNNTFCQDINEC
QLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGTTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPS
LDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRTTCIC
YEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRM
TQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDI
DECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKS
VCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEVSMENTGEQVVCLMATH
LLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLPITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCI
LKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNK
STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRE

>In-frame_LTBP1_ENST00000354476_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1569aa
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNARYSRSSAAAGAPSRASPGVPSERTRRTSKP
GGAALQGLRPPPPPPPEPARPAVPGGQLHPNPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMT
LTLKPKPSVGLPQQIHSQVTPLSSQSVVIHHGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRTVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPG
KALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSTHGYNQMMECLPGTKRVNNTFCQDINEC
QLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGTTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPS
LDQEKTKLEPGQPQLSPGISTIHLHPQFPGIVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRTTCI
CYEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYR
MTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRD
IDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDK
SVCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEVSMENTGEQVVCLMAT
HLLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLPITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKC
ILKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKN
KSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLR

>In-frame_LTBP1_ENST00000390003_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1243aa
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSR
DKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQK
CPKKPSTHGYNQMMECLPGTKRVNNTFCQDINECQLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGTTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPA
KEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPGIVIEKTSPPVPVEVAPEASTSSASQV
IAPTQVTEINECTVNPDICGAGHCINLPVRTTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNC
IDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEP
NVCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQC
RNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSF
HCVCQQGFSISADGRTCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDL
PITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDT
QAKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPT

>In-frame_LTBP1_ENST00000418533_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1242aa
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSR
DKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQK
CPKKPSTHGYNQMMECLPGTKRVNNTFCQDINECQLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGTTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPA
KEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRTTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCI
DVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPN
VCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCR
NTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFH
CVCQQGFSISADGRTCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLP
ITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQ
AKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTC

>In-frame_LTBP1_ENST00000402934_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1189aa
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSR
DKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQK
CPKKPSTHGYNQMMECLPGTKRVNNTFCQDINECQLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGI
STIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRTTCICYEGYRFSEQQRKCVDIDEC
TQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCP
DEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEG
SFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCP
DGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPM
NPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLPITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNT
KFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNG
FSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINP

>In-frame_LTBP1_ENST00000404525_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1189aa
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSR
DKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQK
CPKKPSTHGYNQMMECLPGTKRVNNTFCQDINECQLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGI
STIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRTTCICYEGYRFSEQQRKCVDIDEC
TQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCP
DEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEG
SFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCP
DGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPM
NPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLPITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNT
KFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNG
FSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINP

>In-frame_LTBP1_ENST00000407925_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1242aa
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSR
DKCQCPPNFTGKLCQIPVHGASVPKLTQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQK
CPKKPSTHGYNQMMECLPGTKRVNNTFCQDINECQLQGVCPNGECLNTMGSTRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGTTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPA
KEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRTTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCI
DVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPN
VCANGDCSNLEGSYMCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCR
NTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFH
CVCQQGFSISADGRTCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLP
ITTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQ
AKFHIMFLFFAAAMFSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTC

>In-frame_LTBP1_ENST00000272273_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_508aa
MCSCHKGTTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGY
RASGLGDHCEDINECLEDKSVCQRGDCINTAGSTDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGR
TCEVSMENTGEQVVCLMATHLLFAMFVWSYWKTIFTLPMNPSKEFHLSTAEKDLLEREPRGEAHQEVLRRAAKDLPITTRTMSGAIRYCD
RCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNTKFFLLFLATSLLYCLFIAATDLQTFIKFWTNGLPDTQAKFHIMFLFFAAAM
FSVSLSSLFGTHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQDPEQASTPAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LTBP1_ENST00000404816_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_4704nt
ATGGCGGGGGCCTGGCTCAGGTGGGGGCTCCTGCTCTGGGCAGGGCTCCTCGCGTCCTCGGCGCACGGCCGGCTGCGGAGGATCACCTAC
GTGGTGCACCCGGGCCCCGGCCTGGCAGCCGGCGCCTTGCCCCTGAGCGGGCCCCCGCGTTCGCGGACATTCAACGTCGCGCTCAACGCC
AGGTACAGCCGCAGCTCGGCGGCTGCCGGCGCCCCCAGCCGTGCCTCCCCCGGGGTCCCCTCGGAGAGGACCCGGCGCACGAGCAAGCCG
GGCGGCGCGGCCCTGCAGGGGCTCAGACCGCCGCCGCCGCCGCCGCCGGAGCCTGCGCGTCCCGCGGTCCCCGGCGGGCAGCTCCACCCC
AATCCCGGCGGCCACCCGGCAGCCGCCCCGTTCACCAAACAAGGCAGGCAAGTTGTGCGCTCCAAGGTGCCGCAGGAGACCCAGAGCGGC
GGAGGCTCTAGGCTGCAGGTTCACCAGAAGCAGCAGCTGCAGGGGGTCAATGTCTGTGGAGGGCGGTGCTGTCATGGCTGGAGTAAGGCC
CCTGGCTCCCAGAGGTGCACCAAACCTAGCTGTGTTCCGCCATGTCAGAATGGAGGGATGTGTCTCCGGCCACAACTCTGTGTGTGTAAA
CCAGGGACCAAGGGCAAAGCCTGTGAAACAATAGCTGCCCAGGACACCTCGTCACCAGTCTTTGGAGGGCAGAGTCCTGGGGCTGCTTCC
TCGTGGGGCCCTCCTGAGCAAGCAGCAAAGCATACTTCATCTAAGAAGGCAGACACTCTACCAAGAGTCAGCCCTGTGGCCCAGATGACC
TTAACCCTCAAGCCGAAGCCTTCAGTGGGACTCCCCCAGCAGATACATTCTCAAGTGACTCCTCTTTCTTCCCAGAGTGTGGTGATTCAC
CATGGCCAGACCCAGGAATACGTGCTCAAGCCCAAGTACTTTCCAGCCCAGAAGGGGATTTCAGGAGAGCAGTCCACTGAAGGTTCTTTC
CCTTTAAGATATGTGCAGGATCAAGTTGCGGCACCTTTTCAGCTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATC
TGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCTGCC
GACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAG
TGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGC
AAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCT
AACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAG
ACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCAC
CAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAA
GCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAA
CCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAATGT
CAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGATCCT
ACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATG
CACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCA
GGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTA
GGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAGCCA
GTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCA
TTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGTA
GTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAA
GTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGC
TACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGC
TGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAA
TGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATG
ACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTAC
CAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAAT
GGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATT
GATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAG
CTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGC
TCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGT
GTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGT
CAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAG
CAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCAT
CTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCA
GAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGG
ACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATT
TTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTG
CTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCAT
ATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAA
TCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAA
GTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAG
GATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAG
TCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCA

>In-frame_LTBP1_ENST00000354476_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_4707nt
ATGGCGGGGGCCTGGCTCAGGTGGGGGCTCCTGCTCTGGGCAGGGCTCCTCGCGTCCTCGGCGCACGGCCGGCTGCGGAGGATCACCTAC
GTGGTGCACCCGGGCCCCGGCCTGGCAGCCGGCGCCTTGCCCCTGAGCGGGCCCCCGCGTTCGCGGACATTCAACGTCGCGCTCAACGCC
AGGTACAGCCGCAGCTCGGCGGCTGCCGGCGCCCCCAGCCGTGCCTCCCCCGGGGTCCCCTCGGAGAGGACCCGGCGCACGAGCAAGCCG
GGCGGCGCGGCCCTGCAGGGGCTCAGACCGCCGCCGCCGCCGCCGCCGGAGCCTGCGCGTCCCGCGGTCCCCGGCGGGCAGCTCCACCCC
AATCCCGGCGGCCACCCGGCAGCCGCCCCGTTCACCAAACAAGGCAGGCAAGTTGTGCGCTCCAAGGTGCCGCAGGAGACCCAGAGCGGC
GGAGGCTCTAGGCTGCAGGTTCACCAGAAGCAGCAGCTGCAGGGGGTCAATGTCTGTGGAGGGCGGTGCTGTCATGGCTGGAGTAAGGCC
CCTGGCTCCCAGAGGTGCACCAAACCTAGCTGTGTTCCGCCATGTCAGAATGGAGGGATGTGTCTCCGGCCACAACTCTGTGTGTGTAAA
CCAGGGACCAAGGGCAAAGCCTGTGAAACAATAGCTGCCCAGGACACCTCGTCACCAGTCTTTGGAGGGCAGAGTCCTGGGGCTGCTTCC
TCGTGGGGCCCTCCTGAGCAAGCAGCAAAGCATACTTCATCTAAGAAGGCAGACACTCTACCAAGAGTCAGCCCTGTGGCCCAGATGACC
TTAACCCTCAAGCCGAAGCCTTCAGTGGGACTCCCCCAGCAGATACATTCTCAAGTGACTCCTCTTTCTTCCCAGAGTGTGGTGATTCAC
CATGGCCAGACCCAGGAATACGTGCTCAAGCCCAAGTACTTTCCAGCCCAGAAGGGGATTTCAGGAGAGCAGTCCACTGAAGGTTCTTTC
CCTTTAAGATATGTGCAGGATCAAGTTGCGGCACCTTTTCAGCTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATC
TGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCTGCC
GACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAG
TGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGC
AAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCT
AACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAG
ACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCAC
CAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAA
GCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAA
CCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAATGT
CAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGATCCT
ACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATG
CACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCA
GGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTA
GGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAGCCA
GTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCA
TTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGGT
ATAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACT
CAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATA
TGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGC
CGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGAC
GAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGC
ATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCT
TACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCA
AATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGAT
ATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTAC
CAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAG
GGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAG
AGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACA
TGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGC
CAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTAT
CATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTAT
GCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACC
AGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGT
ATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCT
CTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTC
CATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAAT
AAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGA
CAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAAC
CAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGA
GAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCT

>In-frame_LTBP1_ENST00000390003_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_3729nt
ATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTT
ACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAAT
GGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGG
GACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCC
CAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTG
AAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCA
ACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCC
ACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCA
CAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAA
TGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGAT
ATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTT
GGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGA
AGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAA
TGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATC
CATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCC
AAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAG
GAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCA
CAGTTTCCAGGTATAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTG
ATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGA
TATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTC
TGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGC
ATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGAC
AGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAAT
TCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCA
AACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAG
CACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGT
GGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGC
AGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGC
TTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGAT
GACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTC
CATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGC
CTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTC
CATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTT
CCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTC
TGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTC
TTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACT
CAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTA
GTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGT
AAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACT
TGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCA
AAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGT

>In-frame_LTBP1_ENST00000418533_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_3726nt
ATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTT
ACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAAT
GGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGG
GACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCC
CAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTG
AAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCA
ACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCC
ACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCA
CAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAA
TGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGAT
ATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTT
GGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGA
AGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAA
TGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATC
CATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCC
AAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAG
GAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCA
CAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATT
GCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATAT
ACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGC
TCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATA
GATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGC
GGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCT
CCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAAC
GTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCAC
TGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGA
CAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGG
AACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTG
GAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGAC
AATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCAT
TGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTG
ATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCAT
CTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCC
ATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGT
GATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTG
GCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAA
GCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTC
AGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAA
AACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGC
CTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAG
CCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATG

>In-frame_LTBP1_ENST00000402934_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_3567nt
ATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTT
ACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAAT
GGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGG
GACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCC
CAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTG
AAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCA
ACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCC
ACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCA
CAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAA
TGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGAT
ATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTT
GGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGA
AGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAA
TGTCCCCTTCCAGGCACAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTG
GCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATT
TCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACG
TCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGC
ATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGT
ACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGT
GAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTC
CGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCA
GATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTG
GACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACC
CGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGC
TCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTC
TGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGT
GAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCG
GATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTA
AACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACT
GGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATG
AATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGG
CGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGC
TGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTAT
AAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACA
AATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTT
GGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGA
TTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGAT
GGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAA
AACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCA

>In-frame_LTBP1_ENST00000404525_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_3567nt
ATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTT
ACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAAT
GGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGG
GACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCC
CAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTG
AAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCA
ACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCC
ACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCA
CAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAA
TGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGAT
ATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTT
GGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGA
AGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAA
TGTCCCCTTCCAGGCACAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTG
GCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATT
TCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACG
TCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGC
ATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGT
ACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGT
GAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTC
CGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCA
GATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTG
GACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACC
CGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGC
TCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTC
TGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGT
GAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCG
GATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTA
AACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACT
GGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATG
AATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGG
CGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGC
TGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTAT
AAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACA
AATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTT
GGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGA
TTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGAT
GGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAA
AACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCA

>In-frame_LTBP1_ENST00000407925_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_3726nt
ATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTT
ACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAAT
GGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGG
GACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCC
CAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTG
AAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCA
ACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCC
ACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCA
CAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAA
TGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGAT
ATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTT
GGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGA
AGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAA
TGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATC
CATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCC
AAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAG
GAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCA
CAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATT
GCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATAT
ACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGC
TCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATA
GATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGC
GGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCT
CCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAAC
GTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCAC
TGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGA
CAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGG
AACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTG
GAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGAC
AATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCAT
TGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTG
ATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCAT
CTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCC
ATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGT
GATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTG
GCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAA
GCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTC
AGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAA
AACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGC
CTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAG
CCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATG

>In-frame_LTBP1_ENST00000272273_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_1524nt
ATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTA
AACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGAC
ATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTAC
AGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACT
GCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGG
CTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGT
ACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATAC
TGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGA
GGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGAC
AGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTG
AACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGAT
TTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATG
TTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTA
TTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTG
CTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGG
CTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LTBP1_ENST00000404816_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_9635nt
CGCTCGCTCTCGGCCACCCTCGCCGGGCCCCGCTGCGGCGCGCGCTGCAACCCCCGGCCGGACGCGCGGACCCTCACCTTGCGCGGCCCG
CTCCCCTCGCCCCTCCCCGCTCCCCGGGCTCCGCGCTCCCCACCCCCACGCCCTCCTCCTGCTCCCAGCCACAATCGGCCGGGGTCTGGG
GCCGCTCAGCTGCCCGCAGAGCCTCCTCCCTCGCCACCGACTTGGTCTCCTCCCGCCTTTCCCGGGCTCTCGGCAGCTCTCGGGGGAGCC
CGAACGCGCGGGGAAAGGCGAGCCGCACGGCCGGGGGAGGGGGCCGGACCGCGCGCGACCGGTCGCGCCCGCTGGGGCCCGCGATGGCGG
GGGCCTGGCTCAGGTGGGGGCTCCTGCTCTGGGCAGGGCTCCTCGCGTCCTCGGCGCACGGCCGGCTGCGGAGGATCACCTACGTGGTGC
ACCCGGGCCCCGGCCTGGCAGCCGGCGCCTTGCCCCTGAGCGGGCCCCCGCGTTCGCGGACATTCAACGTCGCGCTCAACGCCAGGTACA
GCCGCAGCTCGGCGGCTGCCGGCGCCCCCAGCCGTGCCTCCCCCGGGGTCCCCTCGGAGAGGACCCGGCGCACGAGCAAGCCGGGCGGCG
CGGCCCTGCAGGGGCTCAGACCGCCGCCGCCGCCGCCGCCGGAGCCTGCGCGTCCCGCGGTCCCCGGCGGGCAGCTCCACCCCAATCCCG
GCGGCCACCCGGCAGCCGCCCCGTTCACCAAACAAGGCAGGCAAGTTGTGCGCTCCAAGGTGCCGCAGGAGACCCAGAGCGGCGGAGGCT
CTAGGCTGCAGGTTCACCAGAAGCAGCAGCTGCAGGGGGTCAATGTCTGTGGAGGGCGGTGCTGTCATGGCTGGAGTAAGGCCCCTGGCT
CCCAGAGGTGCACCAAACCTAGCTGTGTTCCGCCATGTCAGAATGGAGGGATGTGTCTCCGGCCACAACTCTGTGTGTGTAAACCAGGGA
CCAAGGGCAAAGCCTGTGAAACAATAGCTGCCCAGGACACCTCGTCACCAGTCTTTGGAGGGCAGAGTCCTGGGGCTGCTTCCTCGTGGG
GCCCTCCTGAGCAAGCAGCAAAGCATACTTCATCTAAGAAGGCAGACACTCTACCAAGAGTCAGCCCTGTGGCCCAGATGACCTTAACCC
TCAAGCCGAAGCCTTCAGTGGGACTCCCCCAGCAGATACATTCTCAAGTGACTCCTCTTTCTTCCCAGAGTGTGGTGATTCACCATGGCC
AGACCCAGGAATACGTGCTCAAGCCCAAGTACTTTCCAGCCCAGAAGGGGATTTCAGGAGAGCAGTCCACTGAAGGTTCTTTCCCTTTAA
GATATGTGCAGGATCAAGTTGCGGCACCTTTTCAGCTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATCTGTAAAG
TGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCTGCCGACACCC
TGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTC
CAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGCAAGGCGT
TGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAG
TCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAGACAAAAG
AAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGG
TCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAAGCGCTCC
CTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAACCATCTT
ATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAATGTCAGCTAC
AAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGATCCTACCTTTT
CAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGCACCCTC
TGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCAGGCACAG
CTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTAGGTAAAG
GACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAGCCAGTGGAGG
CCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATC
AAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTG
AAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAG
AAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGG
GCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAA
ACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGA
GGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGA
GAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCG
TTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATT
GTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAAT
GTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGG
CAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTC
AATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCC
AGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATA
TTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTT
TCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTT
TTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAG
ATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGT
CTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGA
TGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACT
GCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGT
TTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACAT
TAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTG
GTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTG
AACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGA
GCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATTAACCA
TGGAAAATGAGACTTAACTCTTCAAGCAAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCCCACAG
GAAGGTGCCACCAGTCAGTTGTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCTTAAAA
TATAACATGTTTTGGATCCAATACACACATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAATCAAC
GGGGAAAACATCTTCTCCAAAAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACATAGAAA
CTCCATTAATCATCTGATTTTCCGAATCTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAATGATAA
GCATTATTCATAAAACTTGTTACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCTCAGAC
TGAGTGAACTGTAATAATTATGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAATTCCA
GCCTTTTGTTTTCTGCTGGAAAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATACGGTA
CATTTCTATTACATCAGAAATATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTTATGAC
ATTCTTTTGTCAGTTTGGCTTTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTAAGAAT
TCCTAATAGGTCAATAGATTTACCCTCCAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATATTTTT
CCTTAAACACCTATTACAGTTAAATTATGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAAAATGG
CATGCTATTTGGAAATTTAGTTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTGTGCCT
TGTATGCACTATTTAAAAAAAGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTATGCTTT
TTTGATACTGATTTTGAGAATTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAATGGTAA
TAAACTTTTCAAAATCTTTGTTAAACCAAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTGCAATT
ACTTATCCTTCCTAAAAATATAGTTTTATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGTGCAAT
TCTTTGAACAATAGAAATATCTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATCTCAGA
AAATATGATAACATTTTAACTTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAGCTACT
GCTAGAAGTCTTAAAAAAACCAACAGCAGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAA
AGCACAGTACTGTTAGCTGTTTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGGATTTT
TATCCTTTACTCTTCTAGAGTACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAATCAGAT
TTGAAAAAGTTAAAACAATTTCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTTTTGTT
TTGAATTATAGGAGTTATAATCTTTGGAGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGCTAAAT
AAATAGATCTACATTTTGTACATATTTATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTTGAAGA
CACATACTTCAACTGTCCTTATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAAGATTT
AAGAAATTTTGCATTAAAAATAGTGTACCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTCAAAGA
TATATTAAAGAACAGTTGCATCTGAATATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTAATAAA
GTGGTTGATCACCTACATTATCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAATAGTTT
ATTAGAGCTACTAATGGCAAAATTCATGTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTTACTTT
GTAGTAGTTAAGTGATTCTGAGGACAATTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATATGGCA
TATGTTGACAAACACTTAACTAGGGAAATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCTTCAAG
AAAATATATGAAAAAAGTGTTACTCCATTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCTGATTC
TGAAATTGTACTGTATCATTTGGTATTTACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAACATAG
ATACAAACCTCAGAAAATGGTAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACACACCT
AGACTACAGATTCTGATCTGTGAATATTTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATATCTTTC
TGCAGAAACGTGTTCTTCTAAAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTTCAGCA
CCGATTTCCTCTTATATGTGGAAGGAGACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCACTGTC
TTGGTAAAAATTCCTAGATTCTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGCCAACA
TTAACCTAGATTTTACAACTGAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAGAACAC
AGGAAATTGTTAAACCTTATAATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCCTGGCT
TGTAAACAGTGGACATCACTGAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGTATCTC
CCAGAACAATGTTGAGTGTTTCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATGTGAGC
AAAGAACTATGATGATGCAGTCCAGGTATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTCAAATA
CAATAACCTGGGCAATGCCAACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAACTGGTG
AAAAATGTTCAAAAATAGATCTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTGTTAAG
GCTAATCATCTGAGTGATTTGAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTTCCCTT
TTGCTCAGGAAAAATAGTACTACTTTATGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAAGGAGC
TGAATCCTACCTGAAATTATTAATGCTTAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCATAATG
CTTCAAGGTAAAATTCCGTTGATTCTGAATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATGAGAGC
AAGGCTATTTTGTCAGTTTAGATTTTGTGTCTTTTTCTGTCAGTATGTATGGCTCCCTAATTGAAAACATCTTAAATGAACTAATCAAAC

