FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20003

FusionGeneSummary for LPHN2_AK5

check button Fusion gene summary
Fusion gene informationFusion gene name: LPHN2_AK5
Fusion gene ID: 20003
HgeneTgene
Gene symbol

LPHN2

AK5

Gene ID

23266

26289

Gene nameadhesion G protein-coupled receptor L2adenylate kinase 5
SynonymsCIRL2|CL2|LEC1|LPHH1|LPHN2AK6
Cytomap

1p31.1

1p31.1

Type of geneprotein-codingprotein-coding
Descriptionadhesion G protein-coupled receptor L2calcium-independent alpha-latrotoxin receptor 2latrophilin homolog 1latrophilin-2lectomedin-1adenylate kinase isoenzyme 5AK 5ATP-AMP transphosphorylase 5adenylate kinase 6
Modification date2018052320180519
UniProtAcc

Q9Y6K8

Ensembl transtripts involved in fusion geneENST00000370723, ENST00000370727, 
ENST00000370725, ENST00000370721, 
ENST00000370728, ENST00000370730, 
ENST00000469377, ENST00000359929, 
ENST00000370713, ENST00000319517, 
ENST00000370715, ENST00000335786, 
ENST00000394879, ENST00000271029, 
ENST00000370717, 
ENST00000354567, 
ENST00000344720, ENST00000317704, 
ENST00000478255, 
Fusion gene scores* DoF score1 X 1 X 1=15 X 3 X 4=60
# samples 15
** MAII scorelog2(1/1*10)=3.32192809488736log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LPHN2 [Title/Abstract] AND AK5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAK5

GO:0006165

nucleoside diphosphate phosphorylation

23416111

TgeneAK5

GO:0009142

nucleoside triphosphate biosynthetic process

23416111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-A46G-01ALPHN2chr1

82302742

+AK5chr1

77759478

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370723ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370723ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370723ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370723ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370727ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370727ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370727ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370727ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370725ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370725ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370725ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370725ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370721ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370721ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370721ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370721ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370728ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370728ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370728ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370728ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370730ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370730ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370730ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370730ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
3UTR-3CDSENST00000469377ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
3UTR-3CDSENST00000469377ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
3UTR-intronENST00000469377ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
3UTR-intronENST00000469377ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000359929ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000359929ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000359929ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000359929ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370713ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370713ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370713ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370713ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000319517ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000319517ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000319517ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000319517ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370715ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370715ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370715ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370715ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000335786ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000335786ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000335786ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000335786ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000394879ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000394879ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000394879ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000394879ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000271029ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000271029ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000271029ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000271029ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370717ENST00000354567LPHN2chr1

82302742

+AK5chr1

77759478

+
In-frameENST00000370717ENST00000344720LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370717ENST00000317704LPHN2chr1

82302742

+AK5chr1

77759478

+
5CDS-intronENST00000370717ENST00000478255LPHN2chr1

82302742

+AK5chr1

77759478

+

Top

FusionProtFeatures for LPHN2_AK5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LPHN2

