FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20120

FusionGeneSummary for LRP1B_HECW2

check button Fusion gene summary
Fusion gene informationFusion gene name: LRP1B_HECW2
Fusion gene ID: 20120
HgeneTgene
Gene symbol

LRP1B

HECW2

Gene ID

53353

57520

Gene nameLDL receptor related protein 1BHECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
SynonymsLRP-1B|LRP-DIT|LRPDITNDHSAL|NEDL2
Cytomap

2q22.1-q22.2

2q32.3

Type of geneprotein-codingprotein-coding
Descriptionlow-density lipoprotein receptor-related protein 1BLRP-deleted in tumorslow density lipoprotein receptor related protein-deleted in tumorlow density lipoprotein receptor-related protein 1Blow density lipoprotein-related protein 1B (deleted in tumors)E3 ubiquitin-protein ligase HECW2HECT-type E3 ubiquitin transferase HECW2NEDD4-like E3 ubiquitin-protein ligase 2NEDD4-related E3 ubiquitin ligase NEDL2
Modification date2018051920180526
UniProtAcc

Q9NZR2

Q9P2P5

Ensembl transtripts involved in fusion geneENST00000389484, ENST00000486364, 
ENST00000260983, ENST00000409111, 
Fusion gene scores* DoF score7 X 7 X 3=1475 X 4 X 4=80
# samples 75
** MAII scorelog2(7/147*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LRP1B [Title/Abstract] AND HECW2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-22-5482-01ALRP1Bchr2

142567848

-HECW2chr2

197208488

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389484ENST00000260983LRP1Bchr2

142567848

-HECW2chr2

197208488

-
5CDS-5UTRENST00000389484ENST00000409111LRP1Bchr2

142567848

-HECW2chr2

197208488

-
5UTR-3CDSENST00000486364ENST00000260983LRP1Bchr2

142567848

-HECW2chr2

197208488

-
5UTR-5UTRENST00000486364ENST00000409111LRP1Bchr2

142567848

-HECW2chr2

197208488

-

Top

FusionProtFeatures for LRP1B_HECW2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LRP1B

Q9NZR2

HECW2

Q9P2P5

Potential cell surface proteins that bind andinternalize ligands in the process of receptor-mediatedendocytosis. E3 ubiquitin-protein ligase that mediates ubiquitinationof TP73. Acts to stabilize TP73 and enhance activation oftranscription by TP73 (PubMed:12890487). Involved in theregulation of mitotic metaphase/anaphase transition(PubMed:24163370). {ECO:0000269|PubMed:12890487,ECO:0000269|PubMed:24163370}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-29131_70684600DomainLDL-receptor class A 1
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-129847_874971573Coiled coilOntology_term=ECO:0000255
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-027847_874-2021217Coiled coilOntology_term=ECO:0000255
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-1291237_1572971573DomainHECT
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-129172_282971573DomainC2
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-129807_840971573DomainWW 1
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-129985_1018971573DomainWW 2
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-0271237_1572-2021217DomainHECT
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-027172_282-2021217DomainC2
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-027807_840-2021217DomainWW 1
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-027985_1018-2021217DomainWW 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911005_1043684600DomainLDL-receptor class A 7
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911052_1089684600DomainLDL-receptor class A 8
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911094_1132684600DomainLDL-receptor class A 9
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911135_1174684600DomainLDL-receptor class A 10
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291116_154684600DomainEGF-like 1
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911174_1213684600DomainEGF-like 5
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911214_1253684600DomainEGF-like 6
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911527_1570684600DomainEGF-like 7
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291155_194684600DomainEGF-like 2%3B calcium-binding
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911834_1875684600DomainEGF-like 8
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912143_2183684600DomainEGF-like 9
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912464_2504684600DomainEGF-like 10
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912509_2548684600DomainLDL-receptor class A 11
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912551_2587684600DomainLDL-receptor class A 12
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912590_2626684600DomainLDL-receptor class A 13
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912629_2675684600DomainLDL-receptor class A 14
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912681_2717684600DomainLDL-receptor class A 15
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912719_2757684600DomainLDL-receptor class A 16
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912760_2800684600DomainLDL-receptor class A 17
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912804_2841684600DomainLDL-receptor class A 18
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912844_2885684600DomainLDL-receptor class A 19
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912890_2926684600DomainLDL-receptor class A 20
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912927_2967684600DomainEGF-like 11
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912968_3008684600DomainEGF-like 12%3B calcium-binding
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913273_3314684600DomainEGF-like 13
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913316_3353684600DomainLDL-receptor class A 21
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913356_3392684600DomainLDL-receptor class A 22
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913395_3432684600DomainLDL-receptor class A 23
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913435_3472684600DomainLDL-receptor class A 24
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913475_3511684600DomainLDL-receptor class A 25
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913514_3550684600DomainLDL-receptor class A 26
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913552_3588684600DomainLDL-receptor class A 27
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913593_3629684600DomainLDL-receptor class A 28
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913631_3668684600DomainLDL-receptor class A 29
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913673_3711684600DomainLDL-receptor class A 30
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913714_3752684600DomainLDL-receptor class A 31
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913761_3797684600DomainLDL-receptor class A 32
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913801_3843684600DomainEGF-like 14
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913844_3881684600DomainEGF-like 15
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914171_4208684600DomainEGF-like 16
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914213_4249684600DomainEGF-like 17
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914249_4285684600DomainEGF-like 18
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914285_4321684600DomainEGF-like 19
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914321_4357684600DomainEGF-like 20
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914357_4392684600DomainEGF-like 21
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914390_4427684600DomainEGF-like 22
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291471_517684600DomainEGF-like 3
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-29176_114684600DomainLDL-receptor class A 2
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291794_834684600DomainEGF-like 4
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291844_882684600DomainLDL-receptor class A 3
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291885_923684600DomainLDL-receptor class A 4
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291926_963684600DomainLDL-receptor class A 5
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291966_1003684600DomainLDL-receptor class A 6
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914492_4495684600MotifEndocytosis signal
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914559_4562684600MotifEndocytosis signal
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911300_1346684600RepeatNote=LDL-receptor class B 8
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911347_1389684600RepeatNote=LDL-receptor class B 9
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911390_1436684600RepeatNote=LDL-receptor class B 10
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911437_1480684600RepeatNote=LDL-receptor class B 11
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911481_1522684600RepeatNote=LDL-receptor class B 12
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911618_1660684600RepeatNote=LDL-receptor class B 13
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911661_1704684600RepeatNote=LDL-receptor class B 14
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911705_1744684600RepeatNote=LDL-receptor class B 15
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911745_1787684600RepeatNote=LDL-receptor class B 16
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911922_1964684600RepeatNote=LDL-receptor class B 17
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2911965_2007684600RepeatNote=LDL-receptor class B 28
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912008_2051684600RepeatNote=LDL-receptor class B 19
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912052_2095684600RepeatNote=LDL-receptor class B 20
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912239_2280684600RepeatNote=LDL-receptor class B 21
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912281_2329684600RepeatNote=LDL-receptor class B 22
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912330_2374684600RepeatNote=LDL-receptor class B 23
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912375_2416684600RepeatNote=LDL-receptor class B 24
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2912417_2459684600RepeatNote=LDL-receptor class B 25
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291295_337684600RepeatNote=LDL-receptor class B 1
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913055_3098684600RepeatNote=LDL-receptor class B 26
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913099_3141684600RepeatNote=LDL-receptor class B 27
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913142_3185684600RepeatNote=LDL-receptor class B 28
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913186_3224684600RepeatNote=LDL-receptor class B 29
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913225_3268684600RepeatNote=LDL-receptor class B 30
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291338_381684600RepeatNote=LDL-receptor class B 2
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291382_425684600RepeatNote=LDL-receptor class B 3
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913933_3980684600RepeatNote=LDL-receptor class B 31
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2913981_4038684600RepeatNote=LDL-receptor class B 32
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914039_4082684600RepeatNote=LDL-receptor class B 33
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914083_4127684600RepeatNote=LDL-receptor class B 34
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291568_610684600RepeatNote=LDL-receptor class B 4
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291611_656684600RepeatNote=LDL-receptor class B 5
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291657_706684600RepeatNote=LDL-receptor class B 6
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-291707_750684600RepeatNote=LDL-receptor class B 7
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-29125_4444684600Topological domainExtracellular
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914468_4599684600Topological domainCytoplasmic
HgeneLRP1Bchr2:142567848chr2:197208488ENST00000389484-2914445_4467684600TransmembraneHelical


