FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20278

FusionGeneSummary for LRRFIP1_CARD10

check button Fusion gene summary
Fusion gene informationFusion gene name: LRRFIP1_CARD10
Fusion gene ID: 20278
HgeneTgene
Gene symbol

LRRFIP1

CARD10

Gene ID

9208

29775

Gene nameLRR binding FLII interacting protein 1caspase recruitment domain family member 10
SynonymsFLAP-1|FLAP1|FLIIAP1|GCF-2|GCF2|HUFI-1|TRIPBIMP1|CARMA3
Cytomap

2q37.3

22q13.1

Type of geneprotein-codingprotein-coding
Descriptionleucine-rich repeat flightless-interacting protein 1GC-binding factor 2LRR FLII-interacting protein 1NEDD8-conjugating enzymeTAR RNA-interacting proteinleucine rich repeat (in FLII) interacting protein 1caspase recruitment domain-containing protein 10Bcl10 binding protein and activator of NFKBCARD-containing MAGUK 3 proteinCARD-containing MAGUK protein 3carma 3
Modification date2018052220180519
UniProtAcc

Q32MZ4

Q9BWT7

Ensembl transtripts involved in fusion geneENST00000308482, ENST00000468950, 
ENST00000289175, ENST00000244815, 
ENST00000392000, 
ENST00000403299, 
ENST00000406271, ENST00000251973, 
ENST00000494166, 
Fusion gene scores* DoF score8 X 8 X 5=3203 X 3 X 2=18
# samples 92
** MAII scorelog2(9/320*10)=-1.83007499855769
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/18*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: LRRFIP1 [Title/Abstract] AND CARD10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLRRFIP1

GO:0000122

negative regulation of transcription by RNA polymerase II

14522076

TgeneCARD10

GO:0007250

activation of NF-kappaB-inducing kinase activity

11259443


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHYMTCGA-XU-A92V-01ALRRFIP1chr2

238668848

+CARD10chr22

37912305

-
TCGALDTHYMTCGA-XU-A92V-01ALRRFIP1chr2

238668848

+CARD10chr22

37915224

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308482ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000308482ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000308482ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000308482ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
intron-3CDSENST00000468950ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
intron-intronENST00000468950ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
intron-intronENST00000468950ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
intron-intronENST00000468950ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
In-frameENST00000289175ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000289175ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000289175ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000289175ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
In-frameENST00000244815ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000244815ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000244815ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000244815ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
In-frameENST00000392000ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000392000ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000392000ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-intronENST00000392000ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37912305

-
5CDS-5UTRENST00000308482ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000308482ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000308482ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000308482ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
intron-5UTRENST00000468950ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
intron-intronENST00000468950ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
intron-5UTRENST00000468950ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
intron-intronENST00000468950ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000289175ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000289175ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000289175ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000289175ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000244815ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000244815ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000244815ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000244815ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000392000ENST00000403299LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000392000ENST00000406271LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-5UTRENST00000392000ENST00000251973LRRFIP1chr2

238668848

+CARD10chr22

37915224

-
5CDS-intronENST00000392000ENST00000494166LRRFIP1chr2

238668848

+CARD10chr22

37915224

-

Top

FusionProtFeatures for LRRFIP1_CARD10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LRRFIP1

Q32MZ4

CARD10

Q9BWT7

Transcriptional repressor which preferentially binds tothe GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and mayregulate expression of TNF, EGFR and PDGFA. May control smoothmuscle cells proliferation following artery injury through PDGFArepression. May also bind double-stranded RNA. Positivelyregulates Toll-like receptor (TLR) signaling in response toagonist probably by competing with the negative FLII regulator forMYD88-binding. {ECO:0000269|PubMed:10364563,ECO:0000269|PubMed:14522076, ECO:0000269|PubMed:16199883,ECO:0000269|PubMed:19265123, ECO:0000269|PubMed:9705290}. Activates NF-kappa-B via BCL10 and IKK.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000244815+910128_250272785Coiled coilOntology_term=ECO:0000269
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000308482+1924128_250486641Coiled coilOntology_term=ECO:0000269
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000392000+1011128_250296809Coiled coilOntology_term=ECO:0000269
TgeneCARD10chr2:238668848chr22:37912305ENST00000251973-120138_4561241033Coiled coilOntology_term=ECO:0000255
TgeneCARD10chr2:238668848chr22:37912305ENST00000403299-221138_4561241033Coiled coilOntology_term=ECO:0000255
TgeneCARD10chr2:238668848chr22:37912305ENST00000251973-120567_5741241033Compositional biasNote=Poly-Ser
TgeneCARD10chr2:238668848chr22:37912305ENST00000403299-221567_5741241033Compositional biasNote=Poly-Ser

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000289175+78128_250240753Coiled coilOntology_term=ECO:0000269
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000244815+910567_593272785Compositional biasNote=Lys-rich
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000289175+78567_593240753Compositional biasNote=Lys-rich
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000308482+1924567_593486641Compositional biasNote=Lys-rich
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000392000+1011567_593296809Compositional biasNote=Lys-rich
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000244815+910485_584272785RegionNote=DNA-binding
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000289175+78485_584240753RegionNote=DNA-binding
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000308482+1924485_584486641RegionNote=DNA-binding
HgeneLRRFIP1chr2:238668848chr22:37912305ENST00000392000+1011485_584296809RegionNote=DNA-binding
TgeneCARD10chr2:238668848chr22:37912305ENST00000251973-12023_1151241033DomainCARD
TgeneCARD10chr2:238668848chr22:37912305ENST00000403299-22123_1151241033DomainCARD


