FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20116

FusionGeneSummary for LRP1B_ADAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: LRP1B_ADAP1
Fusion gene ID: 20116
HgeneTgene
Gene symbol

LRP1B

ADAP1

Gene ID

53353

11033

Gene nameLDL receptor related protein 1BArfGAP with dual PH domains 1
SynonymsLRP-1B|LRP-DIT|LRPDITCENTA1|GCS1L|p42IP4
Cytomap

2q22.1-q22.2

7p22.3

Type of geneprotein-codingprotein-coding
Descriptionlow-density lipoprotein receptor-related protein 1BLRP-deleted in tumorslow density lipoprotein receptor related protein-deleted in tumorlow density lipoprotein receptor-related protein 1Blow density lipoprotein-related protein 1B (deleted in tumors)arf-GAP with dual PH domain-containing protein 1centaurin-alphacentaurin-alpha-1cnt-a1putative MAPK-activating protein PM25
Modification date2018051920180523
UniProtAcc

Q9NZR2

O75689

Ensembl transtripts involved in fusion geneENST00000389484, ENST00000486364, 
ENST00000265846, ENST00000449296, 
ENST00000539900, ENST00000463358, 
Fusion gene scores* DoF score7 X 7 X 3=1473 X 2 X 3=18
# samples 73
** MAII scorelog2(7/147*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: LRP1B [Title/Abstract] AND ADAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-EK-A2GZ-01ALRP1Bchr2

142237965

-ADAP1chr7

975141

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389484ENST00000265846LRP1Bchr2

142237965

-ADAP1chr7

975141

-
5CDS-intronENST00000389484ENST00000449296LRP1Bchr2

142237965

-ADAP1chr7

975141

-
5CDS-intronENST00000389484ENST00000539900LRP1Bchr2

142237965

-ADAP1chr7

975141

-
5CDS-5UTRENST00000389484ENST00000463358LRP1Bchr2

142237965

-ADAP1chr7

975141

-
intron-3CDSENST00000486364ENST00000265846LRP1Bchr2

142237965

-ADAP1chr7

975141

-
intron-intronENST00000486364ENST00000449296LRP1Bchr2

142237965

-ADAP1chr7

975141

-
intron-intronENST00000486364ENST00000539900LRP1Bchr2

142237965

-ADAP1chr7

975141

-
intron-5UTRENST00000486364ENST00000463358LRP1Bchr2

142237965

-ADAP1chr7

975141

-

Top

FusionProtFeatures for LRP1B_ADAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LRP1B