Top

FusionGeneSequence for LRP1B_HECW2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LRP1B_ENST00000389484_chr2_142567848_-_HECW2_ENST00000260983_chr2_197208488_-_1544aa
MSEFLLALLTLSGLLPIARVLTVGADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDTTENSPANFWDSKNRGVTGTQKG
QIVWRIEPGPTFMEPEIKICFKTYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLHSRKLVSFTLSDLRAVGLKKGMFFNPDPTL
KMSIQPGKKSSFPTCAHHGQERRSTIISNTTNPIWHREKTSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAIGDQML
SYNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGSPSDDEDMPGSHHDSQVCSNGPVSEDSAADGTPKHSFRTS
STLEIDTEELTSTSSRTSPPRGRQDSLNDYLDAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYP
SSLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESSLPAGPAPEEGEGGPEPQPSADQGSAELCG
SQEVDQPTSGADTGTSDASGGSRRAVSETESLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLECADSSCNESVTTQLSSVDTR
CSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEGAAAA
AESPPQEEGSAGEAQGTCEGATAQEEGATGGSQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPT
APPAPQVLQRSNSIQQMEQLNRRTQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRRENILPHSTSRSRITLLLQSPPVKFLISPE
FFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLP
LQSSRPTSALVHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNH
SLREKIQFIRTEGTPGLVRLSSDADLVMLLSLFEEEIMSTVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAKLRN
FYRKLETKGTGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLTVTFVGEEGLDYSGPSREFFFLVSRELFNPTTGLFETSANDTY
TVQISPMSAFVDNHHEWFRFSGRILGLALIHQTLLDAFFTRPFTKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEV
FGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFTEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTETRG
GYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPTEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLTEKL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LRP1B_ENST00000389484_chr2_142567848_-_HECW2_ENST00000260983_chr2_197208488_-_4632nt
ATGTCCGAGTTTCTCCTCGCCTTACTCACTCTCTCGGGATTATTGCCGATTGCCAGGGTGCTGACCGTGGGAGCCGACCGAGATCAGCAG
TTGTGTGATCCTGGTGAATTTCTTTGCCACGATCACGTGACTTGTGTCTCCCAGAGCTGGCTGTGTGATGGGGACCCTGACTGCCCTGAT
GATTCAGACGAGTCTTTAGATACCTATGAGAATTCTCCAGCCAACTTCTGGGATTCTAAGAACAGGGGTGTGACTGGAACACAAAAAGGG
CAAATTGTATGGAGAATTGAGCCTGGGCCCTATTTCATGGAACCGGAGATAAAAATCTGTTTTAAATATTACCACGGCATTAGTGGAGCC
CTGCGAGCCACGACCCCCTGCATCACCGTGAAGAACCCAGCTGTGATGATGGGGGCAGAAGGCATGGAGGGAGGTGCTTCAGGAAACCTG
CATTCTCGAAAACTTGTTAGCTTTACATTGTCAGATCTTAGGGCAGTTGGGCTAAAGAAAGGGATGTTCTTCAATCCTGACCCTTATCTT
AAGATGTCAATTCAGCCAGGAAAGAAGAGCAGTTTCCCCACCTGTGCCCACCACGGGCAGGAGAGACGGTCTACTATCATCAGTAACACC
ACCAATCCAATTTGGCACCGAGAGAAATATTCCTTTTTTGCACTTCTTACTGATGTCTTAGAAATTGAAATTAAAGACAAATTTGCCAAG
AGCCGTCCCATCATCAAGCGTTTTCTGGGGAAACTAACCATTCCAGTCCAGAGGCTGCTGGAGCGACAAGCCATCGGTGATCAAATGCTC
AGCTACAACCTTGGCAGAAGGCTCCCAGCTGACCACGTGAGTGGGTACCTCCAGTTTAAAGTGGAGGTTACGTCTTCTGTTCATGAAGAT
GCCTCTCCAGAAGCTGTTGGCACAATACTTGGAGTCAATTCTGTGAATGGAGACTTAGGTAGCCCTTCCGATGACGAGGACATGCCAGGG
AGCCATCACGACAGCCAGGTGTGCTCTAATGGGCCAGTTTCTGAGGACAGTGCTGCCGATGGAACCCCCAAGCATTCATTCAGGACTAGC
TCCACTCTGGAAATAGACACAGAGGAATTAACCTCTACGTCTTCAAGGACCTCACCTCCCAGAGGACGTCAGGATTCACTCAATGATTAC
TTAGATGCTATCGAACACAATGGCCACTCCAGGCCGGGGACAGCGACCTGCTCTGAGAGGTCCATGGGTGCCTCTCCGAAACTGAGGAGT