Top

FusionGeneSequence for LRRFIP1_CARD10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LRRFIP1_ENST00000308482_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_1395aa
MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARAEAREIRMKELERQQKEITQVQKKTTGLDTKWGDIEQWMEDSERYS
RRSRRNTSASDEDERMSVGSRGSLRSQPDLETGGPYAWTNGTDGELTGSQSLNRRSGRPSCLYSAARPSGSYRASVLDEGSFGGTRRGST
SGSRAPSEYSGHLNSSSRASSRASSARASPVVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKELNEL
KDQIQDVEGKYMQGLKEMKDSLAEVEEKTKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQF
QFAEVKEALKQREEMLEEIRQLQQKQASSIREISDLQETIEWKDKKIGALERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIA
TNGETSDTLNNVGYQGPTKMTKEELNALKSTGDGTLDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQ
QQAQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALLRRARGPPPGAEEKEKEK
EKEKEPDNVDLVSELRAENQRLTASLRELQEGLQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQ
EMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTLTSLEGTKALLE
VQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREE
DPAPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFTGDRW
SGAVVRRVLSGPGSARMEPREQRVEAAGLEGACLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPER
ADPHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNTQRAQQLLEVQEKCLPSSRHRGPRSNLKKRALDQLRLVRPKPV
GAPAGDSPDQLLLEPCAEPERSLRPYSLVRPLLVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQ
PATPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQ

>In-frame_LRRFIP1_ENST00000289175_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_1149aa
MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGSGD
TSISIDTEASIREIKDSLAEVEEKTKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAE
VKEALKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKMTKEELNALKSTGDGTLDEEGPEGLTQFLMTEVRRLREARKSQLQRE
QQLQARGRVLEEERAGLEQRLRDQQQAQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRL
EEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLVSELRAENQRLTASLRELQEGLQQEASRPGAPGSERILLDILEHDWREAQDSRQE
LCQKLHAVQGELQWAEELRDQYLQEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVR
GLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEK
EINRLSILPFPPSAGSILRRQREEDPAPPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSG
RSPPGGPEPQDKGPDGLSFTGDRWSGAVVRRVLSGPGSARMEPREQRVEAAGLEGACLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEA
LEAWAKGPGAEPFYIRANLTLPERADPHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNTQRAQQLLEVQEKCLPSSR
HRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPLLVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQ
VCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWR

>In-frame_LRRFIP1_ENST00000244815_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_1181aa
MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRVEERPEK
DFTEKGSRNMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKDSLAEVEEKTKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEE
QLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKMTKEELNALKSTGDG
TLDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQAQERCQRLREDWEAGSLELLRLKDENYMIAMR
LAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLVSELRAENQRLTASLRELQEGLQ
QEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIE
KERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEF
PSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPAPPKRSFSSMSDITGSVTLKPWSPGLSSSSSS
DSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFTGDRWSGAVVRRVLSGPGSARMEPREQRVEAAGLEGACL
EAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPERADPHALCVKAQEILRLVDSAYKRRQEWFCTRVDP
LTLRDLDRGTVPNTQRAQQLLEVQEKCLPSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPLLV
SALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRAIQESVGKKHCLLELGARGVREL
VQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVECGS

>In-frame_LRRFIP1_ENST00000392000_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_1205aa
MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRVEERPEK
DFTEKGSRNMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKTKKAMVSNAQ
LDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEKHGIILNSEIATNGETSDTLN
NVGYQGPTKMTKEELNALKSTGDGTLDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQAQERCQRL
REDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVD
LVSELRAENQRLTASLRELQEGLQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQEMEDLRLKHR
TLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGT
CLKACASSHSLCSNLSSTWSLSEFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPAPPKRSFS
SMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFTGDRWSGAVVRRVLS
GPGSARMEPREQRVEAAGLEGACLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPERADPHALCVKA
QEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNTQRAQQLLEVQEKCLPSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQ
LLLEPCAEPERSLRPYSLVRPLLVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRI
RAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LRRFIP1_ENST00000308482_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_4185nt
ATGGACATGGGCACCCAGGGATCGGGGCGCAAGCGGCTCCCCAACCGGGAGCGGCTCACGGCGGAGGACGACGCGCTCAACCAGATCGCG
CGGGAGGCGGAAGCCCGGCTCGCTGCAAAACGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAG
GAGATCTATCAGGTCCAAAAGAAATATTATGGGCTGGATACAAAATGGGGTGACATCGAGCAGTGGATGGAAGACAGTGAGCGCTACTCT
CGTAGATCCAGAAGAAACACATCGGCTTCTGATGAAGACGAGCGCATGTCAGTGGGTAGTCGTGGAAGCCTGAGGTCGCAGCCTGACTTG
GAGTATGGGGGTCCTTACGCCTGGACAAATGGTTATGATGGAGAATTGTATGGATCACAGTCCCTGAATAGAAGATCTGGCAGGCCCTCC
TGTCTGTACAGCGCTGCCCGGCCTTCGGGGAGTTACCGGGCGTCTGTGTTGGATGAAGGCAGCTTCGGTGGGACCCGACGGGGCAGCACC
TCCGGCTCCCGTGCTCCCTCGGAGTACAGCGGCCACCTCAACTCCAGCTCCCGCGCCTCCTCCAGGGCCAGCTCGGCCCGGGCCAGCCCT
GTGGTAGAAGAGAGACCAGAAAAAGATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGT
GGGACTTCCTCTCGGAGAGGCAGCGGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGAACTCAATGAGTTA
AAGGACCAGATTCAGGATGTAGAAGGCAAATACATGCAGGGATTGAAAGAGATGAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAG
AAGGCTATGGTTTCCAATGCTCAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTT
GAAGAACAGCTGGCTGAATCTAGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTT
CAGTTTGCTGAAGTCAAGGAGGCCCTGAAGCAAAGAGAGGAAATGCTCGAGGAAATCCGACAGCTACAGCAGAAACAGGCGAGTTCTATC
AGGGAGATTTCTGATCTTCAGGAAACAATAGAGTGGAAAGACAAAAAGATAGGGGCATTAGAGAGGCAGAAAGAGTTCTTTGATTCCGTA
AGGAGTGAACGGGATGATCTTAGAGAAGAAGTAGTCATGCTGAAAGAGGAATTAAAGAAACATGGAATAATCCTAAATTCAGAAATAGCT
ACCAATGGAGAGACTTCCGACACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCG
ACAGGGGATGGGACCCTAGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAG
AGCCAGCTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAG
CAGCAGGCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATG
ATCGCCATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAG
CTCAAAGTGAGTCGGCTGGAGGAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAG
GAGAAGGAGAAGGAGCCAGACAATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAG
GAGGGCCTGCAGCAGGAGGCGAGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCG
CAGGACAGCAGGCAGGAGCTGTGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAG
GAGATGGAAGACCTGCGGCTCAAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTG
GAGGAGATTGAGAAGGAGCGAGACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAG
TACCGCAAGCAGGTGCGGGGCCTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAG
GTTCAGCTGCAGCGGGCCCAGGGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGC
CTGAGCGAGTTCCCCTCCCCTCTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAA
GCCACAGACAGTGAAAAGGAGATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAA
GACCCCGCACCCCCTAAGAGATCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCG
TCCTCATCCTCTGACAGCGTGTGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTG
GCTATTCGGGTGTCTGGCCGGAGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGG
TCTGGGGCTGTGGTGCGCAGGGTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAG
GGGGCGTGCCTGGAAGCCGAGGCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGC
CAGTCCTTCCACGAGGCCCTAGAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGG
GCAGATCCCCATGCCCTTTGCGTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACC
CGGGTTGACCCCCTCACTCTGCGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAA
TGCCTGCCCTCCAGCCGGCACCGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTG
GGGGCGCCTGCAGGGGACTCCCCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGG
CCGCTACTGGTGTCTGCCCTGCGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGC
TCCCGGCTGGACTTCCAAGTGTGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAG
CCTGCCACCCCTGGGCTAGGCAGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGT
GTGCGGGAGCTGGTGCAGAACGAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTG
GGCCGGCCGGGCTGGCGGGACTCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAG
GTGCCCGCCCATGAGTGGGGACACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTG

>In-frame_LRRFIP1_ENST00000289175_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_3447nt
ATGACCAGCCCCGCGGCCGCTCAAAGCCGGGAGATCGACTGTTTGAGCCCGGAAGCGCAGAAGCTGGCGGAAGCCCGGCTCGCTGCAAAA
CGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGGTAGAAGAGAGACCAGAAAAAGATTTT
ACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGTGGGACTTCCTCTCGGAGAGGCAGCGGAGAC
ACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCTATGGTT
TCCAATGCTCAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAACAGCTG
GCTGAATCTAGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTTCAGTTTGCTGAA
GTCAAGGAGGCCCTGAAGCAAAGAGAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACCAATGGAGAGACTTCC
GACACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTA
GATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAG
CAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGC
TGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCA
CAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGTCGGCTG
GAGGAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGGAGCCA
GACAATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAGCAGGAG
GCGAGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGGCAGGAG
CTGTGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAGATGGAAGACCTGCGG
CTCAAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAGAAGGAG
CGAGACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAGGTGCGG
GGCCTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAGCGGGCC
CAGGGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTCCCCTCC
CCTCTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCCACAGACAGTGAAAAG
GAGATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCCCCTAAG
AGATCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCTGACAGC
GTGTGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTGTCTGGC
CGGAGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTGGTGCGC
AGGGTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTGGAAGCC
GAGGCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCACGAGGCC
CTAGAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCAGATCCCCATGCCCTT
TGCGTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCCCTCACT
CTGCGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCCAGCCGG
CACCGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCAGGGGAC
TCCCCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTGTCTGCC
CTGCGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGACTTCCAA
GTGTGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCTGGGCTA
GGCAGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTGGTGCAG
AACGAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGCTGGCGG
GACTCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCATGAGTGG
GGACACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGCAGCAGA

>In-frame_LRRFIP1_ENST00000244815_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_3543nt
ATGACCAGCCCCGCGGCCGCTCAAAGCCGGGAGATCGACTGTTTGAGCCCGGAAGCGCAGAAGCTGGCGGAAGCCCGGCTCGCTGCAAAA
CGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGGAAGACAGTGAGCGCTACTCTCGTAGA
TCCAGAAGAAACACATCGGCTTCTGATGAAGACGAGCGCATGTCAGTGGGTAGTCGTGGAAGCCTGAGGGTAGAAGAGAGACCAGAAAAA
GATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGTGGGACTTCCTCTCGGAGAGGCAGC
GGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCT
ATGGTTTCCAATGCTCAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAA
CAGCTGGCTGAATCTAGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTTCAGTTT
GCTGAAGTCAAGGAGGCCCTGAAGCAAAGAGAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACCAATGGAGAG
ACTTCCGACACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGG
ACCCTAGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAG
CGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAG
GAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGC
CTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGT
CGGCTGGAGGAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAG
GAGCCAGACAATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAG
CAGGAGGCGAGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGG
CAGGAGCTGTGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAGATGGAAGAC
CTGCGGCTCAAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAG
AAGGAGCGAGACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAG
GTGCGGGGCCTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAG
CGGGCCCAGGGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTC
CCCTCCCCTCTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCCACAGACAGT
GAAAAGGAGATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCC
CCTAAGAGATCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCT
GACAGCGTGTGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTG
TCTGGCCGGAGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTG
GTGCGCAGGGTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTG
GAAGCCGAGGCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCAC
GAGGCCCTAGAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCAGATCCCCAT
GCCCTTTGCGTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCC
CTCACTCTGCGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCC
AGCCGGCACCGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCA
GGGGACTCCCCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTG
TCTGCCCTGCGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGAC
TTCCAAGTGTGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCT
GGGCTAGGCAGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTG
GTGCAGAACGAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGC
TGGCGGGACTCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCAT
GAGTGGGGACACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGC

>In-frame_LRRFIP1_ENST00000392000_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_3615nt
ATGACCAGCCCCGCGGCCGCTCAAAGCCGGGAGATCGACTGTTTGAGCCCGGAAGCGCAGAAGCTGGCGGAAGCCCGGCTCGCTGCAAAA
CGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGGAAGACAGTGAGCGCTACTCTCGTAGA
TCCAGAAGAAACACATCGGCTTCTGATGAAGACGAGCGCATGTCAGTGGGTAGTCGTGGAAGCCTGAGGGTAGAAGAGAGACCAGAAAAA
GATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGTGGGACTTCCTCTCGGAGAGGCAGC
GGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGAACTCAATGAGTTAAAGGACCAGATTCAGGATGTAGAA
GGCAAATACATGCAGGGATTGAAAGAGATGAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCTATGGTTTCCAATGCTCAG
CTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAACAGCTGGCTGAATCTAGG
CGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTTCAGTTTGCTGAAGTCAAGGAGGCC
CTGAAGCAAAGAGAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACCAATGGAGAGACTTCCGACACCCTCAAT
AATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTAGATGAGGAGGGG
CCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAGCAGCAACTGCAG
GCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGCTGTCAACGGCTG
CGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCACAGCTCAGTGAG
GAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGTCGGCTGGAGGAAGAGTGT
GCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGGAGCCAGACAATGTGGAC
CTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAGCAGGAGGCGAGCCGGCCG
GGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGGCAGGAGCTGTGCCAGAAG
CTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAGATGGAAGACCTGCGGCTCAAGCACCGC
ACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAGAAGGAGCGAGACCAGGCC
ATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAGGTGCGGGGCCTGGAGGCG
GAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAGCGGGCCCAGGGTGGCACC
TGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTCCCCTCCCCTCTGGGAGGC
CCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCCACAGACAGTGAAAAGGAGATCAATCGG
CTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCCCCTAAGAGATCCTTCAGC
AGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCTGACAGCGTGTGGCCTTTG
GGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTGTCTGGCCGGAGCCCCCCA
GGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTGGTGCGCAGGGTGCTGTCT
GGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTGGAAGCCGAGGCCCAGCAG
AGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCACGAGGCCCTAGAAGCCTGG
GCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCAGATCCCCATGCCCTTTGCGTGAAAGCC
CAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCCCTCACTCTGCGGGACCTG
GACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCCAGCCGGCACCGAGGCCCC
CGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCAGGGGACTCCCCGGATCAG
CTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTGTCTGCCCTGCGGCCCGTG
GTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGACTTCCAAGTGTGCCCAGCG
GAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCTGGGCTAGGCAGCAGGATC
CGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTGGTGCAGAACGAGATCTAC
CCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGCTGGCGGGACTCAGAGCTG
CTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCATGAGTGGGGACACGCAGAG
GAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGCAGCAGAGGCTGCCCCAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_LRRFIP1_ENST00000308482_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_5051nt
GGGGCCGGGCCGGGGCGGCGCGAGCGGCTGGAGCAACGGGCCCCGCGGCAGCTGCGGGCGACGCGGTCGATGGACATGGGCACCCAGGGA
TCGGGGCGCAAGCGGCTCCCCAACCGGGAGCGGCTCACGGCGGAGGACGACGCGCTCAACCAGATCGCGCGGGAGGCGGAAGCCCGGCTC
GCTGCAAAACGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGATCTATCAGGTCCAAAAG
AAATATTATGGGCTGGATACAAAATGGGGTGACATCGAGCAGTGGATGGAAGACAGTGAGCGCTACTCTCGTAGATCCAGAAGAAACACA
TCGGCTTCTGATGAAGACGAGCGCATGTCAGTGGGTAGTCGTGGAAGCCTGAGGTCGCAGCCTGACTTGGAGTATGGGGGTCCTTACGCC
TGGACAAATGGTTATGATGGAGAATTGTATGGATCACAGTCCCTGAATAGAAGATCTGGCAGGCCCTCCTGTCTGTACAGCGCTGCCCGG
CCTTCGGGGAGTTACCGGGCGTCTGTGTTGGATGAAGGCAGCTTCGGTGGGACCCGACGGGGCAGCACCTCCGGCTCCCGTGCTCCCTCG
GAGTACAGCGGCCACCTCAACTCCAGCTCCCGCGCCTCCTCCAGGGCCAGCTCGGCCCGGGCCAGCCCTGTGGTAGAAGAGAGACCAGAA
AAAGATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGTGGGACTTCCTCTCGGAGAGGC
AGCGGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGAACTCAATGAGTTAAAGGACCAGATTCAGGATGTA
GAAGGCAAATACATGCAGGGATTGAAAGAGATGAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCTATGGTTTCCAATGCT
CAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAACAGCTGGCTGAATCT
AGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTTCAGTTTGCTGAAGTCAAGGAG
GCCCTGAAGCAAAGAGAGGAAATGCTCGAGGAAATCCGACAGCTACAGCAGAAACAGGCGAGTTCTATCAGGGAGATTTCTGATCTTCAG
GAAACAATAGAGTGGAAAGACAAAAAGATAGGGGCATTAGAGAGGCAGAAAGAGTTCTTTGATTCCGTAAGGAGTGAACGGGATGATCTT
AGAGAAGAAGTAGTCATGCTGAAAGAGGAATTAAAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACCAATGGAGAGACTTCCGAC
ACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTAGAT
GAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAGCAG
CAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGCTGT
CAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCACAG
CTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGTCGGCTGGAG
GAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGGAGCCAGAC
AATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAGCAGGAGGCG
AGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGGCAGGAGCTG
TGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAGATGGAAGACCTGCGGCTC
AAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAGAAGGAGCGA
GACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAGGTGCGGGGC
CTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAGCGGGCCCAG
GGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTCCCCTCCCCT
CTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCCACAGACAGTGAAAAGGAG
ATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCCCCTAAGAGA
TCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCTGACAGCGTG
TGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTGTCTGGCCGG
AGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTGGTGCGCAGG
GTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTGGAAGCCGAG
GCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCACGAGGCCCTA
GAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCAGATCCCCATGCCCTTTGC
GTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCCCTCACTCTG
CGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCCAGCCGGCAC
CGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCAGGGGACTCC
CCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTGTCTGCCCTG
CGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGACTTCCAAGTG
TGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCTGGGCTAGGC
AGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTGGTGCAGAAC
GAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGCTGGCGGGAC
TCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCATGAGTGGGGA
CACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGCAGCAGAGGC
TGCCCCAGCAGCAGTGAGGCCTGAGGCTCATCTGATACCTGCACCTTCTCCCCAAGCCAGCGTGGACCCTGGTGTCTATGGTGAAGCTGG
GCCCTCCCACCCTGAGCCTTCCTAGACCCTTGGACTCTCAGATGCAGGGCCCTTGGCTCTGGCCTCTCACCCCCAAGGCTGTCTCTGGCC
CTGCCGAGCCTATGGGAGTCCCGGGACAGAGTGCCCACTCCCCTCTACTTGCTGCTCTGGGCCTCCCCACCTTTCCTGGGGTCTCCACAT
TCCCACTAGTGGGTCTTATGTGTGTCTGTGTCTTCTCCTTAAACACTCGCCCTGGAGTCTGTTCTCACACCTGTGCGCAGGTTTGCACAC
TCAAGTTCTCATGGGCAGGCTCAGGTCTGTCCCGCTGCCCTGGGCACGAGGTCTCCTGAGGACCTGGGCCTGTTCTGCTCCTAGGAGACC
TGAGCCCGTTACCGCGTGACTCCCACCATCCAGCTCGCGCTCCTCGTGGATTCAGCCATGCATGGACTGGGGTGTTCCCTGGCCCATGGT
CACCTGTGCCCCTCGTGTCTCCTCACATGGGTGTCTGTGGTTCTCTCCTGTGTAAATGTCACGCCCCACCCCTGTTTCATGTGGGCACTA
ACACGTGTGCGTTCCTGGCGGGCACACTCAGGACCGTGCCTCACAGGGCCCACTCCCTGCCTATGCCTCCCTCTTGGGGGGCCGAGGAGG
GCGGCTGCTCTGTCATGAGAATGTACGGCCCGTGGATGATTAACGGGCCTTTTTCACTTAGAAGCTGCACATTATGGAGCATTAAACACT