Q9NZR2

ADAP1

O75689

Potential cell surface proteins that bind andinternalize ligands in the process of receptor-mediatedendocytosis. GTPase-activating protein for the ADP ribosylationfactor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate(InsP4). {ECO:0000269|PubMed:10448098,ECO:0000303|PubMed:10333475, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-39131_701144600DomainLDL-receptor class A 1
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-39176_1141144600DomainLDL-receptor class A 2
TgeneADAP1chr2:142237965chr7:975141ENST00000265846-011129_23027375DomainPH 1
TgeneADAP1chr2:142237965chr7:975141ENST00000265846-011252_35627375DomainPH 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911005_10431144600DomainLDL-receptor class A 7
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911052_10891144600DomainLDL-receptor class A 8
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911094_11321144600DomainLDL-receptor class A 9
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911135_11741144600DomainLDL-receptor class A 10
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391116_1541144600DomainEGF-like 1
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911174_12131144600DomainEGF-like 5
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911214_12531144600DomainEGF-like 6
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911527_15701144600DomainEGF-like 7
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391155_1941144600DomainEGF-like 2%3B calcium-binding
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911834_18751144600DomainEGF-like 8
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912143_21831144600DomainEGF-like 9
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912464_25041144600DomainEGF-like 10
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912509_25481144600DomainLDL-receptor class A 11
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912551_25871144600DomainLDL-receptor class A 12
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912590_26261144600DomainLDL-receptor class A 13
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912629_26751144600DomainLDL-receptor class A 14
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912681_27171144600DomainLDL-receptor class A 15
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912719_27571144600DomainLDL-receptor class A 16
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912760_28001144600DomainLDL-receptor class A 17
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912804_28411144600DomainLDL-receptor class A 18
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912844_28851144600DomainLDL-receptor class A 19
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912890_29261144600DomainLDL-receptor class A 20
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912927_29671144600DomainEGF-like 11
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912968_30081144600DomainEGF-like 12%3B calcium-binding
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913273_33141144600DomainEGF-like 13
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913316_33531144600DomainLDL-receptor class A 21
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913356_33921144600DomainLDL-receptor class A 22
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913395_34321144600DomainLDL-receptor class A 23
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913435_34721144600DomainLDL-receptor class A 24
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913475_35111144600DomainLDL-receptor class A 25
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913514_35501144600DomainLDL-receptor class A 26
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913552_35881144600DomainLDL-receptor class A 27
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913593_36291144600DomainLDL-receptor class A 28
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913631_36681144600DomainLDL-receptor class A 29
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913673_37111144600DomainLDL-receptor class A 30
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913714_37521144600DomainLDL-receptor class A 31
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913761_37971144600DomainLDL-receptor class A 32
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913801_38431144600DomainEGF-like 14
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913844_38811144600DomainEGF-like 15
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914171_42081144600DomainEGF-like 16
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914213_42491144600DomainEGF-like 17
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914249_42851144600DomainEGF-like 18
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914285_43211144600DomainEGF-like 19
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914321_43571144600DomainEGF-like 20
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914357_43921144600DomainEGF-like 21
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914390_44271144600DomainEGF-like 22
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391471_5171144600DomainEGF-like 3
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391794_8341144600DomainEGF-like 4
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391844_8821144600DomainLDL-receptor class A 3
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391885_9231144600DomainLDL-receptor class A 4
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391926_9631144600DomainLDL-receptor class A 5
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391966_10031144600DomainLDL-receptor class A 6
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914492_44951144600MotifEndocytosis signal
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914559_45621144600MotifEndocytosis signal
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911300_13461144600RepeatNote=LDL-receptor class B 8
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911347_13891144600RepeatNote=LDL-receptor class B 9
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911390_14361144600RepeatNote=LDL-receptor class B 10
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911437_14801144600RepeatNote=LDL-receptor class B 11
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911481_15221144600RepeatNote=LDL-receptor class B 12
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911618_16601144600RepeatNote=LDL-receptor class B 13
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911661_17041144600RepeatNote=LDL-receptor class B 14
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911705_17441144600RepeatNote=LDL-receptor class B 15
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911745_17871144600RepeatNote=LDL-receptor class B 16
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911922_19641144600RepeatNote=LDL-receptor class B 17
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3911965_20071144600RepeatNote=LDL-receptor class B 28
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912008_20511144600RepeatNote=LDL-receptor class B 19
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912052_20951144600RepeatNote=LDL-receptor class B 20
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912239_22801144600RepeatNote=LDL-receptor class B 21
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912281_23291144600RepeatNote=LDL-receptor class B 22
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912330_23741144600RepeatNote=LDL-receptor class B 23
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912375_24161144600RepeatNote=LDL-receptor class B 24
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3912417_24591144600RepeatNote=LDL-receptor class B 25
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391295_3371144600RepeatNote=LDL-receptor class B 1
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913055_30981144600RepeatNote=LDL-receptor class B 26
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913099_31411144600RepeatNote=LDL-receptor class B 27
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913142_31851144600RepeatNote=LDL-receptor class B 28
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913186_32241144600RepeatNote=LDL-receptor class B 29
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913225_32681144600RepeatNote=LDL-receptor class B 30
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391338_3811144600RepeatNote=LDL-receptor class B 2
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391382_4251144600RepeatNote=LDL-receptor class B 3
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913933_39801144600RepeatNote=LDL-receptor class B 31
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3913981_40381144600RepeatNote=LDL-receptor class B 32
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914039_40821144600RepeatNote=LDL-receptor class B 33
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914083_41271144600RepeatNote=LDL-receptor class B 34
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391568_6101144600RepeatNote=LDL-receptor class B 4
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391611_6561144600RepeatNote=LDL-receptor class B 5
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391657_7061144600RepeatNote=LDL-receptor class B 6
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-391707_7501144600RepeatNote=LDL-receptor class B 7
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-39125_44441144600Topological domainExtracellular
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914468_45991144600Topological domainCytoplasmic
HgeneLRP1Bchr2:142237965chr7:975141ENST00000389484-3914445_44671144600TransmembraneHelical
TgeneADAP1chr2:142237965chr7:975141ENST00000265846-0117_12627375DomainArf-GAP
TgeneADAP1chr2:142237965chr7:975141ENST00000265846-01121_4427375Zinc fingerC4-type