>In-frame_LTBP1_ENST00000354476_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_9308nt
GGTCGCGCCCGCTGGGGCCCGCGATGGCGGGGGCCTGGCTCAGGTGGGGGCTCCTGCTCTGGGCAGGGCTCCTCGCGTCCTCGGCGCACG
GCCGGCTGCGGAGGATCACCTACGTGGTGCACCCGGGCCCCGGCCTGGCAGCCGGCGCCTTGCCCCTGAGCGGGCCCCCGCGTTCGCGGA
CATTCAACGTCGCGCTCAACGCCAGGTACAGCCGCAGCTCGGCGGCTGCCGGCGCCCCCAGCCGTGCCTCCCCCGGGGTCCCCTCGGAGA
GGACCCGGCGCACGAGCAAGCCGGGCGGCGCGGCCCTGCAGGGGCTCAGACCGCCGCCGCCGCCGCCGCCGGAGCCTGCGCGTCCCGCGG
TCCCCGGCGGGCAGCTCCACCCCAATCCCGGCGGCCACCCGGCAGCCGCCCCGTTCACCAAACAAGGCAGGCAAGTTGTGCGCTCCAAGG
TGCCGCAGGAGACCCAGAGCGGCGGAGGCTCTAGGCTGCAGGTTCACCAGAAGCAGCAGCTGCAGGGGGTCAATGTCTGTGGAGGGCGGT
GCTGTCATGGCTGGAGTAAGGCCCCTGGCTCCCAGAGGTGCACCAAACCTAGCTGTGTTCCGCCATGTCAGAATGGAGGGATGTGTCTCC
GGCCACAACTCTGTGTGTGTAAACCAGGGACCAAGGGCAAAGCCTGTGAAACAATAGCTGCCCAGGACACCTCGTCACCAGTCTTTGGAG
GGCAGAGTCCTGGGGCTGCTTCCTCGTGGGGCCCTCCTGAGCAAGCAGCAAAGCATACTTCATCTAAGAAGGCAGACACTCTACCAAGAG
TCAGCCCTGTGGCCCAGATGACCTTAACCCTCAAGCCGAAGCCTTCAGTGGGACTCCCCCAGCAGATACATTCTCAAGTGACTCCTCTTT
CTTCCCAGAGTGTGGTGATTCACCATGGCCAGACCCAGGAATACGTGCTCAAGCCCAAGTACTTTCCAGCCCAGAAGGGGATTTCAGGAG
AGCAGTCCACTGAAGGTTCTTTCCCTTTAAGATATGTGCAGGATCAAGTTGCGGCACCTTTTCAGCTGAGTAACCACACTGGCCGCATCA
AGGTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCA
TTAGTGAGAATGGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGT
GCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTT
ATCAGCATTCCCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAG
GAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAA
TTGATGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGA
CCATACATTCCACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAA
CCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACA
AATGCCAGAAATGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCT
TTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCA
AAATAGGATTTGGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTG
TCAGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCAC
ACTGTGAGAAATGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGAC
GCAGGCCAATCCATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCAC
CTCTCCCAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCAC
CCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTC
ATCTGCATCCACAGTTTCCAGGTATAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTG
CCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACC
TACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGG
TCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGG
GTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTG
AATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGC
AGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGT
GCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTC
CGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCA
GGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTC
ATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATA
TCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGAT
TTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAG
AGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAAC
AAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTT
CAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAG
CCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATC
ACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCT
TTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCC
TACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATC
ATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCT
TGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCT
CCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATC
AGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAAT
GCAAAGCTGGTATGAGCAATCCTGCATTAACCATGGAAAATGAGACTTAACTCTTCAAGCAAGATAAATTCATACTTTATAAAAGTATCA
ATGCTGTAGATGGATGGAAGAGGCTTCCCACAGGAAGGTGCCACCAGTCAGTTGTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGA
ATTGATTAGTTCTCTCCAAGCCATTGCTTAAAATATAACATGTTTTGGATCCAATACACACATTGTTACAACTAACACAAATTCCTATTA
AATATTAAAAGTAGTTCTGGTTTATTAATCAACGGGGAAAACATCTTCTCCAAAAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCA
AATATATGGGTAGCACAGTTTATCACATAGAAACTCCATTAATCATCTGATTTTCCGAATCTGAAAATTGAGACTATTAAGATATTAGGA
TTTCAGAGATTTCAAGTCACATTATAATGATAAGCATTATTCATAAAACTTGTTACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCT
TTTTTTTCCTCTGATGTGAATCCAGCCTCAGACTGAGTGAACTGTAATAATTATGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAA
GATCATCAACCATTTTTGCCTCACTTAATTCCAGCCTTTTGTTTTCTGCTGGAAAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGC
AGTTGGCTGGAATACTTTTGTCAGAATACGGTACATTTCTATTACATCAGAAATATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAAT
TTATGATAGCAATTATGAAGATTGTTTTATGACATTCTTTTGTCAGTTTGGCTTTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGA
ACATAGTAAAACTATTGAATTTCTCTTAAGAATTCCTAATAGGTCAATAGATTTACCCTCCAGTGATATCTATATTATTTCTTTCTCGTC
TCATCAAAATGATGACAGGTAAACTATATTTTTCCTTAAACACCTATTACAGTTAAATTATGCAAATCATTAAATAAAAATCATACAACT
TTTGGAAAGTTAGTTCAACATGAACTAAAATGGCATGCTATTTGGAAATTTAGTTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTT
CAGCTTCAGTAAATATAATAAGCTCTTGTGCCTTGTATGCACTATTTAAAAAAAGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAA
TGTTAACAATTAGAATAATACTCTGTATGCTTTTTTGATACTGATTTTGAGAATTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAA
GTAATTGGTATTTAATCAAAGAGAAAATGGTAATAAACTTTTCAAAATCTTTGTTAAACCAAACATTCAACACAAAATAAACTAGAAGGC
CAGAGGATAATGGAATAAAAGATCATTGCAATTACTTATCCTTCCTAAAAATATAGTTTTATATTAATTGTGCTTATGGAAGAAACAATG
TCAGCCAAGTCCATTTTATAGTTTGAGTGCAATTCTTTGAACAATAGAAATATCTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGT
TTCATCTGACAATCTGCTTCAAGAAATCTCAGAAAATATGATAACATTTTAACTTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAAT
ACCTAAAGTGCCAGACCGGAACCTATAGCTACTGCTAGAAGTCTTAAAAAAACCAACAGCAGCACAGGATGTATTAAGAATTATATGAAG
TCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAAAGCACAGTACTGTTAGCTGTTTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGT
CAAACTGGAAGCTAGGGGAAAAAGAGGGATTTTTATCCTTTACTCTTCTAGAGTACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAA
TTAAATATATGTCAATACACATTAGAATCAGATTTGAAAAAGTTAAAACAATTTCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAG
TGAATAACCTTTAAAGGGTTGTTTTGTTTTGTTTTGAATTATAGGAGTTATAATCTTTGGAGATGATTGCATATCTCATTAGATATGCAA
TATAAATTTATCTGAGTGAACAAAGTGCTAAATAAATAGATCTACATTTTGTACATATTTATATAAAATTTACCTTTAAGTATTTACTTT
AAAAAATTTAATGGCTTAACTCGAACTTGAAGACACATACTTCAACTGTCCTTATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCT
TTTATAGATTTTACTATATAGGAATCAAGATTTAAGAAATTTTGCATTAAAAATAGTGTACCAATGCTTCATATACGTTAGTTATTTGCT
ATTATGTAGGGAAGAGGATTGTTATTTCAAAGATATATTAAAGAACAGTTGCATCTGAATATAATCATGATGCATTCAATGAAGTTCATA
TCCATGAATTCACTCCTAATATACCCTAATAAAGTGGTTGATCACCTACATTATCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTA
AATTATTTTAAGCATAAATTTTCCTAATAGTTTATTAGAGCTACTAATGGCAAAATTCATGTCTTCAATGTGGCCATAACATAGGTCTTG
GGAGGGGTGGTGAGAAAATAAGGTATTTACTTTGTAGTAGTTAAGTGATTCTGAGGACAATTAGAAACAGACTATAAAACTCAACTACAC
TGTAATCAATAGACAACTATTGGAAATATGGCATATGTTGACAAACACTTAACTAGGGAAATCAAAGATATAAATCATGTTTATAAAAAA
TTAGGCACGCAATCATGTGATTCATGCTTCAAGAAAATATATGAAAAAAGTGTTACTCCATTATGTTATAAACTAGCAGATTTTCCCTAT
TTTGAAATGCATGTAAACGGGCTCGGCTGATTCTGAAATTGTACTGTATCATTTGGTATTTACTTATATGGTCAAATACTTGTTTGTAAA
AGTGATGGTTCTGATACCTTTGATCAAACATAGATACAAACCTCAGAAAATGGTAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGT
GTCCTCCAGCACAACCATCCCACCCACACACCTAGACTACAGATTCTGATCTGTGAATATTTTCACCAAAGTGACATTTAAACAAGTGGA
TTTTTCACAAATAACACGTGTTTAATATCTTTCTGCAGAAACGTGTTCTTCTAAAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTA
CACTTCTTTTCCACATACTTAGCCAGTTCAGCACCGATTTCCTCTTATATGTGGAAGGAGACTATGTTACATACCTGAAGTATTACTCTT
TTACAAAGATACCATTAGAATTTTCTCACTGTCTTGGTAAAAATTCCTAGATTCTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGT
AACGCCATGAAAAGCATTAAGTAGAAGCCAACATTAACCTAGATTTTACAACTGAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTT
ATTACCAAAGGATCTTATTTTGTTACAGAACACAGGAAATTGTTAAACCTTATAATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCC
ATAAGATTTTTTTATTGTAGTAGTGCCCTGGCTTGTAAACAGTGGACATCACTGAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGAC
TCCTGTGAATCAACTATGAATATGAAGTATCTCCCAGAACAATGTTGAGTGTTTCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTT
CCTTCCTCAAAATAGTCTCCTTGAAATGTGAGCAAAGAACTATGATGATGCAGTCCAGGTATCTAATAGCTCAATCACCAACACCGCTGA
GAATTGTTCTTATACCAGCAAAAAGTTCAAATACAATAACCTGGGCAATGCCAACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTG
TTGCAGGAAAGTGAGGGCAAAAACAAACTGGTGAAAAATGTTCAAAAATAGATCTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGT
ATTGTTTACAATTGGGGGAAAATGTCTGTTAAGGCTAATCATCTGAGTGATTTGAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGT
TATTTTAAGCCCTGGTTTATGGCTAGTTCCCTTTTGCTCAGGAAAAATAGTACTACTTTATGGTTTATGAAAACCTATGATTTATGTTGC
ATCTTCCGGGGAAGGTTTAACAGTACAAGGAGCTGAATCCTACCTGAAATTATTAATGCTTAATATATTGCTTCTGTTTGATTGATAAAG
GTGCTTAATCAATTGAAAAAAAAACGCATAATGCTTCAAGGTAAAATTCCGTTGATTCTGAATTTAAAAAGATACTACAGAATGCGTCAG
TTCTCCTGTTGTATTTTTCTCAGTTATGAGAGCAAGGCTATTTTGTCAGTTTAGATTTTGTGTCTTTTTCTGTCAGTATGTATGGCTCCC