>In-frame_LRRFIP1_ENST00000289175_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_4555nt
GCGTGGGGGGCGGGGCGGGCCGTGGGACGGGCGGAGGCGCCCGAGTCCCGCTTCCCCGGCGCCCTTCCACCCCGAGCCCGACTCAGCCCG
CGGCCACCTGCGCCCCGCCCCTGTCGGCCGCGCCCGAGCCCAGCGCCGCGAGCCGCTCCCCGGCGGGCTGGCTCCTGGCCCCGGAAGCGC
GAGCGTTCACTTAGCGGCGAGTGGCTCCGTCTCCGCGGACAGAGCGCGCGCCCCCTGGCCCGGCCCGCGAGGGGCTCCCGGCGCGGTCCC
CGAGCATTTCCCGCCGGGTGGAGCGGGCCGAGCCCGGCAGGATGACCAGCCCCGCGGCCGCTCAAAGCCGGGAGATCGACTGTTTGAGCC
CGGAAGCGCAGAAGCTGGCGGAAGCCCGGCTCGCTGCAAAACGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGC
GGCAGCAGAAGGAGGTAGAAGAGAGACCAGAAAAAGATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGG
CCTCTCTGGGTGGGACTTCCTCTCGGAGAGGCAGCGGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGACT
CTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCTATGGTTTCCAATGCTCAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTG
ATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAACAGCTGGCTGAATCTAGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGG
AAAAACACGCCCACAGTATACTGCAATTTCAGTTTGCTGAAGTCAAGGAGGCCCTGAAGCAAAGAGAGGAAATGCTCGAGAAACATGGAA
TAATCCTAAATTCAGAAATAGCTACCAATGGAGAGACTTCCGACACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAG
AAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTAGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGC
GACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGC
TGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGC
GGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGC
AGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGTCGGCTGGAGGAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGG
CAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGGAGCCAGACAATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGA
CGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAGCAGGAGGCGAGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCC
TAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGGCAGGAGCTGTGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGG
AGCTGCGCGACCAGTACCTGCAGGAGATGGAAGACCTGCGGCTCAAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCA
TGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAGAAGGAGCGAGACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCAC
AGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAGGTGCGGGGCCTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGG
AGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAGCGGGCCCAGGGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCT
CCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTCCCCTCCCCTCTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGAC
CTGAGCCTCACAACTCGGAGGAAGCCACAGACAGTGAAAAGGAGATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCA
TCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCCCCTAAGAGATCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGC
CCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCTGACAGCGTGTGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCC
TGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTGTCTGGCCGGAGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGAC
TGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTGGTGCGCAGGGTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAA
GGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTGGAAGCCGAGGCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCT
CCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCACGAGGCCCTAGAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTG
CCAACCTCACCTTGCCTGAGAGGGCAGATCCCCATGCCCTTTGCGTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGC
GGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCCCTCACTCTGCGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGC
AGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCCAGCCGGCACCGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGC
GGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCAGGGGACTCCCCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCC
TCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTGTCTGCCCTGCGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCC
GTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGACTTCCAAGTGTGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAG
CGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCTGGGCTAGGCAGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCC
TGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTGGTGCAGAACGAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATG
TCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGCTGGCGGGACTCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGG
GGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCATGAGTGGGGACACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGG
AGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGCAGCAGAGGCTGCCCCAGCAGCAGTGAGGCCTGAGGCTCATCTGATACCTGCACCT
TCTCCCCAAGCCAGCGTGGACCCTGGTGTCTATGGTGAAGCTGGGCCCTCCCACCCTGAGCCTTCCTAGACCCTTGGACTCTCAGATGCA
GGGCCCTTGGCTCTGGCCTCTCACCCCCAAGGCTGTCTCTGGCCCTGCCGAGCCTATGGGAGTCCCGGGACAGAGTGCCCACTCCCCTCT
ACTTGCTGCTCTGGGCCTCCCCACCTTTCCTGGGGTCTCCACATTCCCACTAGTGGGTCTTATGTGTGTCTGTGTCTTCTCCTTAAACAC
TCGCCCTGGAGTCTGTTCTCACACCTGTGCGCAGGTTTGCACACTCAAGTTCTCATGGGCAGGCTCAGGTCTGTCCCGCTGCCCTGGGCA
CGAGGTCTCCTGAGGACCTGGGCCTGTTCTGCTCCTAGGAGACCTGAGCCCGTTACCGCGTGACTCCCACCATCCAGCTCGCGCTCCTCG
TGGATTCAGCCATGCATGGACTGGGGTGTTCCCTGGCCCATGGTCACCTGTGCCCCTCGTGTCTCCTCACATGGGTGTCTGTGGTTCTCT
CCTGTGTAAATGTCACGCCCCACCCCTGTTTCATGTGGGCACTAACACGTGTGCGTTCCTGGCGGGCACACTCAGGACCGTGCCTCACAG
GGCCCACTCCCTGCCTATGCCTCCCTCTTGGGGGGCCGAGGAGGGCGGCTGCTCTGTCATGAGAATGTACGGCCCGTGGATGATTAACGG