Top

FusionGeneSequence for LRP1B_ADAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LRP1B_ENST00000389484_chr2_142237965_-_ADAP1_ENST00000265846_chr7_975141_-_462aa
MSEFLLALLTLSGLLPIARVLTVGADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDTCPEEVEIKCPLNHIACLGTNKC
VHLSQLCNGVLDCPDGTDEGVHCQDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFY
YRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKTFNRNDAKEPKAVMKIEHLNAT
FQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKR
WFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LRP1B_ENST00000389484_chr2_142237965_-_ADAP1_ENST00000265846_chr7_975141_-_1386nt
ATGTCCGAGTTTCTCCTCGCCTTACTCACTCTCTCGGGATTATTGCCGATTGCCAGGGTGCTGACCGTGGGAGCCGACCGAGATCAGCAG
TTGTGTGATCCTGGTGAATTTCTTTGCCACGATCACGTGACTTGTGTCTCCCAGAGCTGGCTGTGTGATGGGGACCCTGACTGCCCTGAT
GATTCAGACGAGTCTTTAGATACCTGTCCCGAGGAGGTAGAAATCAAGTGCCCCTTGAATCACATTGCTTGCCTTGGTACCAACAAATGT
GTTCATTTATCCCAGCTGTGCAATGGTGTCTTGGACTGCCCAGATGGGTATGACGAAGGAGTACATTGTCAGGATCCCGACTGGGCCTCC
TACACTCTGGGCGTCTTCATCTGCCTGAGCTGCTCGGGAATCCACCGGAATATCCCCCAGGTCAGCAAGGTGAAGTCCGTCCGCCTGGAC
GCCTGGGAGGAGGCCCAAGTGGAGTTCATGGCCTCCCACGGGAACGACGCCGCGAGAGCCAGGTTTGAGTCCAAAGTACCCTCCTTCTAC
TACCGGCCCACGCCCTCCGACTGCCAGCTCCTTCGAGAGCAGTGGATCCGGGCCAAGTACGAGCGACAGGAGTTCATCTACCCGGAGAAG
CAGGAGCCCTACTCGGCAGGGTACCGTGAGGGTTTTCTCTGGAAGCGTGGCCGGGACAACGGGCAGTTTTTGAGCCGGAAGTTTGTGCTG
ACAGAACGAGAGGGTGCTCTGAAGTATTTCAACAGAAATGATGCCAAGGAGCCCAAGGCCGTGATGAAGATCGAGCACCTGAACGCCACC
TTCCAGCCGGCCAAGATCGGCCACCCCCACGGCCTGCAGGTCACCTACCTGAAGGACAACAGCACCCGTAACATCTTCATCTACCATGAG
GACGGGAAGGAGATTGTGGACTGGTTCAATGCACTCCGAGCTGCTCGCTTCCACTACCTGCAGGTGGCATTCCCAGGGGCCGGCGACGCA
GATCTGGTGCCAAAGCTCTCCAGGAACTACCTGAAGGAAGGCTACATGGAGAAGACGGGGCCCAAGCAAACGGAAGGCTTCCGGAAGCGC
TGGTTCACCATGGATGACCGCAGGCTCATGTACTTCAAAGACCCCCTGGACGCCTTCGCCCGAGGGGAAGTCTTCATTGGCAGCAAGGAG
AGTGGCTACACGGTGCTGCATGGGTTCCCGCCGTCCACCCAGGGCCACCACTGGCCACATGGCATCACCATCGTCACGCCCGACCGCAAG
TTTCTGTTTGCCTGCGAGACGGAGTCCGACCAGAGGGAGTGGGTGGCGGCCTTCCAGAAGGCGGTGGACAGGCCCATGCTGCCCCAGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LRP1B_ENST00000389484_chr2_142237965_-_ADAP1_ENST00000265846_chr7_975141_-_3376nt