>In-frame_LTBP1_ENST00000390003_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_8448nt
GAGACACCACTGAATACAGAGCAGCGAGCACTGAAGGCTTCCCTCTTTCCTTAAACCTGTCGGGTTGTGGGCTCTCTCTTTTCCCCTCTT
GCTCCTTTCTTTTCTTTTTTTCTGTTTTTTTAAACCTTCCAAGGCAAGTTCATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCC
CTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGC
TGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGA
GTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTT
TGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCAT
TCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATATCCATGTGAAACAT
CCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCC
CAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCC
GTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAG
GACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAACCATCTTATCATGGATACAACCAAATG
ATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGT
GAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCC
CCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAG
CAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGT
CCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCA
AAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAA
CACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAG
CCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGGTATAGTGATTGAAAAAACATCACCTCCT
GTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACT
GTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAA
CAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTC
TTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGG
GAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGAT
ATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGA
TTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGC
TCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTA
TGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGT
GAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAG
GGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATT
AATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACAT
CCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGAT
GGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGG
TCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAG
CCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATAC
TGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCA
TGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCA
ACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCA
GCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGT
CCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTAC
TGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCT
GCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGAT
TCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATTAACCATGGAAAATGAGACTTAA
CTCTTCAAGCAAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCCCACAGGAAGGTGCCACCAGTCA
GTTGTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCTTAAAATATAACATGTTTTGGAT
CCAATACACACATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAATCAACGGGGAAAACATCTTCTC
CAAAAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACATAGAAACTCCATTAATCATCTGA
TTTTCCGAATCTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAATGATAAGCATTATTCATAAAACT
TGTTACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCTCAGACTGAGTGAACTGTAATAA
TTATGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAATTCCAGCCTTTTGTTTTCTGCT
GGAAAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATACGGTACATTTCTATTACATCAG
AAATATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTTATGACATTCTTTTGTCAGTTTG
GCTTTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTAAGAATTCCTAATAGGTCAATAG
ATTTACCCTCCAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATATTTTTCCTTAAACACCTATTAC
AGTTAAATTATGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAAAATGGCATGCTATTTGGAAATT
TAGTTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTGTGCCTTGTATGCACTATTTAAA
AAAAGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTATGCTTTTTTGATACTGATTTTGA
GAATTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAATGGTAATAAACTTTTCAAAATCT
TTGTTAAACCAAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTGCAATTACTTATCCTTCCTAAAA
ATATAGTTTTATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGTGCAATTCTTTGAACAATAGAAA
TATCTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATCTCAGAAAATATGATAACATTTT
AACTTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAGCTACTGCTAGAAGTCTTAAAAA
AACCAACAGCAGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAAAGCACAGTACTGTTAGC
TGTTTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGGATTTTTATCCTTTACTCTTCTA
GAGTACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAATCAGATTTGAAAAAGTTAAAACA
ATTTCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTTTTGTTTTGAATTATAGGAGTTA
TAATCTTTGGAGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGCTAAATAAATAGATCTACATTTT
GTACATATTTATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTTGAAGACACATACTTCAACTGTC
CTTATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAAGATTTAAGAAATTTTGCATTAA
AAATAGTGTACCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTCAAAGATATATTAAAGAACAGTT
GCATCTGAATATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTAATAAAGTGGTTGATCACCTACA
TTATCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAATAGTTTATTAGAGCTACTAATGG
CAAAATTCATGTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTTACTTTGTAGTAGTTAAGTGATT
CTGAGGACAATTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATATGGCATATGTTGACAAACACTT
AACTAGGGAAATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCTTCAAGAAAATATATGAAAAAAG
TGTTACTCCATTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCTGATTCTGAAATTGTACTGTATC
ATTTGGTATTTACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAACATAGATACAAACCTCAGAAAA
TGGTAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACACACCTAGACTACAGATTCTGAT
CTGTGAATATTTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATATCTTTCTGCAGAAACGTGTTCTT
CTAAAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTTCAGCACCGATTTCCTCTTATAT
GTGGAAGGAGACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCACTGTCTTGGTAAAAATTCCTAG
ATTCTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGCCAACATTAACCTAGATTTTACA
ACTGAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAGAACACAGGAAATTGTTAAACCT
TATAATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCCTGGCTTGTAAACAGTGGACATC
ACTGAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGTATCTCCCAGAACAATGTTGAGT
GTTTCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATGTGAGCAAAGAACTATGATGATG
CAGTCCAGGTATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTCAAATACAATAACCTGGGCAATG
CCAACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAACTGGTGAAAAATGTTCAAAAATA
GATCTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTGTTAAGGCTAATCATCTGAGTGA
TTTGAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTTCCCTTTTGCTCAGGAAAAATAG
TACTACTTTATGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAAGGAGCTGAATCCTACCTGAAAT
TATTAATGCTTAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCATAATGCTTCAAGGTAAAATTCC
GTTGATTCTGAATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATGAGAGCAAGGCTATTTTGTCAGT