AGTTTTCCCACTGACACAAGACTCAATGCCATGCTTCATATTGATTCAGATGAAGAAGATCACGAGTTCCAGCAAGACCTGGGTTACCCA
TCTTCCTTGGAGGAGGAGGGAGGCCTGATCATGTTTAGCAGGGCATCCAGAGCTGATGATGGAAGCCTGACATCTCAGACAAAGCTGGAG
GACAACCCTGTTGAGAATGAGGAAGCCTCCACACACGAAGCTGCTTCCTTTGAGGATAAGCCAGAAAATCTTCCAGAGCTTGCAGAGAGC
TCCTTACCTGCAGGCCCAGCCCCAGAGGAAGGTGAAGGCGGCCCAGAGCCTCAACCCAGTGCTGACCAGGGCAGTGCTGAACTGTGTGGC
TCTCAAGAGGTAGATCAGCCCACAAGTGGCGCAGACACAGGGACTTCCGATGCATCAGGAGGAAGCCGAAGAGCCGTCAGTGAGACCGAG
TCTCTCGATCAGGGCTCTGAGCCTTCCCAGGTGTCCTCTGAAACAGAACCCAGTGATCCTGCCAGGACAGAGAGTGTGAGCGAAGCCAGC
ACCAGGCCTGAGGGAGAGAGTGACCTGGAATGCGCTGACAGCTCCTGCAATGAGAGTGTGACCACGCAGCTGTCCTCTGTGGACACACGG
TGCTCCTCTCTTGAGAGCGCACGGTTTCCTGAAACCCCAGCCTTTTCTTCTCAGGAGGAGGAAGACGGAGCCTGTGCAGCAGAGCCCACC
AGCAGTGGCCCTGCCGAAGGGTCGCAGGAATCCGTGTGCACTGCTGGTTCTTTACCTGTGGTACAGGTGCCCAGTGGGGAGGATGAAGGG
CCAGGGGCAGAATCGGCCACTGTACCTGACCAGGAGGAGCTGGGGGAGGTCTGGCAGCGGAGGGGGAGCCTGGAGGGAGCTGCAGCTGCT
GCCGAGAGCCCACCGCAAGAAGAAGGCAGTGCTGGGGAGGCCCAAGGCACCTGTGAAGGGGCAACTGCCCAGGAGGAGGGCGCTACTGGA
GGTTCTCAAGCCAACGGCCACCAGCCACTGCGATCACTACCTTCAGTGCGCCAGGATGTTAGCCGGTACCAGAGGGTGGACGAGGCTCTC
CCACCAAACTGGGAGGCACGCATTGACAGCCACGGCAGGATCTTCTACGTGGATCACGTAAACAGAACCACGACGTGGCAGCGACCGACA
GCTCCCCCAGCCCCGCAGGTGCTGCAGAGATCTAACTCCATACAGCAAATGGAGCAGCTGAACCGGCGATATCAGAGTATCCGCAGAACC
ATGACCAATGAGAGGCCTGAGGAAAATACCAATGCTATTGATGGGGCAGGGGAGGAAGCTGACTTTCACCAAGCCAGTGCAGATTTCCGA
CGGGAGAACATCCTGCCTCACTCTACCTCCAGATCCAGGATCACGTTGCTGTTACAGTCTCCCCCCGTGAAGTTCCTCATCAGCCCAGAG
TTCTTCACCGTGCTGCATTCTAACCCTAGTGCCTACCGCATGTTTACAAACAACACGTGTTTGAAGCACATGATCACCAAAGTCCGGAGG
GACACCCACCACTTTGAACGCTACCAGCATAACCGCGACCTTGTGGGATTCCTCAACATGTTCGCGAACAAACAGCTAGAGCTGCCGCGG
GGATGGGAAATGAAACATGATCACCAGGGCAAGGCATTCTTTGTGGACCACAACTCCCGCACCACCACTTTCATTGATCCCCGGCTCCCA
CTTCAGAGCAGTAGACCCACAAGTGCGCTGGTTCATCGGCAACACCTGACAAGGCAACGCAGCCACAGTGCGGGTGAGGTAGGAGAAGAT
TCTCGACATGCAGGACCACCAGTTCTTCCCAGGCCATCCAGTACATTCAATACAGTCAGTAGGCCACAGTACCAGGACATGGTTCCAGTG
GCTTACAATGACAAGATTGTTGCATTTCTACGTCAACCCAATATCTTTGAAATTCTACAGGAGCGTCAACCTGATCTTACCAGGAATCAC
TCACTCAGGGAGAAGATCCAATTTATCCGAACTGAAGGGACTCCAGGATTGGTGCGCCTTTCAAGCGATGCAGACCTTGTTATGTTGCTG
AGCTTATTTGAAGAAGAGATAATGTCGTATGTGCCTCCACATGCCTTACTCCACCCCAGCTACTGTCAGTCCCCACGTGGCTCTCCCGTG
TCATCTCCTCAGAACTCGCCAGGTACCCAGCGTGCCAATGCCCGGGCTCCAGCCCCTTACAAGCGGGATTTCGAAGCCAAACTGAGGAAC
TTTTACAGGAAGTTAGAGACTAAAGGATATGGACAAGGCCCAGGGAAGTTAAAGTTAATTATCCGAAGAGATCACTTACTAGAAGATGCT
TTTAATCAGATTATGGGCTACTCCAGAAAAGACCTGCAGAGAAATAAGCTATATGTCACCTTCGTTGGGGAGGAAGGGCTGGATTACAGT
GGGCCTTCTAGAGAGTTTTTCTTCCTGGTATCCAGAGAACTCTTTAACCCATATTATGGCTTATTTGAATATTCAGCCAATGACACATAC
ACAGTACAAATAAGTCCTATGTCTGCTTTTGTAGACAATCACCATGAATGGTTCCGATTCAGTGGTAGGATCCTTGGTCTTGCACTAATA
CACCAGTATTTGTTGGATGCCTTCTTCACACGGCCCTTTTATAAGGCTCTTCTCAGAATTCTATGTGACCTGAGTGACCTAGAATACCTT
GATGAAGAGTTCCATCAGAGCCTGCAGTGGATGAAAGACAATGATATCCATGACATCCTAGACCTCACGTTCACTGTGAACGAAGAAGTA
TTTGGGCAGATAACTGAACGAGAATTAAAGCCAGGGGGTGCCAATATCCCAGTTACAGAGAAGAACAAGAAGGAGTACATCGAGAGGATG
GTGAAGTGGAGGATTGAGAGGGGTGTTGTACAGCAAACAGAGAGCTTAGTGCGTGGCTTCTATGAGGTGGTGGATGCCAGGCTGGTATCT
GTTTTTGATGCAAGAGAACTGGAATTGGTCATCGCAGGCACAGCTGAAATAGACCTAAGTGATTGGAGAAACAACACAGAATATAGAGGA
GGATACCATGACAATCATATTGTAATTCGGTGGTTCTGGGCTGCAGTGGAAAGATTCAACAATGAACAACGACTAAGGTTGTTACAGTTT
GTTACAGGCACATCCAGCATTCCCTATGAAGGATTTGCTTCACTCCGAGGGAGTAACGGCCCAAGAAGATTCTGTGTGGAGAAATGGGGG