AK5

Q9Y6K8

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. Nucleoside monophosphate (NMP) kinase that catalyzes thereversible transfer of the terminal phosphate group betweennucleoside triphosphates and monophosphates. Active on AMP anddAMP with ATP as a donor. When GTP is used as phosphate donor, theenzyme phosphorylates AMP, CMP, and to a small extent dCMP. Alsodisplays broad nucleoside diphosphate kinase activity.{ECO:0000269|PubMed:19647735, ECO:0000269|PubMed:23416111}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114142_14756537Nucleotide bindingATP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114191_19356537Nucleotide bindingAMP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114219_22256537Nucleotide bindingAMP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114386_39156537Nucleotide bindingATP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114433_43556537Nucleotide bindingAMP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114462_46556537Nucleotide bindingAMP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114142_14782563Nucleotide bindingATP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114191_19382563Nucleotide bindingAMP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114219_22282563Nucleotide bindingAMP 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114386_39182563Nucleotide bindingATP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114433_43582563Nucleotide bindingAMP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114462_46582563Nucleotide bindingAMP 2
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114133_31656537RegionAdenylate kinase 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114162_19356537RegionNMPbind 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114256_26656537RegionLID 1
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114377_55956537RegionAdenylate kinase 2
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114406_43556537RegionNMPbind 2
TgeneAK5chr1:82302742chr1:77759478ENST00000344720+114499_50956537RegionLID 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114133_31682563RegionAdenylate kinase 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114162_19382563RegionNMPbind 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114256_26682563RegionLID 1
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114377_55982563RegionAdenylate kinase 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114406_43582563RegionNMPbind 2
TgeneAK5chr1:82302742chr1:77759478ENST00000354567+114499_50982563RegionLID 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220135_394241404DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+22041_130241404DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220784_836241404DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221135_394241417DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+22141_130241417DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221784_836241417DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321135_394241404DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+32141_130241404DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321784_836241404DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219135_394241124DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+21941_130241124DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219784_836241124DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222135_394241741DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+22241_130241741DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222784_836241741DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223135_394241475DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+22341_130241475DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223784_836241475DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525135_394241462DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+52541_130241462DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525784_836241462DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526135_394241475DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+52641_130241475DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526784_836241475DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525135_394241460DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+52541_130241460DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525784_836241460DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524135_394241417DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+52441_130241417DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524784_836241417DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222135_394241462DomainOlfactomedin-like
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+22241_130241462DomainSUEL-type lectin
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222784_836241462DomainGPS
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+2201012_1037241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+2201059_1062241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+2201084_1459241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+22026_851241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220873_880241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220902_907241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220929_952241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220974_990241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+2211012_1037241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+2211059_1062241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+2211084_1459241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+22126_851241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221873_880241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221902_907241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221929_952241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221974_990241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+3211012_1037241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+3211059_1062241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+3211084_1459241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+32126_851241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321873_880241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321902_907241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321929_952241404Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321974_990241404Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+2191012_1037241124Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+2191059_1062241124Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+2191084_1459241124Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+21926_851241124Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219873_880241124Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219902_907241124Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219929_952241124Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219974_990241124Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+2221012_1037241741Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+2221059_1062241741Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+2221084_1459241741Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+22226_851241741Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222873_880241741Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222902_907241741Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222929_952241741Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222974_990241741Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+2231012_1037241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+2231059_1062241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+2231084_1459241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+22326_851241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223873_880241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223902_907241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223929_952241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223974_990241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+5251012_1037241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+5251059_1062241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+5251084_1459241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+52526_851241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525873_880241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525902_907241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525929_952241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525974_990241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+5261012_1037241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+5261059_1062241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+5261084_1459241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+52626_851241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526873_880241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526902_907241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526929_952241475Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526974_990241475Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+5251012_1037241460Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+5251059_1062241460Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+5251084_1459241460Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+52526_851241460Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525873_880241460Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525902_907241460Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525929_952241460Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525974_990241460Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+5241012_1037241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+5241059_1062241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+5241084_1459241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+52426_851241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524873_880241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524902_907241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524929_952241417Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524974_990241417Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+2221012_1037241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+2221059_1062241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+2221084_1459241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+22226_851241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222873_880241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222902_907241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222929_952241462Topological domainCytoplasmic
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222974_990241462Topological domainExtracellular
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+2201038_1058241404TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+2201063_1083241404TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220852_872241404TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220881_901241404TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220908_928241404TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220953_973241404TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000319517+220991_1011241404TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+2211038_1058241417TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+2211063_1083241417TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221852_872241417TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221881_901241417TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221908_928241417TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221953_973241417TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000335786+221991_1011241417TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+3211038_1058241404TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+3211063_1083241404TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321852_872241404TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321881_901241404TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321908_928241404TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321953_973241404TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000359929+321991_1011241404TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+2191038_1058241124TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+2191063_1083241124TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219852_872241124TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219881_901241124TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219908_928241124TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219953_973241124TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370713+219991_1011241124TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+2221038_1058241741TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+2221063_1083241741TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222852_872241741TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222881_901241741TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222908_928241741TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222953_973241741TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370715+222991_1011241741TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+2231038_1058241475TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+2231063_1083241475TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223852_872241475TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223881_901241475TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223908_928241475TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223953_973241475TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370717+223991_1011241475TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+5251038_1058241462TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+5251063_1083241462TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525852_872241462TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525881_901241462TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525908_928241462TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525953_973241462TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370723+525991_1011241462TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+5261038_1058241475TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+5261063_1083241475TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526852_872241475TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526881_901241475TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526908_928241475TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526953_973241475TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370725+526991_1011241475TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+5251038_1058241460TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+5251063_1083241460TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525852_872241460TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525881_901241460TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525908_928241460TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525953_973241460TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370728+525991_1011241460TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+5241038_1058241417TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+5241063_1083241417TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524852_872241417TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524881_901241417TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524908_928241417TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524953_973241417TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000370730+524991_1011241417TransmembraneHelical%3B Name%3D5
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+2221038_1058241462TransmembraneHelical%3B Name%3D6
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+2221063_1083241462TransmembraneHelical%3B Name%3D7
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222852_872241462TransmembraneHelical%3B Name%3D1
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222881_901241462TransmembraneHelical%3B Name%3D2
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222908_928241462TransmembraneHelical%3B Name%3D3
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222953_973241462TransmembraneHelical%3B Name%3D4
HgeneLPHN2chr1:82302742chr1:77759478ENST00000394879+222991_1011241462TransmembraneHelical%3B Name%3D5