>In-frame_LRRFIP1_ENST00000244815_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_4580nt
CCGAGCCCGACTCAGCCCGCGGCCACCTGCGCCCCGCCCCTGTCGGCCGCGCCCGAGCCCAGCGCCGCGAGCCGCTCCCCGGCGGGCTGG
CTCCTGGCCCCGGAAGCGCGAGCGTTCACTTAGCGGCGAGTGGCTCCGTCTCCGCGGACAGAGCGCGCGCCCCCTGGCCCGGCCCGCGAG
GGGCTCCCGGCGCGGTCCCCGAGCATTTCCCGCCGGGTGGAGCGGGCCGAGCCCGGCAGGATGACCAGCCCCGCGGCCGCTCAAAGCCGG
GAGATCGACTGTTTGAGCCCGGAAGCGCAGAAGCTGGCGGAAGCCCGGCTCGCTGCAAAACGGGCGGCCCGCGCGGAGGCTCGCGAGATC
CGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGGAAGACAGTGAGCGCTACTCTCGTAGATCCAGAAGAAACACATCGGCTTCTGATGAA
GACGAGCGCATGTCAGTGGGTAGTCGTGGAAGCCTGAGGGTAGAAGAGAGACCAGAAAAAGATTTTACTGAGAAGGGGTCTCGTAACATG
CCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTGGGTGGGACTTCCTCTCGGAGAGGCAGCGGAGACACCTCCATCTCCATCGACACCGAG
GCATCCATCAGGGAAATCAAGGACTCTCTAGCAGAAGTTGAAGAGAAATATAAGAAGGCTATGGTTTCCAATGCTCAGCTAGACAATGAA
AAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAGCTTGAAGAACAGCTGGCTGAATCTAGGCGGCAGTACGAA
GAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAATTTCAGTTTGCTGAAGTCAAGGAGGCCCTGAAGCAAAGA
GAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACCAATGGAGAGACTTCCGACACCCTCAATAATGTTGGATAC
CAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTAGATGAGGAGGGGCCTGAGGGCCTG
ACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGCCAGCTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGG
GTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAGCAGGCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGG
GAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATCGCCATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCG
GCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTCAAAGTGAGTCGGCTGGAGGAAGAGTGTGCACTGCTTCGA
AGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAGAAGGAGAAGGAGCCAGACAATGTGGACCTTGTCTCTGAG
CTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAGGGCCTGCAGCAGGAGGCGAGCCGGCCGGGGGCCCCGGGC
TCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAGGACAGCAGGCAGGAGCTGTGCCAGAAGCTGCATGCCGTG
CAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAGATGGAAGACCTGCGGCTCAAGCACCGCACGCTGCAGAAG
GACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAGGAGATTGAGAAGGAGCGAGACCAGGCCATCCAGAGCCGT
GACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTACCGCAAGCAGGTGCGGGGCCTGGAGGCGGAGCGGGATGAG
CTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTTCAGCTGCAGCGGGCCCAGGGTGGCACCTGCCTCAAGGCC
TGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTGAGCGAGTTCCCCTCCCCTCTGGGAGGCCCAGAAGCAACT
GGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCCACAGACAGTGAAAAGGAGATCAATCGGCTCTCCATCCTG
CCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGACCCCGCACCCCCTAAGAGATCCTTCAGCAGCATGTCAGAC
ATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCCTCATCCTCTGACAGCGTGTGGCCTTTGGGAAAGCCGGAA
GGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCTATTCGGGTGTCTGGCCGGAGCCCCCCAGGGGGCCCAGAG
CCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCTGGGGCTGTGGTGCGCAGGGTGCTGTCTGGGCCTGGGTCC
GCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGGGCGTGCCTGGAAGCCGAGGCCCAGCAGAGAACCTTGCTC
TGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAGTCCTTCCACGAGGCCCTAGAAGCCTGGGCAAAGGGACCA
GGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCAGATCCCCATGCCCTTTGCGTGAAAGCCCAAGAGATCCTT
CGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGGGTTGACCCCCTCACTCTGCGGGACCTGGACCGGGGCACC
GTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGCCTGCCCTCCAGCCGGCACCGAGGCCCCCGCAGTAATCTG
AAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGGGCGCCTGCAGGGGACTCCCCGGATCAGCTGCTGCTGGAG
CCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCGCTACTGGTGTCTGCCCTGCGGCCCGTGGTGCTGTTGCCT
GAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCCCGGCTGGACTTCCAAGTGTGCCCAGCGGAAAGCCTCTCT
GGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCTGCCACCCCTGGGCTAGGCAGCAGGATCCGGGCCATCCAG
GAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTGCGGGAGCTGGTGCAGAACGAGATCTACCCCATCGTCATC
CACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGCCGGCCGGGCTGGCGGGACTCAGAGCTGCTGCGGCAGTGC
CGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTGCCCGCCCATGAGTGGGGACACGCAGAGGAGCTGGCCAAG
GTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAGTGCGGCAGCAGCAGAGGCTGCCCCAGCAGCAGTGAGGCC
TGAGGCTCATCTGATACCTGCACCTTCTCCCCAAGCCAGCGTGGACCCTGGTGTCTATGGTGAAGCTGGGCCCTCCCACCCTGAGCCTTC
CTAGACCCTTGGACTCTCAGATGCAGGGCCCTTGGCTCTGGCCTCTCACCCCCAAGGCTGTCTCTGGCCCTGCCGAGCCTATGGGAGTCC
CGGGACAGAGTGCCCACTCCCCTCTACTTGCTGCTCTGGGCCTCCCCACCTTTCCTGGGGTCTCCACATTCCCACTAGTGGGTCTTATGT
GTGTCTGTGTCTTCTCCTTAAACACTCGCCCTGGAGTCTGTTCTCACACCTGTGCGCAGGTTTGCACACTCAAGTTCTCATGGGCAGGCT
CAGGTCTGTCCCGCTGCCCTGGGCACGAGGTCTCCTGAGGACCTGGGCCTGTTCTGCTCCTAGGAGACCTGAGCCCGTTACCGCGTGACT
CCCACCATCCAGCTCGCGCTCCTCGTGGATTCAGCCATGCATGGACTGGGGTGTTCCCTGGCCCATGGTCACCTGTGCCCCTCGTGTCTC
CTCACATGGGTGTCTGTGGTTCTCTCCTGTGTAAATGTCACGCCCCACCCCTGTTTCATGTGGGCACTAACACGTGTGCGTTCCTGGCGG
GCACACTCAGGACCGTGCCTCACAGGGCCCACTCCCTGCCTATGCCTCCCTCTTGGGGGGCCGAGGAGGGCGGCTGCTCTGTCATGAGAA