>In-frame_LTBP1_ENST00000418533_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_8445nt
GAGACACCACTGAATACAGAGCAGCGAGCACTGAAGGCTTCCCTCTTTCCTTAAACCTGTCGGGTTGTGGGCTCTCTCTTTTCCCCTCTT
GCTCCTTTCTTTTCTTTTTTTCTGTTTTTTTAAACCTTCCAAGGCAAGTTCATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCC
CTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGC
TGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGA
GTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTT
TGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCAT
TCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATATCCATGTGAAACAT
CCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCC
CAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCC
GTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAG
GACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAACCATCTTATCATGGATACAACCAAATG
ATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGT
GAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCC
CCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAG
CAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGT
CCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTAGGTAAAGGACCTGTATTTGTCAAGCCA
AAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAA
CACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAG
CCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTG
CCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTG
AACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAA
CAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTG
TGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAG
GGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATT
GATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTC
CGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCC
TACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGT
GTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAA
GACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGT
TACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAAT
ACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCA
GGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGC
CGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCA
TACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCA
AGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGT
GACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGG
GTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACA
GATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCT
ATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCA
GTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGG
TTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCA
GGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCT
CAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATTAACCATGGAAAATGAGACTTAACTC
TTCAAGCAAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCCCACAGGAAGGTGCCACCAGTCAGTT
GTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCTTAAAATATAACATGTTTTGGATCCA
ATACACACATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAATCAACGGGGAAAACATCTTCTCCAA
AAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACATAGAAACTCCATTAATCATCTGATTT
TCCGAATCTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAATGATAAGCATTATTCATAAAACTTGT
TACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCTCAGACTGAGTGAACTGTAATAATTA
TGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAATTCCAGCCTTTTGTTTTCTGCTGGA
AAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATACGGTACATTTCTATTACATCAGAAA
TATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTTATGACATTCTTTTGTCAGTTTGGCT
TTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTAAGAATTCCTAATAGGTCAATAGATT
TACCCTCCAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATATTTTTCCTTAAACACCTATTACAGT
TAAATTATGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAAAATGGCATGCTATTTGGAAATTTAG
TTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTGTGCCTTGTATGCACTATTTAAAAAA
AGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTATGCTTTTTTGATACTGATTTTGAGAA
TTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAATGGTAATAAACTTTTCAAAATCTTTG
TTAAACCAAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTGCAATTACTTATCCTTCCTAAAAATA
TAGTTTTATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGTGCAATTCTTTGAACAATAGAAATAT
CTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATCTCAGAAAATATGATAACATTTTAAC
TTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAGCTACTGCTAGAAGTCTTAAAAAAAC
CAACAGCAGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAAAGCACAGTACTGTTAGCTGT
TTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGGATTTTTATCCTTTACTCTTCTAGAG
TACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAATCAGATTTGAAAAAGTTAAAACAATT
TCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTTTTGTTTTGAATTATAGGAGTTATAA
TCTTTGGAGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGCTAAATAAATAGATCTACATTTTGTA
CATATTTATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTTGAAGACACATACTTCAACTGTCCTT
ATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAAGATTTAAGAAATTTTGCATTAAAAA
TAGTGTACCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTCAAAGATATATTAAAGAACAGTTGCA
TCTGAATATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTAATAAAGTGGTTGATCACCTACATTA
TCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAATAGTTTATTAGAGCTACTAATGGCAA
AATTCATGTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTTACTTTGTAGTAGTTAAGTGATTCTG
AGGACAATTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATATGGCATATGTTGACAAACACTTAAC
TAGGGAAATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCTTCAAGAAAATATATGAAAAAAGTGT
TACTCCATTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCTGATTCTGAAATTGTACTGTATCATT
TGGTATTTACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAACATAGATACAAACCTCAGAAAATGG
TAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACACACCTAGACTACAGATTCTGATCTG
TGAATATTTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATATCTTTCTGCAGAAACGTGTTCTTCTA
AAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTTCAGCACCGATTTCCTCTTATATGTG
GAAGGAGACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCACTGTCTTGGTAAAAATTCCTAGATT
CTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGCCAACATTAACCTAGATTTTACAACT
GAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAGAACACAGGAAATTGTTAAACCTTAT
AATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCCTGGCTTGTAAACAGTGGACATCACT
GAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGTATCTCCCAGAACAATGTTGAGTGTT
TCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATGTGAGCAAAGAACTATGATGATGCAG
TCCAGGTATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTCAAATACAATAACCTGGGCAATGCCA
ACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAACTGGTGAAAAATGTTCAAAAATAGAT
CTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTGTTAAGGCTAATCATCTGAGTGATTT
GAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTTCCCTTTTGCTCAGGAAAAATAGTAC
TACTTTATGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAAGGAGCTGAATCCTACCTGAAATTAT
TAATGCTTAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCATAATGCTTCAAGGTAAAATTCCGTT
GATTCTGAATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATGAGAGCAAGGCTATTTTGTCAGTTTA

>In-frame_LTBP1_ENST00000402934_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_8258nt
CACTGAAGGCTTCCCTCTTTCCTTAAACCTGTCGGGTTGTGGGCTCTCTCTTTTCCCCTCTTGCTCCTTTCTTTTCTTTTTTTCTGTTTT
TTTAAACCTTCCAAGGCAAGTTCATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACA
CTGGCCGCATCAAGGTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACA
CCACCACTCTCATTAGTGAGAATGGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGA
ATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCG
TGCCTAAACTTTATCAGCATTCCCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGA
CTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATC
AGGTTTCAAGAATTGATGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCC
AGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGT
GCTTCCAGGAAACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCT
GGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGG
TTAACAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATC
GATGTACCTGCAAAATAGGATTTGGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCT
GTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGG
CCTGGGGCCCACACTGTGAGAAATGTCCCCTTCCAGGCACAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGC
CAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTC
AACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTG
AAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTG
ATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGA
AATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTT
GCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACT
GTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAAT
GTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCT
GGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGT
GTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACG
GGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTG
ATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAG
CATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAG
GGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCT
GTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGT
GTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGA
AAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAG
AAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGAT
GCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACA
ATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTAC
AGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTT
CTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTC
GACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTAC
CCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGA
ATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTT
GGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATTAACCATGGAAAATGAGACTTAACTCTTCAAGC
AAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCCCACAGGAAGGTGCCACCAGTCAGTTGTGCCTA
TGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCTTAAAATATAACATGTTTTGGATCCAATACACA
CATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAATCAACGGGGAAAACATCTTCTCCAAAAAACTT
GGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACATAGAAACTCCATTAATCATCTGATTTTCCGAAT
CTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAATGATAAGCATTATTCATAAAACTTGTTACCTTT
AAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCTCAGACTGAGTGAACTGTAATAATTATGAATTC
ATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAATTCCAGCCTTTTGTTTTCTGCTGGAAAATAAG
TGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATACGGTACATTTCTATTACATCAGAAATATATTT
TCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTTATGACATTCTTTTGTCAGTTTGGCTTTCTAAA
AATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTAAGAATTCCTAATAGGTCAATAGATTTACCCTC
CAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATATTTTTCCTTAAACACCTATTACAGTTAAATTA
TGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAAAATGGCATGCTATTTGGAAATTTAGTTTGAGA
TAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTGTGCCTTGTATGCACTATTTAAAAAAAGTTTTT
TTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTATGCTTTTTTGATACTGATTTTGAGAATTTAAAG
CAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAATGGTAATAAACTTTTCAAAATCTTTGTTAAACC
AAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTGCAATTACTTATCCTTCCTAAAAATATAGTTTT
ATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGTGCAATTCTTTGAACAATAGAAATATCTGCAGT
CTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATCTCAGAAAATATGATAACATTTTAACTTTCATT
TTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAGCTACTGCTAGAAGTCTTAAAAAAACCAACAGC
AGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAAAGCACAGTACTGTTAGCTGTTTTTGTG
GACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGGATTTTTATCCTTTACTCTTCTAGAGTACTGTT
AATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAATCAGATTTGAAAAAGTTAAAACAATTTCATTGT
TGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTTTTGTTTTGAATTATAGGAGTTATAATCTTTGG
AGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGCTAAATAAATAGATCTACATTTTGTACATATTT
ATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTTGAAGACACATACTTCAACTGTCCTTATTGTCC
ATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAAGATTTAAGAAATTTTGCATTAAAAATAGTGTA
CCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTCAAAGATATATTAAAGAACAGTTGCATCTGAAT
ATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTAATAAAGTGGTTGATCACCTACATTATCTGTCT
ATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAATAGTTTATTAGAGCTACTAATGGCAAAATTCAT
GTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTTACTTTGTAGTAGTTAAGTGATTCTGAGGACAA
TTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATATGGCATATGTTGACAAACACTTAACTAGGGAA
ATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCTTCAAGAAAATATATGAAAAAAGTGTTACTCCA
TTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCTGATTCTGAAATTGTACTGTATCATTTGGTATT
TACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAACATAGATACAAACCTCAGAAAATGGTAAATGC
AAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACACACCTAGACTACAGATTCTGATCTGTGAATAT
TTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATATCTTTCTGCAGAAACGTGTTCTTCTAAAGCAGA
AAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTTCAGCACCGATTTCCTCTTATATGTGGAAGGAG
ACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCACTGTCTTGGTAAAAATTCCTAGATTCTACTTT
TTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGCCAACATTAACCTAGATTTTACAACTGAGCAAT
CTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAGAACACAGGAAATTGTTAAACCTTATAATGTTG
CAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCCTGGCTTGTAAACAGTGGACATCACTGAAAGGA
TGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGTATCTCCCAGAACAATGTTGAGTGTTTCAGGAG
ACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATGTGAGCAAAGAACTATGATGATGCAGTCCAGGT
ATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTCAAATACAATAACCTGGGCAATGCCAACAGAAG
ACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAACTGGTGAAAAATGTTCAAAAATAGATCTTTTTG
ATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTGTTAAGGCTAATCATCTGAGTGATTTGAGTAGC
AATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTTCCCTTTTGCTCAGGAAAAATAGTACTACTTTA
TGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAAGGAGCTGAATCCTACCTGAAATTATTAATGCT
TAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCATAATGCTTCAAGGTAAAATTCCGTTGATTCTG
AATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATGAGAGCAAGGCTATTTTGTCAGTTTAGATTTTG