AAAGACAGAACCCCAGAGAAAAACGCTGCCAATTCGTTGCTTTATTGTTCCCTGCCTGGGGACCTCAATAGCCTTTTCCATTAACCTTCC
CTTCTTACGCAACGGTTAATGACTTTGGGGGTTGTTTTGCTTTCTGTTTCTGCTGAGTCACTAAATTTTGCCTCTTTGTCCCCAGGTGCT
GCTCAGCATAAAAGTTAAAAGTGCAATTCAGGAAGTACTGGGATTCTGTGTAGAGCCGAGGAAACCATTTCCCTAAGAGAAGCTCTGTTC
CTTGGCTTGTCCTTCCTTCCCGGGAAGGAAGCTTCCGAGGAACGAAGGGAGAAGCTTTGTTTTGCCTGCAGAAGCAGCCCTGTGCTCGGC
TGAGGGTTCTCAGCTGGCTGTGAACTGCGGAGCATTGTAGGCGCCTGGCTGGCTCAGGCCAATGCAGAAGTCTCTCCCTTCTCCAAAGAC
CCAAATCCCCACAGAACCAGCTTCGAGTTACTTTCCCTTCAAGGGGATTAAAATAATTGTGATTTGTGGCGCTCTCCGTTCGCGGTGGTA
TTTTCCTGTTGTGTTAAATGCCTCTTATTAAGTAATAGATGTGATTTATGTGAACGACGAAGGGGTGTGTGGTGGATTCGGTGATTAATC
AGTGAATTCCCATCCGCTGGCATCTCTCACTGCCCCTCTTGCGTGATGTAAGATCAGACGTACCCTGCATTGAAAAGTCAAGACACACGG
GCGTCTCGCTCGCGCTCACACACGCTCTGCCTCCTCTCTCCCGCACGCGCGCATCCCTCCACCTTCCACATCCTGCTCCAGGCAGGAGAA
GGCTGACTGGCTGGACTCATTGAGCTGAAGAATTTCCAGTGACATTTGTAAATGACGCCGCTCGATTCCAGGCTCCAAGCGGCCCCTGCC
GCCGCCGCCGCCGCCGGGCCGAAGGTGCCGCCGAGCAGTCTCCAGCGCAGGCTTCCTTACCGGGCGACCACAATGTCCGAGTTTCTCCTC
GCCTTACTCACTCTCTCGGGATTATTGCCGATTGCCAGGGTGCTGACCGTGGGAGCCGACCGAGATCAGCAGTTGTGTGATCCTGGTGAA
TTTCTTTGCCACGATCACGTGACTTGTGTCTCCCAGAGCTGGCTGTGTGATGGGGACCCTGACTGCCCTGATGATTCAGACGAGTCTTTA
GATACCTGTCCCGAGGAGGTAGAAATCAAGTGCCCCTTGAATCACATTGCTTGCCTTGGTACCAACAAATGTGTTCATTTATCCCAGCTG
TGCAATGGTGTCTTGGACTGCCCAGATGGGTATGACGAAGGAGTACATTGTCAGGATCCCGACTGGGCCTCCTACACTCTGGGCGTCTTC
ATCTGCCTGAGCTGCTCGGGAATCCACCGGAATATCCCCCAGGTCAGCAAGGTGAAGTCCGTCCGCCTGGACGCCTGGGAGGAGGCCCAA
GTGGAGTTCATGGCCTCCCACGGGAACGACGCCGCGAGAGCCAGGTTTGAGTCCAAAGTACCCTCCTTCTACTACCGGCCCACGCCCTCC
GACTGCCAGCTCCTTCGAGAGCAGTGGATCCGGGCCAAGTACGAGCGACAGGAGTTCATCTACCCGGAGAAGCAGGAGCCCTACTCGGCA
GGGTACCGTGAGGGTTTTCTCTGGAAGCGTGGCCGGGACAACGGGCAGTTTTTGAGCCGGAAGTTTGTGCTGACAGAACGAGAGGGTGCT
CTGAAGTATTTCAACAGAAATGATGCCAAGGAGCCCAAGGCCGTGATGAAGATCGAGCACCTGAACGCCACCTTCCAGCCGGCCAAGATC
GGCCACCCCCACGGCCTGCAGGTCACCTACCTGAAGGACAACAGCACCCGTAACATCTTCATCTACCATGAGGACGGGAAGGAGATTGTG
GACTGGTTCAATGCACTCCGAGCTGCTCGCTTCCACTACCTGCAGGTGGCATTCCCAGGGGCCGGCGACGCAGATCTGGTGCCAAAGCTC