>In-frame_LRRFIP1_ENST00000392000_chr2_238668848_+_CARD10_ENST00000403299_chr22_37912305_-_4529nt
CGGCGAGTGGCTCCGTCTCCGCGGACAGAGCGCGCGCCCCCTGGCCCGGCCCGCGAGGGGCTCCCGGCGCGGTCCCCGAGCATTTCCCGC
CGGGTGGAGCGGGCCGAGCCCGGCAGGATGACCAGCCCCGCGGCCGCTCAAAGCCGGGAGATCGACTGTTTGAGCCCGGAAGCGCAGAAG
CTGGCGGAAGCCCGGCTCGCTGCAAAACGGGCGGCCCGCGCGGAGGCTCGCGAGATCCGCATGAAGGAGCTGGAGCGGCAGCAGAAGGAG
GAAGACAGTGAGCGCTACTCTCGTAGATCCAGAAGAAACACATCGGCTTCTGATGAAGACGAGCGCATGTCAGTGGGTAGTCGTGGAAGC
CTGAGGGTAGAAGAGAGACCAGAAAAAGATTTTACTGAGAAGGGGTCTCGTAACATGCCGGGCCTGTCTGCAGCCACGCTGGCCTCTCTG
GGTGGGACTTCCTCTCGGAGAGGCAGCGGAGACACCTCCATCTCCATCGACACCGAGGCATCCATCAGGGAAATCAAGGAACTCAATGAG
TTAAAGGACCAGATTCAGGATGTAGAAGGCAAATACATGCAGGGATTGAAAGAGATGAAGGACTCTCTAGCAGAAGTTGAAGAGAAATAT
AAGAAGGCTATGGTTTCCAATGCTCAGCTAGACAATGAAAAGACAAACTTCATGTACCAGGTTGATACCCTAAAAGATATGTTGCTGGAG
CTTGAAGAACAGCTGGCTGAATCTAGGCGGCAGTACGAAGAGAAAAACAAAGAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAA
TTTCAGTTTGCTGAAGTCAAGGAGGCCCTGAAGCAAAGAGAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGCTACC
AATGGAGAGACTTCCGACACCCTCAATAATGTTGGATACCAAGGTCCTACCAAGATGACAAAAGAAGAGTTAAATGCCCTCAAGTCGACA
GGGGATGGGACCCTAGATGAGGAGGGGCCTGAGGGCCTGACCCAATTCTTGATGACAGAGGTGCGACGGCTGCGGGAAGCTCGCAAGAGC
CAGCTGCAGCGGGAGCAGCAACTGCAGGCCCGGGGCCGGGTGCTCGAGGAGGAGCGGGCAGGGCTGGAGCAGCGGCTGCGGGACCAGCAG
CAGGCTCAGGAGCGCTGTCAACGGCTGCGGGAGGACTGGGAGGCGGGCAGCCTGGAGCTGCTGCGGCTCAAGGATGAGAACTACATGATC
GCCATGCGCCTGGCACAGCTCAGTGAGGAGAAGAACTCGGCTGTACTTCGCAGCCGTGACCTGCAGCTGGCGGTGGATCAGCTCAAGCTC
AAAGTGAGTCGGCTGGAGGAAGAGTGTGCACTGCTTCGAAGGGCCAGGGGCCCGCCCCCTGGGGCAGAGGAGAAGGAGAAGGAGAAGGAG
AAGGAGAAGGAGCCAGACAATGTGGACCTTGTCTCTGAGCTGCGTGCTGAGAACCAGCGGCTGACGGCGTCACTGCGGGAGTTGCAGGAG
GGCCTGCAGCAGGAGGCGAGCCGGCCGGGGGCCCCGGGCTCCGAGCGCATCCTGCTGGACATCCTAGAGCATGACTGGCGGGAGGCGCAG
GACAGCAGGCAGGAGCTGTGCCAGAAGCTGCATGCCGTGCAGGGGGAGCTGCAGTGGGCCGAGGAGCTGCGCGACCAGTACCTGCAGGAG
ATGGAAGACCTGCGGCTCAAGCACCGCACGCTGCAGAAGGACTGTGACCTGTACAAGCACCGCATGGCCACTGTCCTGGCCCAACTGGAG
GAGATTGAGAAGGAGCGAGACCAGGCCATCCAGAGCCGTGACCGGATCCAGTTGCAGTACTCACAGAGCCTCATCGAGAAGGACCAGTAC
CGCAAGCAGGTGCGGGGCCTGGAGGCGGAGCGGGATGAGCTGCTGACAACGCTCACCAGCCTGGAGGGCACCAAGGCTCTGCTGGAGGTT
CAGCTGCAGCGGGCCCAGGGTGGCACCTGCCTCAAGGCCTGTGCCTCCTCCCATTCCCTGTGCTCCAACCTCAGCAGCACTTGGAGCCTG
AGCGAGTTCCCCTCCCCTCTGGGAGGCCCAGAAGCAACTGGGGAGGCAGCTGTCATGGGGGGACCTGAGCCTCACAACTCGGAGGAAGCC
ACAGACAGTGAAAAGGAGATCAATCGGCTCTCCATCCTGCCCTTCCCCCCCAGTGCCGGCTCCATCCTCCGCCGGCAGCGTGAGGAAGAC
CCCGCACCCCCTAAGAGATCCTTCAGCAGCATGTCAGACATCACAGGGAGTGTGACACTTAAGCCCTGGTCCCCTGGCCTCTCTTCGTCC
TCATCCTCTGACAGCGTGTGGCCTTTGGGAAAGCCGGAAGGCCTCCTGGCTCGGGGCTGTGGCCTGGACTTCCTCAACAGGTCTCTGGCT
ATTCGGGTGTCTGGCCGGAGCCCCCCAGGGGGCCCAGAGCCGCAGGACAAGGGACCAGATGGACTGTCGTTTTATGGGGACAGATGGTCT