>In-frame_LTBP1_ENST00000404525_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_8244nt
CTCTTTCCTTAAACCTGTCGGGTTGTGGGCTCTCTCTTTTCCCCTCTTGCTCCTTTCTTTTCTTTTTTTCTGTTTTTTTAAACCTTCCAA
GGCAAGTTCATGGATACTAAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAG
GTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATT
AGTGAGAATGGTCATGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGC
AGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTAT
CAGCATTCCCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGA
GTCAAAGTGAAATTTCCTCCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATT
GATGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACC
ATACATTCCACATACTCCCACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACC
ATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAA
TGCCAGAAATGCCCCAAGAAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTT
TGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAA
ATAGGATTTGGGCCGGATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTC
AGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACAC
TGTGAGAAATGTCCCCTTCCAGGCACAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAG
CCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCT
CCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAA
GCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCA
GGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATT
GATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTT
ATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTG
GGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGC
ACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGC
CTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAA
GGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAAT
ACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCAC
CGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGA
GACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGT
ACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGG
GAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATG
GAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACA
TTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAA
GTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAA
CCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTT
TCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAA
TTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCT
TCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGAT
AAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGT
CTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAA
AATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGC
ATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATTAACCATGGAAAATGAGACTTAACTCTTCAAGCAAGATAAATTCATA
CTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCCCACAGGAAGGTGCCACCAGTCAGTTGTGCCTATGTCCCTTTGGCTG
GAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCTTAAAATATAACATGTTTTGGATCCAATACACACATTGTTACAACTA
ACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAATCAACGGGGAAAACATCTTCTCCAAAAAACTTGGAATAAATCCAAG
GACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACATAGAAACTCCATTAATCATCTGATTTTCCGAATCTGAAAATTGAGAC
TATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAATGATAAGCATTATTCATAAAACTTGTTACCTTTAAGAAGGTGGAAGT
GGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCTCAGACTGAGTGAACTGTAATAATTATGAATTCATTACAGAGTCCAG
GTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAATTCCAGCCTTTTGTTTTCTGCTGGAAAATAAGTGTGGACATTGAAG
CTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATACGGTACATTTCTATTACATCAGAAATATATTTTCATCTCTTCTTGT
TAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTTATGACATTCTTTTGTCAGTTTGGCTTTCTAAAAATCTCTTTTTAGA
TTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTAAGAATTCCTAATAGGTCAATAGATTTACCCTCCAGTGATATCTATA
TTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATATTTTTCCTTAAACACCTATTACAGTTAAATTATGCAAATCATTAAA
TAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAAAATGGCATGCTATTTGGAAATTTAGTTTGAGATAAACTAAAGTGTG
TTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTGTGCCTTGTATGCACTATTTAAAAAAAGTTTTTTTTATTTGAGTCCA
GTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTATGCTTTTTTGATACTGATTTTGAGAATTTAAAGCAGATTACCTTTTA
AAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAATGGTAATAAACTTTTCAAAATCTTTGTTAAACCAAACATTCAACACA
AAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTGCAATTACTTATCCTTCCTAAAAATATAGTTTTATATTAATTGTGCT
TATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGTGCAATTCTTTGAACAATAGAAATATCTGCAGTCTTTCACAGATTTG
TATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATCTCAGAAAATATGATAACATTTTAACTTTCATTTTAGAGCACGTTTT
GGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAGCTACTGCTAGAAGTCTTAAAAAAACCAACAGCAGCACAGGATGTAT
TAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTTTTCAAAGCACAGTACTGTTAGCTGTTTTTGTGGACAGGATTCGATT
AAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGGATTTTTATCCTTTACTCTTCTAGAGTACTGTTAATGCCCCTTTCCC
ACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAATCAGATTTGAAAAAGTTAAAACAATTTCATTGTTGTAATTGTTCCCT
TTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTTTTGTTTTGAATTATAGGAGTTATAATCTTTGGAGATGATTGCATAT
CTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGCTAAATAAATAGATCTACATTTTGTACATATTTATATAAAATTTACC
TTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTTGAAGACACATACTTCAACTGTCCTTATTGTCCATTAAACTGATAAT
TTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAAGATTTAAGAAATTTTGCATTAAAAATAGTGTACCAATGCTTCATAT
ACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTCAAAGATATATTAAAGAACAGTTGCATCTGAATATAATCATGATGCA
TTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTAATAAAGTGGTTGATCACCTACATTATCTGTCTATAAGAAACTGCCT
TTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAATAGTTTATTAGAGCTACTAATGGCAAAATTCATGTCTTCAATGTGGC
CATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTTACTTTGTAGTAGTTAAGTGATTCTGAGGACAATTAGAAACAGACTA
TAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATATGGCATATGTTGACAAACACTTAACTAGGGAAATCAAAGATATAAA
TCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCTTCAAGAAAATATATGAAAAAAGTGTTACTCCATTATGTTATAAACT
AGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCTGATTCTGAAATTGTACTGTATCATTTGGTATTTACTTATATGGTCA
AATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAACATAGATACAAACCTCAGAAAATGGTAAATGCAAAGCAGTTTACGT
TGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACACACCTAGACTACAGATTCTGATCTGTGAATATTTTCACCAAAGTGA
CATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATATCTTTCTGCAGAAACGTGTTCTTCTAAAGCAGAAAACCACGTGGCTT
AATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTTCAGCACCGATTTCCTCTTATATGTGGAAGGAGACTATGTTACATAC
CTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCACTGTCTTGGTAAAAATTCCTAGATTCTACTTTTTATTGCAAGTGTT
AGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGCCAACATTAACCTAGATTTTACAACTGAGCAATCTGTTCCCCACCAG
ATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAGAACACAGGAAATTGTTAAACCTTATAATGTTGCAAACCATGCATTT
TCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCCTGGCTTGTAAACAGTGGACATCACTGAAAGGATGAAATCAAGTAGG
CTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGTATCTCCCAGAACAATGTTGAGTGTTTCAGGAGACTCTGAAACAGGG
CACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATGTGAGCAAAGAACTATGATGATGCAGTCCAGGTATCTAATAGCTCAA
TCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTCAAATACAATAACCTGGGCAATGCCAACAGAAGACACTTTTAATCAT
TTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAACTGGTGAAAAATGTTCAAAAATAGATCTTTTTGATGTTCATAGCCAG
TATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTGTTAAGGCTAATCATCTGAGTGATTTGAGTAGCAATTAAACCAAAGG
GAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTTCCCTTTTGCTCAGGAAAAATAGTACTACTTTATGGTTTATGAAAAC
CTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAAGGAGCTGAATCCTACCTGAAATTATTAATGCTTAATATATTGCTTC
TGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCATAATGCTTCAAGGTAAAATTCCGTTGATTCTGAATTTAAAAAGATA
CTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATGAGAGCAAGGCTATTTTGTCAGTTTAGATTTTGTGTCTTTTTCTGTC