AAAATCACTGCTCTTCCCAGAGCGCATACATGTTTTAACCGTCTGGATCTGCCTCCCTACCCATCCTTTTCCATGCTTTATGAAAAACTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LRP1B_ENST00000389484_chr2_142567848_-_HECW2_ENST00000260983_chr2_197208488_-_12511nt
AAAGACAGAACCCCAGAGAAAAACGCTGCCAATTCGTTGCTTTATTGTTCCCTGCCTGGGGACCTCAATAGCCTTTTCCATTAACCTTCC
CTTCTTACGCAACGGTTAATGACTTTGGGGGTTGTTTTGCTTTCTGTTTCTGCTGAGTCACTAAATTTTGCCTCTTTGTCCCCAGGTGCT
GCTCAGCATAAAAGTTAAAAGTGCAATTCAGGAAGTACTGGGATTCTGTGTAGAGCCGAGGAAACCATTTCCCTAAGAGAAGCTCTGTTC
CTTGGCTTGTCCTTCCTTCCCGGGAAGGAAGCTTCCGAGGAACGAAGGGAGAAGCTTTGTTTTGCCTGCAGAAGCAGCCCTGTGCTCGGC
TGAGGGTTCTCAGCTGGCTGTGAACTGCGGAGCATTGTAGGCGCCTGGCTGGCTCAGGCCAATGCAGAAGTCTCTCCCTTCTCCAAAGAC
CCAAATCCCCACAGAACCAGCTTCGAGTTACTTTCCCTTCAAGGGGATTAAAATAATTGTGATTTGTGGCGCTCTCCGTTCGCGGTGGTA
TTTTCCTGTTGTGTTAAATGCCTCTTATTAAGTAATAGATGTGATTTATGTGAACGACGAAGGGGTGTGTGGTGGATTCGGTGATTAATC
AGTGAATTCCCATCCGCTGGCATCTCTCACTGCCCCTCTTGCGTGATGTAAGATCAGACGTACCCTGCATTGAAAAGTCAAGACACACGG
GCGTCTCGCTCGCGCTCACACACGCTCTGCCTCCTCTCTCCCGCACGCGCGCATCCCTCCACCTTCCACATCCTGCTCCAGGCAGGAGAA
GGCTGACTGGCTGGACTCATTGAGCTGAAGAATTTCCAGTGACATTTGTAAATGACGCCGCTCGATTCCAGGCTCCAAGCGGCCCCTGCC
GCCGCCGCCGCCGCCGGGCCGAAGGTGCCGCCGAGCAGTCTCCAGCGCAGGCTTCCTTACCGGGCGACCACAATGTCCGAGTTTCTCCTC
GCCTTACTCACTCTCTCGGGATTATTGCCGATTGCCAGGGTGCTGACCGTGGGAGCCGACCGAGATCAGCAGTTGTGTGATCCTGGTGAA
TTTCTTTGCCACGATCACGTGACTTGTGTCTCCCAGAGCTGGCTGTGTGATGGGGACCCTGACTGCCCTGATGATTCAGACGAGTCTTTA
GATACCTATGAGAATTCTCCAGCCAACTTCTGGGATTCTAAGAACAGGGGTGTGACTGGAACACAAAAAGGGCAAATTGTATGGAGAATT
GAGCCTGGGCCCTATTTCATGGAACCGGAGATAAAAATCTGTTTTAAATATTACCACGGCATTAGTGGAGCCCTGCGAGCCACGACCCCC
TGCATCACCGTGAAGAACCCAGCTGTGATGATGGGGGCAGAAGGCATGGAGGGAGGTGCTTCAGGAAACCTGCATTCTCGAAAACTTGTT
AGCTTTACATTGTCAGATCTTAGGGCAGTTGGGCTAAAGAAAGGGATGTTCTTCAATCCTGACCCTTATCTTAAGATGTCAATTCAGCCA
GGAAAGAAGAGCAGTTTCCCCACCTGTGCCCACCACGGGCAGGAGAGACGGTCTACTATCATCAGTAACACCACCAATCCAATTTGGCAC
CGAGAGAAATATTCCTTTTTTGCACTTCTTACTGATGTCTTAGAAATTGAAATTAAAGACAAATTTGCCAAGAGCCGTCCCATCATCAAG
CGTTTTCTGGGGAAACTAACCATTCCAGTCCAGAGGCTGCTGGAGCGACAAGCCATCGGTGATCAAATGCTCAGCTACAACCTTGGCAGA
AGGCTCCCAGCTGACCACGTGAGTGGGTACCTCCAGTTTAAAGTGGAGGTTACGTCTTCTGTTCATGAAGATGCCTCTCCAGAAGCTGTT
GGCACAATACTTGGAGTCAATTCTGTGAATGGAGACTTAGGTAGCCCTTCCGATGACGAGGACATGCCAGGGAGCCATCACGACAGCCAG
GTGTGCTCTAATGGGCCAGTTTCTGAGGACAGTGCTGCCGATGGAACCCCCAAGCATTCATTCAGGACTAGCTCCACTCTGGAAATAGAC
ACAGAGGAATTAACCTCTACGTCTTCAAGGACCTCACCTCCCAGAGGACGTCAGGATTCACTCAATGATTACTTAGATGCTATCGAACAC
AATGGCCACTCCAGGCCGGGGACAGCGACCTGCTCTGAGAGGTCCATGGGTGCCTCTCCGAAACTGAGGAGTAGTTTTCCCACTGACACA
AGACTCAATGCCATGCTTCATATTGATTCAGATGAAGAAGATCACGAGTTCCAGCAAGACCTGGGTTACCCATCTTCCTTGGAGGAGGAG
GGAGGCCTGATCATGTTTAGCAGGGCATCCAGAGCTGATGATGGAAGCCTGACATCTCAGACAAAGCTGGAGGACAACCCTGTTGAGAAT
GAGGAAGCCTCCACACACGAAGCTGCTTCCTTTGAGGATAAGCCAGAAAATCTTCCAGAGCTTGCAGAGAGCTCCTTACCTGCAGGCCCA
GCCCCAGAGGAAGGTGAAGGCGGCCCAGAGCCTCAACCCAGTGCTGACCAGGGCAGTGCTGAACTGTGTGGCTCTCAAGAGGTAGATCAG
CCCACAAGTGGCGCAGACACAGGGACTTCCGATGCATCAGGAGGAAGCCGAAGAGCCGTCAGTGAGACCGAGTCTCTCGATCAGGGCTCT
GAGCCTTCCCAGGTGTCCTCTGAAACAGAACCCAGTGATCCTGCCAGGACAGAGAGTGTGAGCGAAGCCAGCACCAGGCCTGAGGGAGAG
AGTGACCTGGAATGCGCTGACAGCTCCTGCAATGAGAGTGTGACCACGCAGCTGTCCTCTGTGGACACACGGTGCTCCTCTCTTGAGAGC
GCACGGTTTCCTGAAACCCCAGCCTTTTCTTCTCAGGAGGAGGAAGACGGAGCCTGTGCAGCAGAGCCCACCAGCAGTGGCCCTGCCGAA