Top

FusionGeneSequence for LPHN2_AK5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_505aa
MVSSGCRMRSLWFIIVISFLPNTEVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQ
SLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPD
LVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAG
SSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_1515nt
ATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTCA
AACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTG
ATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAG
AGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGG
AAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCAA
ATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGAT
TTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGTA
AAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATTT
GATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGT
TCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTTA
AATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGC
AAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAA
TCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATG
GTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGA
GACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGAC
GACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370723_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370727_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370725_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370721_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370728_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3456nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000370730_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3452nt
CTCTTTCTCTCTCCCTCTCTTGCGCTGTCCCTCATTCATGCACTCTTCCATCTTTTTGCCATTGTGCCAGCTCAATTTAAATGTATCTGC
TCTGTATCTGTTCAAGTGGAGATAATCCATGCAAATCAGGAGCCGTGGCTCTCAATGCCTGGTTCACAGAGAGGACTCAGCTTGAGGAGG
TCACTCGTTCACAGCCGCTCCTCCCATTATATTTTTCCCCTTATTGCAGAACTGCTGTATGTATACAGTGACTGAAAGGACTCAATTTAC
TGCAACTGCTGCCTGGCTTTACTTACAACTTTTTTTTTTTTATAAAGGAACTTACCTCCATCTGTCTTTTCAAGCTCTAAACTTCACAAA
TGGTTCTGAAGAGTATGGAGCCTACGTAGATTCATAAGAGCCCAATGTTTCCAAAGGACATTAATTTTGATTTCTCCAATGAAGGCTTGT
GGCTGTCCTTATGCTTTACAAAACATTACCAAATCAGAGCCGAAAAGAAAACTGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCA
GAATGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATAC
TTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTA
ATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCT
GAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGT
GGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGT
ACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAG
CAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAA
ATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGA
CCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGG
CTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAA
GAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAG
GGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGT
GGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAG
GAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTC
CTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTC
GGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGC
AGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAG
ACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGA
AGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGT
CACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGC
ATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCA
CACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGT
TCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCC
TGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTT
GTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACC
CAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAA
TTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGA
TATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAA
AAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAG
GAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATC
AGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCAT
GAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAA

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_2992nt
AACTGTGTTCTATGTGGATCCAGCATTACAACTGATAAGGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCAGAATGATATGAAGA
TCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATACTTAAAGGGATCAAT
AATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTC
AAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTT
GATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCA
GAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAG
GAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCA
AATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGA
TTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGT
AAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATT
TGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGG
TTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTT
AAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGG
CAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGA
ATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCAT
GGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGG
AGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGA
CGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCT
ACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGAAGGCAAAAATGCAT
GTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCA
ACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGCATGGTGTATTTGGG
ACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCACACTCAGAGCTAGT
CAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGTTCTCCTCTCATTAA
GCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTT
TGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTTGTACATGATATAGA
GGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACCCAGGTTAGTCATCA
GTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAATTGTGTAACCTAGT
CTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGATATTTGCTATTTCA
TTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAAAAAAATACCCTAAC
AAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCT
TGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAG
AGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTT
TTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAAATGGATATGTACAA

>In-frame_LPHN2_ENST00000359929_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_2988nt
AACTGTGTTCTATGTGGATCCAGCATTACAACTGATAAGGGTATTTATGGCACAATGAAAAATTTCATCTTTCCCAGAATGATATGAAGA
TCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCATTAAGGAATACAAAGAAAATACTTAAAGGGATCAAT
AATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGCTTCTTACCAAATACAGAAGTAATGCCTGAAAACTC
AAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATAGAAAGTGACACGGATCTCTCTGAGACTGCAGAGTT
GATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTTGTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCA
GAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTATTAAGAAAGAAGATCCACAGTACCAGCAGCAATAG
GAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAAACAACAATTACAGAGATAAAGCAAAAATTGATGCA
AATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAGGCTCTATCTTTTGAGGACCAAATCTGTACCCCCGA
TTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAGCGTGCAGAACAGCAGGGCCGACCAGACGACAATGT
AAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTTAAATACTTCCAGGAAAAGGGGCTCATCATGACATT
TGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGACAACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGG
TTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACAGGATCTGATTATGAAGATCAGGGTGATGACCAGTT
AAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGTAAAATTATTTTCATAATTGGTGGTCCTGGCTCTGG
CAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCAACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGA
ATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCCTCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCAT
GGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAGGTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGG
AGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGCCTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGA
CGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATCCCCGTGATCGCCTACTACGAGACAAAAACACAGCT
ACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACAGCTATTGACTCTATTTTCTGAAGGCAAAAATGCAT
GTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGTTTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCA
ACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTGAGAGGTGTCTGGAAATCATGCATGGTGTATTTGGG
ACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACACACTTTGTATCATGCAGGCCACACTCAGAGCTAGT
CAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTTGCTAGACCCTGATCATCTGGTTCTCCTCTCATTAA
GCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGCCCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTT
TGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGTGGGTTGATTACACAATGCCTTGTACATGATATAGA
GGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTTTCCCAAGATGATGGTAAAACCCAGGTTAGTCATCA
GTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGCTAAGAGAACAAATCTGATAAATTGTGTAACCTAGT
CTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAAAAGTAACTTAAAAGCATGAGATATTTGCTATTTCA
TTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATTTATTTGTTGCCAAGCAAGTAAAAAAATACCCTAAC
AAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTGTTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCT
TGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGGTTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAG
AGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAAAAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTT
TTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTTAAGTCATTTTTTTTTCTTGAAATGGATATGTACAA

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000370713_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000319517_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000370715_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000335786_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000394879_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000271029_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000354567_chr1_77759478_+_3027nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT

>In-frame_LPHN2_ENST00000370717_chr1_82302742_+_AK5_ENST00000344720_chr1_77759478_+_3023nt
CGGCGAACAGACGTTCTTTCTCCTCCATGCAGTTACACAAAAGGAGGGCTACGGAAACTAAAAGTTTCGGGGCCTCTGGCTCGGTGCGTG
GAGAAAAGAGAAAACCTGGAGACGGGATATGAAGATCAATGATGCAGACTGATGGTTTTGATGAAGCTGGGCATTTATAACTAGATTCAT
TAAGGAATACAAAGAAAATACTTAAAGGGATCAATAATGGTGTCTTCTGGTTGCAGAATGCGAAGTCTGTGGTTTATCATTGTAATCAGC
TTCTTACCAAATACAGAAGTAATGCCTGAAAACTCAAACTTTCCATATCGGCGGTATGACCGGCTCCCTCCAATCCATCAATTCTCCATA
GAAAGTGACACGGATCTCTCTGAGACTGCAGAGTTGATTGAGGAGTATGAGGTTTTTGATCCTACCAGACCTCGACCAAAAATCATTCTT
GTTATAGGTGGTCCAGGAAGTGGAAAGGGTACTCAGAGTTTGAAAATTGCAGAACGATATGGATTCCAATACATTTCTGTGGGAGAATTA
TTAAGAAAGAAGATCCACAGTACCAGCAGCAATAGGAAATGGAGTCTTATTGCCAAGATAATTACAACTGGAGAATTGGCCCCACAGGAA
ACAACAATTACAGAGATAAAGCAAAAATTGATGCAAATACCTGATGAAGAGGGCATTGTTATTGATGGATTTCCAAGAGATGTTGCCCAG
GCTCTATCTTTTGAGGACCAAATCTGTACCCCCGATTTGGTGGTATTCCTGGCTTGTGCTAATCAGAGACTCAAAGAAAGATTACTGAAG
CGTGCAGAACAGCAGGGCCGACCAGACGACAATGTAAAAGCTACCCAAAGGAGACTAATGAACTTCAAGCAGAATGCTGCTCCATTGGTT
AAATACTTCCAGGAAAAGGGGCTCATCATGACATTTGATGCCGACCGCGATGAGGATGAGGTGTTCTATGACATCAGCATGGCAGTTGAC
AACAAGTTATTTCCAAACAAAGAGGCTGCAGCAGGTTCAAGTGACCTTGATCCTTCGATGATATTGGACACTGGAGAGATCATTGATACA
GGATCTGATTATGAAGATCAGGGTGATGACCAGTTAAATGTATTTGGAGAGGACACTATGGGAGGTTTCATGGAAGATTTGAGAAAGTGT
AAAATTATTTTCATAATTGGTGGTCCTGGCTCTGGCAAAGGCACACAGTGTGAAAAGCTGGTGGAAAAATATGGATTTACACATCTCTCA
ACTGGCGAGCTCCTGCGTGAGGAACTGGCATCAGAATCTGAAAGAAGCAAATTGATCAGAGACATTATGGAACGTGGAGACCTGGTGCCC
TCAGGCATCGTTTTGGAGCTCCTGAAGGAGGCCATGGTGGCCAGCCTCGGGGACACCAGGGGCTTCCTGATTGACGGCTATCCTCGGGAG
GTGAAGCAAGGGGAAGAGTTCGGACGCAGGATTGGAGACCCACAGTTGGTGATCTGTATGGACTGCTCGGCAGACACCATGACCAACCGC
CTTCTCCAAAGGAGCCGGAGCAGCCTGCCTGTGGACGACACCACCAAGACCATCGCCAAGCGCCTAGAAGCCTACTACCGAGCGTCCATC
CCCGTGATCGCCTACTACGAGACAAAAACACAGCTACACAAGATAAATGCAGAGGGAACACCAGAGGACGTTTTTCTTCAACTCTGCACA
GCTATTGACTCTATTTTCTGAAGGCAAAAATGCATGTTTGTTAGAATGGAAACAGAAAAACATTAAAAAGTTCATTCCTTAACACAATGT
TTCAAGTTAAACCTTTTGTGTCACCGCCCCCACCAACCACCACCTCCTAAATCCTGACAGCACTGTTTGCTTCCCAGCTAGACCTGTGTG
AGAGGTGTCTGGAAATCATGCATGGTGTATTTGGGACTATATCAACCTATTCTCCACACTTCAGACAACTGTCTGCACTCACGGCACACA
CACTTTGTATCATGCAGGCCACACTCAGAGCTAGTCAGTACATGAACAGTGGTGCGGTGCCAGTCTGTGTCCGTTGTGATCACAGGCCTT
GCTAGACCCTGATCATCTGGTTCTCCTCTCATTAAGCATCCCTAACCCCCAGTCACACCTTCCTCTTACATACTGTTCCCCAATGGAGGC
CCCTGGCATAGGGGACAGCCCTGGGCATCTTCCTTTGGTGTCTGGCTGTTTTGTCAACTCTCATCCACTGGTGGCTCAGAGCCATAAGGT
GGGTTGATTACACAATGCCTTGTACATGATATAGAGGCATCAAGCAAGTAAAATTTGACAGAAATTTTAAAATATGAAGATGTATAGCTT
TCCCAAGATGATGGTAAAACCCAGGTTAGTCATCAGTAACCTTCTCTATTATTATTATTTTTTAGAAACTTGGAATACTGTCGTCATGGC
TAAGAGAACAAATCTGATAAATTGTGTAACCTAGTCTCTTCTCTACATGGTGATGCATTTCAGCAATTATAAATTAATATAAATGACCAA
AAGTAACTTAAAAGCATGAGATATTTGCTATTTCATTCATTGGGCACATATCAAATTATAATTTTGATTTTAAATGGTCACCCATGTATT
TATTTGTTGCCAAGCAAGTAAAAAAATACCCTAACAAACCTGATGTGGGTGGGAGGGGCATGTCAGTAAGTGGTGTGTTCAATGTGTTTG
TTTCATATGGGCCCTTTCCAGGAGTTTGCAAACCTTGTCATACCCATATGCAAAACTGTGTTTCCTTGCATTAAACCAGTGAAGTTTGGG
TTCTCTTTTGTGCTATCAATCAGTTGTAAAATCAGAGCTGCTTATATATTCTACTGGAATAACTGCATCTTCCACTCAGTCACTACAAAA
AAGCATAGTTTCAGTTTGCATGAATTTTTTTTTTTTTCTTCAATGGCTGTGCAGATAAGGATCCATTTCTGGGATAGAATTGTATTTTTT


Top

FusionGenePPI for LPHN2_AK5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LPHN2SHANK1, CLN3, NCK1, NTRK1, TMEM17, TMEM216, IRF3, CDH1, CTDSPL, FLRT1, TMPRSS11BAK5C7orf26, CPNE6, NUCKS1, STRN4, TRIM46, UGDH, RNF114, CEBPA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LPHN2_AK5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LPHN2_AK5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAK5C0236733Amphetamine-Related Disorders1CTD_human