>In-frame_LTBP1_ENST00000407925_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_8385nt
CGGGTTGTGGGCTCTCTCTTTTCCCCTCTTGCTCCTTTCTTTTCTTTTTTTCTGTTTTTTTAAACCTTCCAAGGCAAGTTCATGGATACT
AAGCTGATGTGTTTGTTGTTCTTTTTCTCCCTGCCTCCGCTCCTAGTGAGTAACCACACTGGCCGCATCAAGGTGGTCTTTACTCCGAGC
ATCTGTAAAGTGACCTGCACCAAGGGCAGCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCATGCT
GCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGTATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGT
CAGTGCCCTCCAAATTTCACAGGAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTCCCAGCAGCCA
GGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCTCTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCT
CCTAACATAGTCAATATCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGATGGCCCAACAGGCCAG
AAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTACCAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCC
CACCAGCAGGTCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGAAACCATTGGGTCACAGTGTGGC
AAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGCTGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAG
AAACCATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAACAACACCTTTTGCCAAGATATTAATGAA
TGTCAGCTACAAGGTGTATGCCCTAATGGTGAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGGAT
CCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCCCTGTTACCGACTTGTCAGTTCTGGAAGACAGTGT
ATGCACCCTCTGTCTGTTCACCTCACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAATGTCCCCTT
CCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCAT
GTAGGTAAAGGACCTGTATTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAGCCAAGGAAGAG
CCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCT
TCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCACTATTCATCTGCATCCACAGTTTCCA
GTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACT
CAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATA
TGCTACGAGGGCTACAGGTTCAGTGAACAACAGAGGAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGC
CGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGAC
GAATGCCTGAGGCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTACCGC
ATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCT
TACCAGTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCA
AATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGAT
ATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTAC
CAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAG
GGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAG
AGTGTTTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACA
TGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGC
CAGCAGGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTAT
CATCTACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTAT
GCAGAGAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACC
AGGACCATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGT
ATTTTGAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCT
CTGCTCTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTC
CATATTATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAAT
AAATCTACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGA
CAAGTTTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAAC
CAGGATCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGA
GAGTCCCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCT
GCATTAACCATGGAAAATGAGACTTAACTCTTCAAGCAAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGG
CTTCCCACAGGAAGGTGCCACCAGTCAGTTGTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCA
TTGCTTAAAATATAACATGTTTTGGATCCAATACACACATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTT
ATTAATCAACGGGGAAAACATCTTCTCCAAAAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTAT
CACATAGAAACTCCATTAATCATCTGATTTTCCGAATCTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATT
ATAATGATAAGCATTATTCATAAAACTTGTTACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCC
AGCCTCAGACTGAGTGAACTGTAATAATTATGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCA
CTTAATTCCAGCCTTTTGTTTTCTGCTGGAAAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCA
GAATACGGTACATTTCTATTACATCAGAAATATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATT
GTTTTATGACATTCTTTTGTCAGTTTGGCTTTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTC
TCTTAAGAATTCCTAATAGGTCAATAGATTTACCCTCCAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAA
CTATATTTTTCCTTAAACACCTATTACAGTTAAATTATGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGA
ACTAAAATGGCATGCTATTTGGAAATTTAGTTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGC
TCTTGTGCCTTGTATGCACTATTTAAAAAAAGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTC
TGTATGCTTTTTTGATACTGATTTTGAGAATTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAG
AAAATGGTAATAAACTTTTCAAAATCTTTGTTAAACCAAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGAT
CATTGCAATTACTTATCCTTCCTAAAAATATAGTTTTATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTT
TGAGTGCAATTCTTTGAACAATAGAAATATCTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAG
AAATCTCAGAAAATATGATAACATTTTAACTTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACC
TATAGCTACTGCTAGAAGTCTTAAAAAAACCAACAGCAGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTT
TTTTTTTCAAAGCACAGTACTGTTAGCTGTTTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAA
GAGGGATTTTTATCCTTTACTCTTCTAGAGTACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATT
AGAATCAGATTTGAAAAAGTTAAAACAATTTCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTT
TTGTTTTGTTTTGAATTATAGGAGTTATAATCTTTGGAGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAA
AGTGCTAAATAAATAGATCTACATTTTGTACATATTTATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCG
AACTTGAAGACACATACTTCAACTGTCCTTATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGA
ATCAAGATTTAAGAAATTTTGCATTAAAAATAGTGTACCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTT
ATTTCAAAGATATATTAAAGAACAGTTGCATCTGAATATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATA
CCCTAATAAAGTGGTTGATCACCTACATTATCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTC
CTAATAGTTTATTAGAGCTACTAATGGCAAAATTCATGTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGG
TATTTACTTTGTAGTAGTTAAGTGATTCTGAGGACAATTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGG
AAATATGGCATATGTTGACAAACACTTAACTAGGGAAATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTC
ATGCTTCAAGAAAATATATGAAAAAAGTGTTACTCCATTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCT
CGGCTGATTCTGAAATTGTACTGTATCATTTGGTATTTACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGA
TCAAACATAGATACAAACCTCAGAAAATGGTAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCAC
CCACACACCTAGACTACAGATTCTGATCTGTGAATATTTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTT
AATATCTTTCTGCAGAAACGTGTTCTTCTAAAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGC
CAGTTCAGCACCGATTTCCTCTTATATGTGGAAGGAGACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTT
TCTCACTGTCTTGGTAAAAATTCCTAGATTCTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTA
GAAGCCAACATTAACCTAGATTTTACAACTGAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGT
TACAGAACACAGGAAATTGTTAAACCTTATAATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAG
TGCCCTGGCTTGTAAACAGTGGACATCACTGAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATAT
GAAGTATCTCCCAGAACAATGTTGAGTGTTTCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTG
AAATGTGAGCAAAGAACTATGATGATGCAGTCCAGGTATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAA
AGTTCAAATACAATAACCTGGGCAATGCCAACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAA
CAAACTGGTGAAAAATGTTCAAAAATAGATCTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAAT
GTCTGTTAAGGCTAATCATCTGAGTGATTTGAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGC
TAGTTCCCTTTTGCTCAGGAAAAATAGTACTACTTTATGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAG
TACAAGGAGCTGAATCCTACCTGAAATTATTAATGCTTAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAA
ACGCATAATGCTTCAAGGTAAAATTCCGTTGATTCTGAATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAG
TTATGAGAGCAAGGCTATTTTGTCAGTTTAGATTTTGTGTCTTTTTCTGTCAGTATGTATGGCTCCCTAATTGAAAACATCTTAAATGAA