GGGTCGCAGGAATCCGTGTGCACTGCTGGTTCTTTACCTGTGGTACAGGTGCCCAGTGGGGAGGATGAAGGGCCAGGGGCAGAATCGGCC
ACTGTACCTGACCAGGAGGAGCTGGGGGAGGTCTGGCAGCGGAGGGGGAGCCTGGAGGGAGCTGCAGCTGCTGCCGAGAGCCCACCGCAA
GAAGAAGGCAGTGCTGGGGAGGCCCAAGGCACCTGTGAAGGGGCAACTGCCCAGGAGGAGGGCGCTACTGGAGGTTCTCAAGCCAACGGC
CACCAGCCACTGCGATCACTACCTTCAGTGCGCCAGGATGTTAGCCGGTACCAGAGGGTGGACGAGGCTCTCCCACCAAACTGGGAGGCA
CGCATTGACAGCCACGGCAGGATCTTCTACGTGGATCACGTAAACAGAACCACGACGTGGCAGCGACCGACAGCTCCCCCAGCCCCGCAG
GTGCTGCAGAGATCTAACTCCATACAGCAAATGGAGCAGCTGAACCGGCGATATCAGAGTATCCGCAGAACCATGACCAATGAGAGGCCT
GAGGAAAATACCAATGCTATTGATGGGGCAGGGGAGGAAGCTGACTTTCACCAAGCCAGTGCAGATTTCCGACGGGAGAACATCCTGCCT
CACTCTACCTCCAGATCCAGGATCACGTTGCTGTTACAGTCTCCCCCCGTGAAGTTCCTCATCAGCCCAGAGTTCTTCACCGTGCTGCAT
TCTAACCCTAGTGCCTACCGCATGTTTACAAACAACACGTGTTTGAAGCACATGATCACCAAAGTCCGGAGGGACACCCACCACTTTGAA
CGCTACCAGCATAACCGCGACCTTGTGGGATTCCTCAACATGTTCGCGAACAAACAGCTAGAGCTGCCGCGGGGATGGGAAATGAAACAT
GATCACCAGGGCAAGGCATTCTTTGTGGACCACAACTCCCGCACCACCACTTTCATTGATCCCCGGCTCCCACTTCAGAGCAGTAGACCC
ACAAGTGCGCTGGTTCATCGGCAACACCTGACAAGGCAACGCAGCCACAGTGCGGGTGAGGTAGGAGAAGATTCTCGACATGCAGGACCA
CCAGTTCTTCCCAGGCCATCCAGTACATTCAATACAGTCAGTAGGCCACAGTACCAGGACATGGTTCCAGTGGCTTACAATGACAAGATT
GTTGCATTTCTACGTCAACCCAATATCTTTGAAATTCTACAGGAGCGTCAACCTGATCTTACCAGGAATCACTCACTCAGGGAGAAGATC
CAATTTATCCGAACTGAAGGGACTCCAGGATTGGTGCGCCTTTCAAGCGATGCAGACCTTGTTATGTTGCTGAGCTTATTTGAAGAAGAG
ATAATGTCGTATGTGCCTCCACATGCCTTACTCCACCCCAGCTACTGTCAGTCCCCACGTGGCTCTCCCGTGTCATCTCCTCAGAACTCG
CCAGGTACCCAGCGTGCCAATGCCCGGGCTCCAGCCCCTTACAAGCGGGATTTCGAAGCCAAACTGAGGAACTTTTACAGGAAGTTAGAG
ACTAAAGGATATGGACAAGGCCCAGGGAAGTTAAAGTTAATTATCCGAAGAGATCACTTACTAGAAGATGCTTTTAATCAGATTATGGGC
TACTCCAGAAAAGACCTGCAGAGAAATAAGCTATATGTCACCTTCGTTGGGGAGGAAGGGCTGGATTACAGTGGGCCTTCTAGAGAGTTT
TTCTTCCTGGTATCCAGAGAACTCTTTAACCCATATTATGGCTTATTTGAATATTCAGCCAATGACACATACACAGTACAAATAAGTCCT
ATGTCTGCTTTTGTAGACAATCACCATGAATGGTTCCGATTCAGTGGTAGGATCCTTGGTCTTGCACTAATACACCAGTATTTGTTGGAT
GCCTTCTTCACACGGCCCTTTTATAAGGCTCTTCTCAGAATTCTATGTGACCTGAGTGACCTAGAATACCTTGATGAAGAGTTCCATCAG
AGCCTGCAGTGGATGAAAGACAATGATATCCATGACATCCTAGACCTCACGTTCACTGTGAACGAAGAAGTATTTGGGCAGATAACTGAA
CGAGAATTAAAGCCAGGGGGTGCCAATATCCCAGTTACAGAGAAGAACAAGAAGGAGTACATCGAGAGGATGGTGAAGTGGAGGATTGAG
AGGGGTGTTGTACAGCAAACAGAGAGCTTAGTGCGTGGCTTCTATGAGGTGGTGGATGCCAGGCTGGTATCTGTTTTTGATGCAAGAGAA
CTGGAATTGGTCATCGCAGGCACAGCTGAAATAGACCTAAGTGATTGGAGAAACAACACAGAATATAGAGGAGGATACCATGACAATCAT
ATTGTAATTCGGTGGTTCTGGGCTGCAGTGGAAAGATTCAACAATGAACAACGACTAAGGTTGTTACAGTTTGTTACAGGCACATCCAGC
ATTCCCTATGAAGGATTTGCTTCACTCCGAGGGAGTAACGGCCCAAGAAGATTCTGTGTGGAGAAATGGGGGAAAATCACTGCTCTTCCC
AGAGCGCATACATGTTTTAACCGTCTGGATCTGCCTCCCTACCCATCCTTTTCCATGCTTTATGAAAAACTGTTGACAGCAGTTGAAGAA
ACCAGTACTTTTGGACTTGAGTGACCTGGAAGCTGAATGCCCATCTCTGTGGACAGGCAGGTTCAGAAGCTGCCTTCTAGAAGAATGATT
GAACATTGGAAGTTTCAAGAGGATGCTTCCTTTAGGATAAAGCTATGTGCTGTTGTTTTCCAGGAACAAGTGCTCTGTCACATTTGGGGA
CTGGAGATGAGTCCTCTTGGAAGGATTTGGGTGAGCTTGATGCCCAGGGAACAACCCAACCGTCTTTCAATCAACAGTTCTTGACTGCCA
AACTTTTTCCATTTGTTATGTTCCAAGACAAAGATGAACCCATACATGATCAGCTCCACGGTAATTTTTAGGGACTCAGGAGAATCTTGA
AACTTACCCTTGAACGTGGTTCAAGCCAAACTGGCAGCATTTGGCCCAATCTCCAAATTAGAGCAAGTTAAATAATATAATAAAAGTAAA
TATATTTCCTGAAAGTACATTCATTTAAGCCCTAAGTTATAACAGAATATTCATTTCTTGCTTATGAGTGCCTGCATGGTGTGCACCATA