TCCAGGAACTACCTGAAGGAAGGCTACATGGAGAAGACGGGGCCCAAGCAAACGGAAGGCTTCCGGAAGCGCTGGTTCACCATGGATGAC
CGCAGGCTCATGTACTTCAAAGACCCCCTGGACGCCTTCGCCCGAGGGGAAGTCTTCATTGGCAGCAAGGAGAGTGGCTACACGGTGCTG
CATGGGTTCCCGCCGTCCACCCAGGGCCACCACTGGCCACATGGCATCACCATCGTCACGCCCGACCGCAAGTTTCTGTTTGCCTGCGAG
ACGGAGTCCGACCAGAGGGAGTGGGTGGCGGCCTTCCAGAAGGCGGTGGACAGGCCCATGCTGCCCCAGGAGTACGCAGTGGAGGCGCAC
TTCAAGCATAAACCTTAGCGAGTGCGGCTGGAGGACCACGGACATTGGACTCACTGTGGCTGGACGGAGGGGACCCGTGGATGGGGGGGC
TCTGGCGTCCTGAGGCCACCTGGCCCCACCTGCTCCTCAGGGCAGCCCGGCGCGGCCAGGTAGGGCCCGAGCTTCAGCTTCCAGGATGCT
TCTCTGGAACCTCAAGGCAGGCAGCCCAGGCCCTGGGCCTGATCTCTAACCCCGTCATGCTGCTGCTGACCACACCCAGCCAACCTGCCC
CTCCCTGACCCGGGGCCCCCTTTCCTCCAGGGCCCAGTCTGGCTCCCGAGCTCAGACACAGCCCCCAGGAGCCGCCCACCACGGCTGTGG
GAACTTCCAGGCCTCAGCGCAGAGCCCTGCTTGGGGCCAGCACGGTGGGCAGCTGCCGGCCGCTGGGGACTGGGCCCTGCTCGCATGCCG
CCCCGCCCTCCCCCCACCTCCACGACTATTTATTGAGCGCCTGTTGTGTGTCACGGGGCTATGAGGGCCGTGGGGTGTTTGGGTGGATTA
TCCACACAGGTCCCGGCCCCTGCCCGGGCTGGAGTTGCCACAGCCTGTGCTCCTGGTCCTCACCTGGAGGGGCCAGCAGGCTGCCGTCCC
ACCACACGTGGCCTCTGCGCCCAGCACGGTGCTCGCCGACAGTGGTGTCTGAACCCTTGGGGACGAGGGCCTGGGCCGCGGTGAGGCCAC
CAGAGGCAGGAGTGGCCCTGGGGGTCCCGGGCACTGTCGCGCTTGCTGCAGGCGGCCCAGCCGTGTATTTATTTTTCACCTATCTCCTTC
CTGTCAAGGCAGGCCGGGCTCCAGGGCTCCCCTTGCGTGGGGCATGTAGGTGGGGGAGGCGTCTGCAGGTCACCTGGGGGGCCCAGCCCT
CTCCCAGCCTTGCCTGGCTGAGCTGTGTTCCAGGGGAGCCCTGGACAAGCCCTCATAGGCAGGGAGGGGGTTTCCGAGGCCAGGCATCCG


Top

FusionGenePPI for LRP1B_ADAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LRP1BARRB1, CUL4B, TAZ, RSPO1, SFRP4, PTPRK, FOXD4L6, ZFP41, EWSR1, LRPAP1, ZNF408, ZNF224, ZNF331, FAM19A3, ZNF563, ZNF517, ZNF169, SCGB1D1, DNAJC10, CHRDL1, OLFM3, EGFL6, TRIM25ADAP1PRKCI, PRKCZ, PIK3CA, PRKD1, PRKCE, PSME3, CSNK1A1, NCL, ANP32A, GSK3B, GADD45A, RANBP9, DVL3, GOLGA2, SDCBP2, ARF6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LRP1B_ADAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LRP1B_ADAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLRP1BC0007134Renal Cell Carcinoma1CTD_human
HgeneLRP1BC0025202melanoma1CTD_human