GGGGCTGTGGTGCGCAGGGTGCTGTCTGGGCCTGGGTCCGCCAGGATGGAACCAAGAGAGCAAAGGGTGGAAGCTGCTGGTCTGGAGGGG
GCGTGCCTGGAAGCCGAGGCCCAGCAGAGAACCTTGCTCTGGAATCAGGGGTCCACACTCCCCTCCCTGATGGACTCGAAGGCCTGCCAG
TCCTTCCACGAGGCCCTAGAAGCCTGGGCAAAGGGACCAGGTGCCGAGCCCTTCTACATTCGTGCCAACCTCACCTTGCCTGAGAGGGCA
GATCCCCATGCCCTTTGCGTGAAAGCCCAAGAGATCCTTCGACTGGTGGACTCGGCATACAAGCGGAGGCAGGAATGGTTCTGCACCCGG
GTTGACCCCCTCACTCTGCGGGACCTGGACCGGGGCACCGTGCCCAATTATCAGAGAGCCCAGCAGCTCCTAGAAGTTCAGGAGAAATGC
CTGCCCTCCAGCCGGCACCGAGGCCCCCGCAGTAATCTGAAGAAGAGAGCCCTGGACCAGCTGCGGCTGGTGAGGCCCAAGCCCGTGGGG
GCGCCTGCAGGGGACTCCCCGGATCAGCTGCTGCTGGAGCCCTGTGCAGAGCCGGAGCGGAGCCTCAGACCCTACAGTTTGGTGCGGCCG
CTACTGGTGTCTGCCCTGCGGCCCGTGGTGCTGTTGCCTGAGTGCCTGGCGCCCCGGCTCATCCGTAACCTGCTAGACCTGCCCAGCTCC
CGGCTGGACTTCCAAGTGTGCCCAGCGGAAAGCCTCTCTGGGGAGGAACTGTGCCCATCCTCAGCGCCTGGAGCCCCCAAGGCTCAGCCT
GCCACCCCTGGGCTAGGCAGCAGGATCCGGGCCATCCAGGAGTCTGTTGGGAAGAAGCACTGCCTGCTGGAGCTGGGTGCTCGGGGTGTG
CGGGAGCTGGTGCAGAACGAGATCTACCCCATCGTCATCCACGTGGAGGTGACTGAGAAGAATGTCCGGGAAGTCAGGGGTCTGCTGGGC
CGGCCGGGCTGGCGGGACTCAGAGCTGCTGCGGCAGTGCCGTGGCTCAGAGCAGGTGCTCTGGGGGCTGCCCTGCTCCTGGGTGCAGGTG
CCCGCCCATGAGTGGGGACACGCAGAGGAGCTGGCCAAGGTGGTGCGCGGCCGCATCCTGCAGGAGCAGGCCCGCCTCGTGTGGGTGGAG
TGCGGCAGCAGCAGAGGCTGCCCCAGCAGCAGTGAGGCCTGAGGCTCATCTGATACCTGCACCTTCTCCCCAAGCCAGCGTGGACCCTGG
TGTCTATGGTGAAGCTGGGCCCTCCCACCCTGAGCCTTCCTAGACCCTTGGACTCTCAGATGCAGGGCCCTTGGCTCTGGCCTCTCACCC
CCAAGGCTGTCTCTGGCCCTGCCGAGCCTATGGGAGTCCCGGGACAGAGTGCCCACTCCCCTCTACTTGCTGCTCTGGGCCTCCCCACCT
TTCCTGGGGTCTCCACATTCCCACTAGTGGGTCTTATGTGTGTCTGTGTCTTCTCCTTAAACACTCGCCCTGGAGTCTGTTCTCACACCT
GTGCGCAGGTTTGCACACTCAAGTTCTCATGGGCAGGCTCAGGTCTGTCCCGCTGCCCTGGGCACGAGGTCTCCTGAGGACCTGGGCCTG
TTCTGCTCCTAGGAGACCTGAGCCCGTTACCGCGTGACTCCCACCATCCAGCTCGCGCTCCTCGTGGATTCAGCCATGCATGGACTGGGG
TGTTCCCTGGCCCATGGTCACCTGTGCCCCTCGTGTCTCCTCACATGGGTGTCTGTGGTTCTCTCCTGTGTAAATGTCACGCCCCACCCC
TGTTTCATGTGGGCACTAACACGTGTGCGTTCCTGGCGGGCACACTCAGGACCGTGCCTCACAGGGCCCACTCCCTGCCTATGCCTCCCT
CTTGGGGGGCCGAGGAGGGCGGCTGCTCTGTCATGAGAATGTACGGCCCGTGGATGATTAACGGGCCTTTTTCACTTAGAAGCTGCACAT


Top

FusionGenePPI for LRRFIP1_CARD10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LRRFIP1FLII, MYD88, DPY30, FKBP3, DYNC1H1, C14orf166, RTCB, DDX1, DHX9, EPRS, RPLP0, MRE11A, PRKDC, RFC2, LGR4, MED4, CEP44, RNF2, TMOD1, NTRK1, IFI16, SH2D2A, DBN1, IQGAP1, U2AF2, CDH1, TMOD3, TMOD4, TFR2, CCNB1, IFT74, TCEAL2, GAS2L1, MCTS1, BRCA1, SERPINB5CARD10BCL10, ATXN7, IKBKG, CARD10, KLHL12, GFOD1, CAPZA2, DBN1, MYO1C, KIF20A, MYO19, CDC5L, FAM167A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LRRFIP1_CARD10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LRRFIP1_CARD10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLRRFIP1C0023893Liver Cirrhosis, Experimental1CTD_human