GGTTTCCGCTTTCATGGGACATGAGTGAAAATGAAACCAAGTCAATATGAGGTACCTTTACAGATTTGCAATAAGATGGTCTGTGACAAT
GTATATGCAAGTGGTATGTGTGTAATTATGGCTAAAGACAAACCATTATTCAGTGAATTACTAATGACAGATTTTATGCTTTATAATGCA
TGAAAACAATTTTAAAATAACTAGCAATTAATCACAGCATATCAGGAAAAAGTACACAGTGAGTTCTGTTTATTTTTTGTAGGTTCATTA
TGTTTATGTTCTTTAAGATGTATATAAGAACCTACCTATCATGCTGTATGTATCACTCATTCCATTTTCATGTTCCATGCATACTCGGGC
ATCATGCTAATATGTATCCTTTTAAGCACTCTCAAGGAAACAAAAGGGCCTTTTATTTTTATAAAGGTAAAAAAAATTCCCCAAATATTT
TGCACTGAATGTACCAAAGGTGAAGGGACATTACAATATGACTAACAGCAACTCCATCACTTGAGAAGTATAATAGAAAATAGCTTCTAA
ATCAAACTTCCTTCACAGTGCCGTGTCTACCACTACAAGGACTGTGCATCTAAGTAATAATTTTTTAAGATTCACTATATGTGATAGTAT
GATATGCATTTATTTAAAATGCATTAGACTCTCTTCCATCCATCAAATACTTTACAGGATGGCATTTAATACAGATATTTCGTATTTCCC
CCACTGCTTTTTATTTGTACAGCATCATTAAACACTAAGCTCAGTTAAGGAGCCATCAGCAACACTGAAGAGATCAGTAGTAAGAATTCC
ATTTTCCCTCATCAGTGAAGACACCACAAATTGAAACTCAGAACTATATTTCTAAGCCTGCATTTTCACTGATGCATAATTTTCTTATTA
ATATTAAGAGACAGTTTTTCTATGGCATCTCCAAAACTGCATGACATCACTAGTCTTACTTCTGCTTAATTTTATGAGAAGGTATTCTTC
ATTTTAATTGCTTTTGGGATTACTCCACATCTTTGTTTATTTCTTGACTAATCAGATTTTCAATAGAGTGAAGTTAAATTGGGGGTCATA
AAAGCATTGGATTGACATATGGTTTGCCAGCCTATGGGTTTACAGGCATTGCCCAAACATTTCTTTGAGATCTATATTTATAAGCAGCCA
TGGAATTCCTATTATGGGATGTTGGCAATCTTACATTTTATAGAGGTCATATGCATAGTTTTCATAGGTGTTTTGTAAGAACTGATTGCT
CTCCTGTGAGTTAAGCTATGTTTACTACTGGGACCCTCAAGAGGAATACCACTTATGTTACACTCCTGCACTAAAGGCACGTACTGCAGT
GTGAAGAAATGTTCTGAAAAAGGGTTATAGAAATCTGGAAATAAGAAAGGAAGAGCTCTCTGTATTCTATAATTGGAAGAGAAAAAAAGA
AAAACTTTTAACTGGAAATGTTAGTTTGTACTTATTGATCATGAATACAAGTATATATTTAATTTTGCAAACTTTTCACTTGTTTGTATT
CTTTTCATTATAAGGAAAAGTAGTATAACACACTTTTTTTTAAGTCACATATTTGATGGTATACAAGATGTTTCAGGGCTGGCATTCTCC
AAGCAGCAGATAAAGGTTGCATTTCTTTCAAAAATACATTCAAAGACCATGTTATCCTTCATTTTGGTTTGAGACATTTAGTTATGGTAT
TTCATATTATTAGGTAAAAGATATTTGAAATAAAATGTATCTCTTTAATTATTTCTAACAAATATATTTCTTTATTAAGGCATCCAACTT
TTTCCCAAATAACAGTACACTTTAATGTATGTAGACATTCTTAATTAGTATAATCATCTAGTTGATACTGTTCTCAGATTGGGAATTATC
AAAGATGTACTTATCATATCAGAACACCATGCTAACTTATCTATTATTCTTTCTTAGTAAAACAAAACAGCCAGTAATAACTATATAAAA
TATTAAATAACATTTCCACAGAATAAATTAGACTTTCATGTACTCTACAATTAGAAATATCCATAAATATTTTCTTCTGGACTGTGAACC
CAGATAACTAGGCTTTCTGGTCTTATTTTAAGTGATGCTCTTTATACTATAGAAGACACTCTTAATACATCATATATGTATGCAGAACAT
CTCTTAGATGAGAGAACAAGCACATCATTGGCATTCCCTCTGTGCCAGTTTGATGTTTGTTTGACGATGGAGCTACAAGAGTCTAAATCT
GCCTTTGAAAAGCTCAGCTCACAGTGTAGTAGAGTAGACTCCAAGGTTCAAAAAAGTGTTTTTAATAAAATTTGGTAAGTTCTACAATCA
AGGAATGAAGAGAGAAGAGAACAGCTTTTTCCATCTGGGAGATTCAATAATGGCTTCATATATAGATGATAGTGTGGCTAAAAAAAATTA
CATCAATGCTGTTTCTATTGGGAAGCAATGGCAAGTAATAGTATGTCAATACTGGTCAAGTGTTGAAGCCAGGATGCACTTACACAACGA
GAGTGTAAAGTGTGTAGGGAGCTGATCTGTGAAGGAGCAACTCAAAGATTTTGAAATTATCAGTGAAATGCCAAAACAGGGAAAGTTTCC
CTGTTTCCCTTCATCTATTCTACAATGCACCATTGGTTTTCAGTGTGAAAAATCCCAATCCCTGAGCCCAAACCACTTCTGGGGTCAAAA
CATTTTTCTTGTGCACAAAATGAATGGATCTTGGTCAAAGAAGTATGGTCACAATTTTCTAGCATATATTGCGTTTATAATTTAGCAGAA
ATTCTGCAATAAATAAAGGAAAATCTGTTTTACCTGTGCAACAATCAGAAATGGTAAAAATGCATTCAAGTGTTTGAAAGAAATGGTAGA
ATATGCTTGCATAGTGCTTTATAGTTTCAAAGTGCTGTCAGGTACATCGTCCGTTTAGCTCCTCACGCACTTTGTAGGGTACAAGCATCA
TGTTCCATCTGGGTTGTGGCTGATTTTCATGGATGGCTTGTGGCATCAGTTTCATTACTTCATAGTCACAATTCTGTGTTTCATCTTGAG
AAATGTGGAGACTAATGTTTGTACCAGTATATTCCACATTCAGTGAGGTTTCCAAGATGCTTCCTCCAAACTCTCACTTTCTTAAACAGA
TACATTTAAAATATGACACCTTCTGAAAAGTCCATAAAGAAATTAGTATATTCATGGAAAAAATTTCCCCGTAGACTTATTTGCATTTCA