>In-frame_LTBP1_ENST00000272273_chr2_33540336_+_ZDHHC2_ENST00000262096_chr8_17042298_+_6310nt
ATTTTGTGAAAGCAACGCAGAGCACCTAGGCAGTGCCATTTCCTTGGCTCTTCTCAGTATGTGCAGGGAACACACCCGTGTGCACACTCA
CAGATACGTGTTTGCCACATTTTAGTACAACTCCGTTTCTGCATTCCACTATGTGGACGAGTGCCTGGAACCAAACGTCTGCGCAAATGG
TGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGA
TGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCT
GTCGGCAGCTAAAGACCAGTGTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTC
TTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGT
TTGCCAGAGAGGAGACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATGTCA
AGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCA
GGGTTTCTCAATCTCTGCAGATGGCCGTACGTGTGAAGTGTCCATGGAAAACACTGGCGAACAAGTTGTGTGCCTGATGGCCTATCATCT
ACTTTTTGCAATGTTTGTCTGGTCATACTGGAAAACTATCTTTACATTACCAATGAATCCTTCAAAAGAATTCCATCTCTCTTATGCAGA
GAAAGATTTGTTGGAGAGAGAGCCAAGAGGAGAAGCCCATCAGGAAGTTCTTAGGCGAGCAGCCAAGGATCTTCCCATCTATACCAGGAC
CATGTCTGGAGCCATCCGATACTGTGACAGATGCCAACTTATAAAACCAGATCGCTGCCATCACTGCTCCGTCTGTGATAAATGTATTTT
GAAGATGGATCATCATTGTCCATGGGTGAACAATTGTGTTGGATTTTCAAATTATAAGTTCTTTCTCCTTTTCTTGGCTTATTCTCTGCT
CTACTGCCTTTTTATTGCGGCAACAGATTTACAGTATTTTATCAAATTTTGGACAAATGGCCTACCTGATACTCAAGCCAAGTTCCATAT
TATGTTTTTATTCTTTGCTGCAGCTATGTTTTCTGTCAGCTTGTCTTCTCTGTTTGGCTATCATTGTTGGCTAGTCAGCAAAAATAAATC
TACATTAGAGGCATTCAGAAGTCCAGTATTTCGACATGGAACAGATAAGAATGGATTCAGCTTGGGTTTCAGTAAAAACATGCGACAAGT
TTTTGGTGATGAGAAGAAGTACTGGTTGCTACCCATTTTTTCAAGTCTAGGTGATGGCTGCTCCTTTCCAACTTGCCTTGTTAACCAGGA
TCCTGAACAAGCATCTACTCCTGCAGGGCTGAATTCCACAGCTAAAAATCTCGAAAACCATCAGTTTCCTGCAAAGCCATTGAGAGAGTC
CCAGAGCCACCTTCTTACTGATTCTCAGTCTTGGACGGAGAGCAGCATAAACCCAGGAAAATGCAAAGCTGGTATGAGCAATCCTGCATT
AACCATGGAAAATGAGACTTAACTCTTCAAGCAAGATAAATTCATACTTTATAAAAGTATCAATGCTGTAGATGGATGGAAGAGGCTTCC
CACAGGAAGGTGCCACCAGTCAGTTGTGCCTATGTCCCTTTGGCTGGAAATGCAGAATATGAATTGATTAGTTCTCTCCAAGCCATTGCT
TAAAATATAACATGTTTTGGATCCAATACACACATTGTTACAACTAACACAAATTCCTATTAAATATTAAAAGTAGTTCTGGTTTATTAA
TCAACGGGGAAAACATCTTCTCCAAAAAACTTGGAATAAATCCAAGGACCAGTTTTTACCCAAATATATGGGTAGCACAGTTTATCACAT
AGAAACTCCATTAATCATCTGATTTTCCGAATCTGAAAATTGAGACTATTAAGATATTAGGATTTCAGAGATTTCAAGTCACATTATAAT
GATAAGCATTATTCATAAAACTTGTTACCTTTAAGAAGGTGGAAGTGGCAAACCATACTTCTTTTTTTTCCTCTGATGTGAATCCAGCCT
CAGACTGAGTGAACTGTAATAATTATGAATTCATTACAGAGTCCAGGTGGCCTGCAGTTGAAGATCATCAACCATTTTTGCCTCACTTAA
TTCCAGCCTTTTGTTTTCTGCTGGAAAATAAGTGTGGACATTGAAGCTTGAGCTCTCAAAGCAGTTGGCTGGAATACTTTTGTCAGAATA
CGGTACATTTCTATTACATCAGAAATATATTTTCATCTCTTCTTGTTAAATTGGGAGGAAATTTATGATAGCAATTATGAAGATTGTTTT
ATGACATTCTTTTGTCAGTTTGGCTTTCTAAAAATCTCTTTTTAGATTATTTCTCCTGTTGAACATAGTAAAACTATTGAATTTCTCTTA
AGAATTCCTAATAGGTCAATAGATTTACCCTCCAGTGATATCTATATTATTTCTTTCTCGTCTCATCAAAATGATGACAGGTAAACTATA
TTTTTCCTTAAACACCTATTACAGTTAAATTATGCAAATCATTAAATAAAAATCATACAACTTTTGGAAAGTTAGTTCAACATGAACTAA
AATGGCATGCTATTTGGAAATTTAGTTTGAGATAAACTAAAGTGTGTTGATGCCAGAATGTTCAGCTTCAGTAAATATAATAAGCTCTTG
TGCCTTGTATGCACTATTTAAAAAAAGTTTTTTTTATTTGAGTCCAGTATAATTCATGTAAATGTTAACAATTAGAATAATACTCTGTAT
GCTTTTTTGATACTGATTTTGAGAATTTAAAGCAGATTACCTTTTAAAACTGGACCAACTAAGTAATTGGTATTTAATCAAAGAGAAAAT
GGTAATAAACTTTTCAAAATCTTTGTTAAACCAAACATTCAACACAAAATAAACTAGAAGGCCAGAGGATAATGGAATAAAAGATCATTG
CAATTACTTATCCTTCCTAAAAATATAGTTTTATATTAATTGTGCTTATGGAAGAAACAATGTCAGCCAAGTCCATTTTATAGTTTGAGT
GCAATTCTTTGAACAATAGAAATATCTGCAGTCTTTCACAGATTTGTATTATGCTGAAGAGTTTCATCTGACAATCTGCTTCAAGAAATC
TCAGAAAATATGATAACATTTTAACTTTCATTTTAGAGCACGTTTTGGTCATTTTTAAAAATACCTAAAGTGCCAGACCGGAACCTATAG
CTACTGCTAGAAGTCTTAAAAAAACCAACAGCAGCACAGGATGTATTAAGAATTATATGAAGTCAGGTTTGTTTTTTTTTTTTTTTTTTT
TTCAAAGCACAGTACTGTTAGCTGTTTTTGTGGACAGGATTCGATTAAGTATTCCCTCTTGTCAAACTGGAAGCTAGGGGAAAAAGAGGG
ATTTTTATCCTTTACTCTTCTAGAGTACTGTTAATGCCCCTTTCCCACAGTCTTTTATATAATTAAATATATGTCAATACACATTAGAAT
CAGATTTGAAAAAGTTAAAACAATTTCATTGTTGTAATTGTTCCCTTTCTGTTTTCATATAGTGAATAACCTTTAAAGGGTTGTTTTGTT
TTGTTTTGAATTATAGGAGTTATAATCTTTGGAGATGATTGCATATCTCATTAGATATGCAATATAAATTTATCTGAGTGAACAAAGTGC
TAAATAAATAGATCTACATTTTGTACATATTTATATAAAATTTACCTTTAAGTATTTACTTTAAAAAATTTAATGGCTTAACTCGAACTT
GAAGACACATACTTCAACTGTCCTTATTGTCCATTAAACTGATAATTTTGATTTTTCTTGCTTTTATAGATTTTACTATATAGGAATCAA
GATTTAAGAAATTTTGCATTAAAAATAGTGTACCAATGCTTCATATACGTTAGTTATTTGCTATTATGTAGGGAAGAGGATTGTTATTTC
AAAGATATATTAAAGAACAGTTGCATCTGAATATAATCATGATGCATTCAATGAAGTTCATATCCATGAATTCACTCCTAATATACCCTA
ATAAAGTGGTTGATCACCTACATTATCTGTCTATAAGAAACTGCCTTTGCACTGACAATGTAAATTATTTTAAGCATAAATTTTCCTAAT
AGTTTATTAGAGCTACTAATGGCAAAATTCATGTCTTCAATGTGGCCATAACATAGGTCTTGGGAGGGGTGGTGAGAAAATAAGGTATTT
ACTTTGTAGTAGTTAAGTGATTCTGAGGACAATTAGAAACAGACTATAAAACTCAACTACACTGTAATCAATAGACAACTATTGGAAATA
TGGCATATGTTGACAAACACTTAACTAGGGAAATCAAAGATATAAATCATGTTTATAAAAAATTAGGCACGCAATCATGTGATTCATGCT
TCAAGAAAATATATGAAAAAAGTGTTACTCCATTATGTTATAAACTAGCAGATTTTCCCTATTTTGAAATGCATGTAAACGGGCTCGGCT
GATTCTGAAATTGTACTGTATCATTTGGTATTTACTTATATGGTCAAATACTTGTTTGTAAAAGTGATGGTTCTGATACCTTTGATCAAA
CATAGATACAAACCTCAGAAAATGGTAAATGCAAAGCAGTTTACGTTGTAAATCATGATGGTGTCCTCCAGCACAACCATCCCACCCACA
CACCTAGACTACAGATTCTGATCTGTGAATATTTTCACCAAAGTGACATTTAAACAAGTGGATTTTTCACAAATAACACGTGTTTAATAT
CTTTCTGCAGAAACGTGTTCTTCTAAAGCAGAAAACCACGTGGCTTAATCCCAAATGTTTTACACTTCTTTTCCACATACTTAGCCAGTT
CAGCACCGATTTCCTCTTATATGTGGAAGGAGACTATGTTACATACCTGAAGTATTACTCTTTTACAAAGATACCATTAGAATTTTCTCA
CTGTCTTGGTAAAAATTCCTAGATTCTACTTTTTATTGCAAGTGTTAGCAATATGATCTTGTAACGCCATGAAAAGCATTAAGTAGAAGC
CAACATTAACCTAGATTTTACAACTGAGCAATCTGTTCCCCACCAGATTTCCTTTAGAATTTATTACCAAAGGATCTTATTTTGTTACAG
AACACAGGAAATTGTTAAACCTTATAATGTTGCAAACCATGCATTTTCCTTTTCTCTTTTCCATAAGATTTTTTTATTGTAGTAGTGCCC
TGGCTTGTAAACAGTGGACATCACTGAAAGGATGAAATCAAGTAGGCTTGTTTCAAAGAGACTCCTGTGAATCAACTATGAATATGAAGT
ATCTCCCAGAACAATGTTGAGTGTTTCAGGAGACTCTGAAACAGGGCACCCATTTTTTTTTTCCTTCCTCAAAATAGTCTCCTTGAAATG
TGAGCAAAGAACTATGATGATGCAGTCCAGGTATCTAATAGCTCAATCACCAACACCGCTGAGAATTGTTCTTATACCAGCAAAAAGTTC
AAATACAATAACCTGGGCAATGCCAACAGAAGACACTTTTAATCATTTGCAGACCTTTCTTGTTGCAGGAAAGTGAGGGCAAAAACAAAC
TGGTGAAAAATGTTCAAAAATAGATCTTTTTGATGTTCATAGCCAGTATTCAGTATTTCTGTATTGTTTACAATTGGGGGAAAATGTCTG
TTAAGGCTAATCATCTGAGTGATTTGAGTAGCAATTAAACCAAAGGGAAACTTTTAATAAGTTATTTTAAGCCCTGGTTTATGGCTAGTT
CCCTTTTGCTCAGGAAAAATAGTACTACTTTATGGTTTATGAAAACCTATGATTTATGTTGCATCTTCCGGGGAAGGTTTAACAGTACAA
GGAGCTGAATCCTACCTGAAATTATTAATGCTTAATATATTGCTTCTGTTTGATTGATAAAGGTGCTTAATCAATTGAAAAAAAAACGCA
TAATGCTTCAAGGTAAAATTCCGTTGATTCTGAATTTAAAAAGATACTACAGAATGCGTCAGTTCTCCTGTTGTATTTTTCTCAGTTATG
AGAGCAAGGCTATTTTGTCAGTTTAGATTTTGTGTCTTTTTCTGTCAGTATGTATGGCTCCCTAATTGAAAACATCTTAAATGAACTAAT


Top

FusionGenePPI for LTBP1_ZDHHC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LTBP1TGFB1, CACNA1A, ATN1, SMURF1, FBXO6, HLA-DPA1, GINM1, ZFP41, IGFBP3, IGFBP5, MED23, ALKBH3, ZNF131, PTPN4, BCHE, KLRG2, ZNF408, KBTBD7, PCDHB11, PCDH20, PCDH12, CSN1S1, EFEMP1, MMP10, VWCE, PCDHGB4, PCDHGA5, PCDHA4, CDH5, DEFA5, MMP3, C4orf26, PCDHA12, LOXL3ZDHHC2MSX2, MAFB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LTBP1_ZDHHC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LTBP1_ZDHHC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLTBP1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneZDHHC2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneZDHHC2C0023903Liver neoplasms1CTD_human
TgeneZDHHC2C0043094Weight Gain1CTD_human