TGACTTGACATGAGAAATTTAAAAAACAGAAGGCAAAATGTGATTGCTTTTGATGGATTTATACAGAATAGTCATTTAATTTTCTCAAGT
ATTATTTGGAAACAAGATAATGGAAAACATTAATCAGAAGCCTTATTTTATTTTTAAATTTTTAATAGGGATGGATCTAGTAAGCCCTAA
TAGCTGAGTTCCAGTGATAAAATTCACAAATTTTATTTATGATTGGACCACTTCTAACAAGGCAAATATCTTATAATGAAGATAGGAGTC
TGTTCAATTTAACCTTATTCAGGAAACTCCGTATTTATGTGAAATGATGCAATGCCATTATTAAGAGGTATCTGTAACCCTGCATAATAA
AAACATGCATAAGAAGAATGTGGTCTAATCTCCAAACTGAGTCTCAGTTTCAGGGCCTTTTGCTTTCTTTGTTTGTTTGTTTGAGACAGT
CTGGCTCTGTCATCCAGGCTGGAGTGCAGTGGCACATGAGCTCACTGCAACCTCCACCTCCCAGGCTCAAGCGATCCTCCCACCTCAGCC
TCCTGAGTAACTGGGACTACAGGCGCATACCACCACACCTGGCTAATTTTTGTATTTTTGTAGAGACAAGGCCCAGGCACGTCTCAAACT
CTTGAGCTCAAGCGATCCGCCCGCCTTGGCCTCCCAAAGTGCTAGGAGTAATTATAGGTGTGAGCCACCATGCTGGCAGTTGTTTTTGTT
TATTTGTGATAAGGTCTGGCTGTCACCCATGCTGGAGTGCAGTGGCATGATCTTGGCTCACTGCAACCTCTGCCTTCCAGGCTCAAGCCA
GCCTCCCACCTCAGCCTCCGAGTAGCTAGGACTACAGGCATGCACCACCATGCCCAGCTAATTTTTTTATATTTTTTGTAGACACAGGGT
TTTGCCACGTTGCCCAGGCTGGTCTTGAACTCCTGAGCTCAAGCAGTCCTCCCACCTTGGCCTCCCGAAGTGCTGGGATTACAGACGTGA
GCCTCTGGGCCTTGCTCTGTTTTGTCTGCTTTCTGATTTAGTAGGTGAGGGACAGCACTCTGGACCTTAGCCATTTTACTTCCATCTTAC
TGCCGTGAGTTTGATGAGAATGTCACTTTTAGACTCTAATTTTCAAAAACTTAGTTTCTTTCCCATTCATTTGTGTTTTCCAAATTAATT
TGTTTGTCTAGTATGGATGCAAAGGAATGCTGAAGACATTAAAGCTTTCTGAATTGTGGCTTAAGGCCAGCTACTGCCCACTGAAAGGAT
GATAAAAATAAAAAAGGAGGAAAGAGGAGCCCAGCAGTTGTGCCACCCCGCAAGAATATAATGCTAATTATTGACCAACTGTCAAGATTC
AGAGTGGTAACTGCATTCCGAGGAGCTGTCAGGAAGGATGACCGTGTGTGTGCTGTCCATATCATAGCCATCTGGGTCAGAAGGAGCGAA
AGGATGGTTAGGACAGGAGTGTAGTGGAGGGAAAGTTAAAACAACGGTAGATGGATCATCTTAGGGCTTGCTGGTGGGGGTAGGAACATA
CTTCAATTTGGTTTCAGACTGAGAAGAAGAAAGCTATGCTCCCTGATGAAGGCACAGTTTGATCTACTAGATGGGAAATACCCTCATTTT
ATAACTTCAGTAATTTAACATTTTCTGTATTGCAAAGTGGAATTTAGTCCCAAAGTATTAAAGCTAACCATAGCTTGATCAGGAGATTTG
ACAATTTAGCATAAAATTATGTTGTGGATTTTTTTATTTAAGAATTATTGTTACTATTATTGAACACCATGTATGAAATGAAAGAAAGGG
TGCTTTTATTTCATTATACTTATTTGGTTTTTTTAGCGGACATCCCTTGACATTAGAATAGCATTTGAGACATTTTCATGATTTCTAAAG
ATAACTTAAATGCTCTCTGTTAATCTGGAAAGTGAAATCCTAAGAGTGAGGTTGCAAATGGAGACTAAATTAGTGTTTCCAAGTCAGGAA
GTTAATCAAGACCGGAAATAGATTTGCTTAGATTTTATCTGCAGAGTCGTTTATTTGGCTTTCGTAATTGAACAGCTCAGCAGAATAAGA
TGGCCCTAGTTGTATGGTTTCTGGGGAACACAGGAGAATTAAATTTATATATGTGATTTTTATGTGTAGTGCCCTTGGGCAGGTGATATC
TTTCTATATGACTTTTAAGATATTACAACCTGAGGAGTGTGGATAGCCGTGTTGTGTGATTCAAACTGAATCAGCTATTACTGATGCAGG
TAAGGAACCATCAGTCAACTTCTGGTTACTATCACCTTCATAAAAAAGAATGGATGATGTTCAGGAATTACCTTGGAAGGATTAACCAGG
AATTAACACAGAATGGGATGTTCTTTTAGGACCCTAATGCTCTAAAAGATAAAATTACAACCTATTTTTCTTTATATGATAGCATAAGTA
AAATTTGGGGCTGTTAATATGTTGGAAAGTGCTTAAAATTACATGTTTTTATAATAGGGATGCAGGCATTCCAAAATAAATGAATAAAAA
TACATGCATCTCTCTCGCCTCTTACTGAAAGTATTAATCTAATTTTATAGTAATGATTACTTTTTAATATTAAGGCTCTGTAAAAAAATT
ATTTCTAAGATTTCAGTAGAACACAGGTGGTGTATTTTTTTAAGCTTTTAATTTCTCTTCACCAACCTCAGTCATTACGTTCACCACACA
GTGTGTCACAGTTAATAGTGGTATTTCAGTTTTTGCGTTGATTTAAGCTTCATATTTATTTAATGTGACTTTTGATGGAGAATAATAATG
GGAGATGCTTGCTGTTAGCATTAAGGTTATACAGCTCTCACTTCACCTTATATGTAATTTTTTTTTCAAAGTAAATAATGCAGATTGTTG
ACATCCTAGAAATGGTTTCTGGGTGGTATTATATGGGGCCTAGGACTCTGAACTGGGACTAGTTGTTTATTTTCTGGGAAGTCTGTATTC
TTATTCTCAACTGAACCCCTGACTCTTTTGTTGTATTTTTTATGATTCCGAAATGCTTTGAGGGAAAGATATTTTAATGTGTACAATTTG
TTTTATTTTCATACTGATCTCTATTTTTGTTTAAAACCATGTTGCATCATGAAATCACTTAATCCAAAATAAATCTTCTTTAAAAAAAAT


Top

FusionGenePPI for LRP1B_HECW2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LRP1BARRB1, CUL4B, TAZ, RSPO1, SFRP4, PTPRK, FOXD4L6, ZFP41, EWSR1, LRPAP1, ZNF408, ZNF224, ZNF331, FAM19A3, ZNF563, ZNF517, ZNF169, SCGB1D1, DNAJC10, CHRDL1, OLFM3, EGFL6, TRIM25HECW2TP73, TP53, APRT, FBXL15, FZR1, HECW1, RAI1, USP9X, INCENP, DIDO1, GRN, DRG1, SLC25A6, GGCT, CDC27, KDM4D, EMG1, FAM120B, CALML3, CIT, RAD54L, ZC3H14, RPL24, YTHDF3, CDT1, CDC23, CBX4, ENAH, PKN3, ZZZ3, BAIAP2, BAIAP2L1, NSMCE4A, PRDX2, MARK1, TRIM3, SAMD1, DMAP1, NPLOC4, POLRMT, GTF2F2, RBM28, SERPINB12, CHAMP1, DDT, ERCC6, NUDT16L1, MRPS9, AMOTL1, ETF1, WIZ, CALM3, TECR, CDC20, RAD21, ELAVL1, GRB10, MBIP, RCL1, SLCO4C1, TUBG1, MEIOB, FAM133B, MAP7D1, MORC2, PPIB, ALKBH5, ASTE1, SRPK1, SLC35E1, SNRPB2, ANAPC4, CABIN1, CSNK2A1, RING1, HSD17B12, LACRT, CHTOP, GSK3B, SRCAP, KMT2A, C11orf84, GPALPP1, LMNB1, LAMB1, LARP4B, MED16, MAP2, PXDN, PSMB1, ZMYND8, PC, PAK4, SNW1, TAAR2, RRP9, VPS33B, ZMAT4, ZNF207, CBX3, MPG, MORC4, MAZ, SF3A2, TRMT2A, ACTL6A, NAIP, CACTIN, DNAJC8, EXOSC7, KPNA1, ZCCHC17, PHC2, FRG1, SENP3, ANAPC5, ANXA1, CDC16, CDYL, FAM120A, TRIM25, RNF2, ALDOC, ABO, MED12, RNMT, NELFA, NOSIP, PWP2, PHF6, PIP5K1A, LOC390760, DHX36, LSM14A, POP1, RNMTL1, SRSF10, CHEK1, PKN2, SH3BP1, SPAG5, SPHK2, SMCHD1, TAF5L, WDR36, WBP11, ZNF638, PTPLAD1, XRN1, ACTR5, ASCC3, AHCY, ARF4, AFF4, ANAPC1, DDX24, CTNNBL1, KCTD6, CARD14, CNOT10, CENPF, CEP55, PRKG1, HUS1, CPSF2, CSTF3, CFL1, CKMT1B, CRTC2, CCNA1, CCNK, CYCS, CYFIP1, SPECC1, DCUN1D5, DHRS7B, RAD54B, KIN, POLR2B, DNAJA2, DYSF, EP400, RBBP6, EEF1D, NTHL1, EIF3H, EIF3I, EIF3J, ECM1, CAPZB, SUPT20H, FAM60A, FOXK2, LGALS7, TUBGCP2, TUBGCP3, GATAD1, GLCCI1, HSPH1, ERV3-1, HMG20A, KAT2A, ANKRD65, C17orf53, INTS4, EIF2AK2, LAMC1, AVL9, L3MBTL3, ACSL4, LYNX1, GMPPA, MED14, METAP1, MECP2, MICALL1, MACF1, MAP1S, TOMM34, MTHFD1L, SMAD5, MOB1A, ESCO1, SIRT5, NCKAP5, NCOA5, SEH1L, NTPCR, NUDCD1, OSBPL8, GIPC1, PEX11B, SLC25A17, HSD17B4, PHF3, EGFLAM, PAFAH1B2, KAT8, PSMA7, PSMB3, PSMB7, ANGEL2, PRMT5, LSM14B, PBRM1, S100A14, MOS, PNP, ASXL2, RBM15B, RSPH9, RADIL, UPF3B, RGAG1, RNASE4, RPS6KA4, TCEB3B, CTR9, RBM42, SCAPER, SRBD1, SCML2, SPAST, KIAA0586, TFAP2A, SP2, TADA2B, NFX1, DUS3L, TSC2, USP10, USP21, MIOS, YEATS4, ZBTB9, ZC3H3, ZC3H7B, ZNF579, ZFP64, ZRANB3, ZSWIM6, ZP3, UBE2D3, UBE2L3, FAM189B, TMEM51, FAM189A2, WBP1, ARRDC1, LDLRAD4, HECW2, EGFR, ARRDC3, SPG20, LITAF, PTPN14, AMOT, AMOTL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneHECW2chr2:142567848chr2:197208488ENST00000260983-129737_1068971573TP73
TgeneHECW2chr2:142567848chr2:197208488ENST00000409111-027737_1068-2021217TP73


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LRP1B_HECW2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LRP1B_HECW2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLRP1BC0007134Renal Cell Carcinoma1CTD_human
HgeneLRP1BC0025202melanoma1CTD_human