FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19902

FusionGeneSummary for LMNA_RAF1

check button Fusion gene summary
Fusion gene informationFusion gene name: LMNA_RAF1
Fusion gene ID: 19902
HgeneTgene
Gene symbol

LMNA

RAF1

Gene ID

4000

5894

Gene namelamin A/CRaf-1 proto-oncogene, serine/threonine kinase
SynonymsCDCD1|CDDC|CMD1A|CMT2B1|EMD2|FPL|FPLD|FPLD2|HGPS|IDC|LDP1|LFP|LGMD1B|LMN1|LMNC|LMNL1|MADA|PRO1CMD1NN|CRAF|NS5|Raf-1|c-Raf
Cytomap

1q22

3p25.2

Type of geneprotein-codingprotein-coding
Descriptionlamin70 kDa laminlamin A/C-like 1mandibuloacral dysplasia type Aprelamin-A/Crenal carcinoma antigen NY-REN-32RAF proto-oncogene serine/threonine-protein kinaseC-Raf proto-oncogene, serine/threonine kinaseOncogene RAF1proto-oncogene c-RAFraf proto-oncogene serine/threonine protein kinasev-raf-1 murine leukemia viral oncogene homolog 1v-raf-1 murine leukemia
Modification date2018052320180523
UniProtAcc

P02545

P04049

Ensembl transtripts involved in fusion geneENST00000368301, ENST00000361308, 
ENST00000347559, ENST00000368300, 
ENST00000368299, ENST00000448611, 
ENST00000368297, ENST00000473598, 
ENST00000392353, ENST00000496738, 
ENST00000251849, ENST00000442415, 
ENST00000534997, ENST00000542177, 
Fusion gene scores* DoF score11 X 12 X 6=7929 X 4 X 6=216
# samples 1412
** MAII scorelog2(14/792*10)=-2.50007360313464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/216*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LMNA [Title/Abstract] AND RAF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLMNA

GO:0090343

positive regulation of cell aging

20458013

TgeneRAF1

GO:0000186

activation of MAPKK activity

10644344

TgeneRAF1

GO:0007190

activation of adenylate cyclase activity

15385642

TgeneRAF1

GO:0008285

negative regulation of cell proliferation

9765203

TgeneRAF1

GO:0031333

negative regulation of protein complex assembly

19667065

TgeneRAF1

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneRAF1

GO:0043066

negative regulation of apoptotic process

19667065


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-EB-A5SF-01ALMNAchr1

156107534

+RAF1chr3

12641914

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000368301ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368301ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368301ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368301ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000361308ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000361308ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000361308ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000361308ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
intron-3CDSENST00000347559ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
intron-3CDSENST00000347559ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
intron-3CDSENST00000347559ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
intron-3CDSENST00000347559ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368300ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368300ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368300ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368300ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368299ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368299ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368299ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000368299ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000448611ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000448611ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000448611ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000448611ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368297ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368297ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368297ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000368297ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000473598ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000473598ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000473598ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
In-frameENST00000473598ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000392353ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000392353ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000392353ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
Frame-shitENST00000392353ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-
3UTR-3CDSENST00000496738ENST00000251849LMNAchr1

156107534

+RAF1chr3

12641914

-
3UTR-3CDSENST00000496738ENST00000442415LMNAchr1

156107534

+RAF1chr3

12641914

-
3UTR-3CDSENST00000496738ENST00000534997LMNAchr1

156107534

+RAF1chr3

12641914

-
3UTR-3CDSENST00000496738ENST00000542177LMNAchr1

156107534

+RAF1chr3

12641914

-

Top

FusionProtFeatures for LMNA_RAF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMNA

P02545

RAF1

P04049

Serine/threonine-protein kinase that acts as aregulatory link between the membrane-associated Ras GTPases andthe MAPK/ERK cascade, and this critical regulatory link functionsas a switch determining cell fate decisions includingproliferation, differentiation, apoptosis, survival and oncogenictransformation. RAF1 activation initiates a mitogen-activatedprotein kinase (MAPK) cascade that comprises a sequentialphosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 andMAP2K2/MEK2) and the extracellular signal-regulated kinases(MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (onresidues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at 'Ser-75'. Phosphorylates adenylylcyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation.Phosphorylates PPP1R12A resulting in inhibition of the phosphataseactivity. Phosphorylates TNNT2/cardiac muscle troponin T. Canpromote NF-kB activation and inhibit signal transducers involvedin motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2),proliferation and angiogenesis (RB1). Can protect cells fromapoptosis also by translocating to the mitochondria where it bindsBCL2 and displaces BAD/Bcl2-antagonist of cell death. RegulatesRho signaling and migration, and is required for normal woundhealing. Plays a role in the oncogenic transformation ofepithelial cells via repression of the TJ protein, occludin (OCLN)by inducing the up-regulation of a transcriptional repressorSNAI2/SLUG, which induces down-regulation of OCLN. Restrictscaspase activation in response to selected stimuli, notably Fasstimulation, pathogen-mediated macrophage apoptosis, and erythroiddifferentiation. {ECO:0000269|PubMed:11427728,ECO:0000269|PubMed:11719507, ECO:0000269|PubMed:15385642,ECO:0000269|PubMed:15618521, ECO:0000269|PubMed:15849194,ECO:0000269|PubMed:16892053, ECO:0000269|PubMed:16924233,ECO:0000269|PubMed:9360956}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for LMNA_RAF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_937aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTW
EIEASEVMLSTRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKH
LHVQETKFQMFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDN
NPFSFQSDVYSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHS

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_825aa
MGNSEGCNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKE
ELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAERNSNLVGAAHEEL
QQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEG
EEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ
NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLL
HHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVMLSTRIGSGSFGTVT
KGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQ
GMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSTGIVLTELMTG
ELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDI

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_825aa
MGNSEGCNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKE
ELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAERNSNLVGAAHEEL
QQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEG
EEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ
NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLL
HHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVMLSTRIGSGSFGTVT
KGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQ
GMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSTGIVLTELMTG
ELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDI

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_825aa
MGNSEGCNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKE
ELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAERNSNLVGAAHEEL
QQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEG
EEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ
NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLL
HHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVMLSTRIGSGSFGTVT
KGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQ
GMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSTGIVLTELMTG
ELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDI

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_825aa
MGNSEGCNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKE
ELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAERNSNLVGAAHEEL
QQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEG
EEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ
NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLL
HHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVMLSTRIGSGSFGTVT
KGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQ
GMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSTGIVLTELMTG
ELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDI

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_838aa
MDLEAWDPHLEPDAEAMVDGNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLR
RVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAE
RNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLAL
DMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN
EDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTV
VEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVML
STRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQ
MFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDV
YSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSAS

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_838aa
MDLEAWDPHLEPDAEAMVDGNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLR
RVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAE
RNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLAL
DMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN
EDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTV
VEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVML
STRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQ
MFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDV
YSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSAS

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_838aa
MDLEAWDPHLEPDAEAMVDGNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLR
RVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAE
RNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLAL
DMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN
EDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTV
VEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVML
STRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQ
MFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDV
YSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSAS

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_838aa
MDLEAWDPHLEPDAEAMVDGNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLR
RVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAKLDNARQSAE
RNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLAL
DMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSN
EDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTV
VEDDEDEDGDDLLHHHHDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSTTWEIEASEVML
STRIGSGSFGTVTKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQ
MFQLIDIARQTAQGMDTLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDV
YSTGIVLTELMTGELPTSHINNRDQIIFMVGRGTASPDLSKLTKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSAS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2811nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGA
AGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTG
CCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGG
GAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTT
GCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCAT
GTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACAC
CTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAG
AACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTA
AAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAAC
AACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAAC
AACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAG
AGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCT
CTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCC

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_2475nt
ATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAAC
TCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTT
GAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAG
GAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGG
AAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAG
CTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTG
CAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGAC
CTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATG
CAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGC
GAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGG
GGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTG
GAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAG
AATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCT
GGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAAC
TCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTC
CATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGC
TGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGA
CAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTAT
AAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTG
GCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGC
GAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAG
GGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATT
GGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCA
GAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGG
GAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATAT
AAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCT
TCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATC

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_2475nt
ATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAAC
TCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTT
GAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAG
GAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGG
AAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAG
CTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTG
CAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGAC
CTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATG
CAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGC
GAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGG
GGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTG
GAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAG
AATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCT
GGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAAC
TCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTC
CATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGC
TGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGA
CAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTAT
AAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTG
GCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGC
GAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAG
GGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATT
GGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCA
GAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGG
GAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATAT
AAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCT
TCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATC

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2475nt
ATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAAC
TCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTT
GAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAG
GAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGG
AAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAG
CTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTG
CAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGAC
CTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATG
CAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGC
GAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGG
GGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTG
GAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAG
AATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCT
GGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAAC
TCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTC
CATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGC
TGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGA
CAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTAT
AAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTG
GCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGC
GAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAG
GGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATT
GGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCA
GAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGG
GAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATAT
AAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCT
TCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATC

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2475nt
ATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAAC
TCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTT
GAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAG
GAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGG
AAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAG
CTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTG
CAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGAC
CTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATG
CAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGC
GAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGG
GGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTG
GAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAG
AATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCT
GGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAAC
TCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTC
CATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGC
TGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGA
CAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTAT
AAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTG
GCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGC
GAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAG
GGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATT
GGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCA
GAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGG
GAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATAT
AAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCT
TCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATC

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_2514nt
ATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGCAATACCAAGAAGGAGGGTGACCTGATAGCT
GCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAG
GGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGG
CGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAG
CGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGG
GCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAG
AGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTC
CAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCG
GAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTG
GACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGT
GGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGC
TTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAAT
GAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTG
AAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACC
TGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTG
GTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCA
GCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTA
TCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTG
TCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGAC
CCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTAC
ATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAG
ATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCC
AACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAG
GTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTC
TACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTG
GGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAA
GTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCC

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_2514nt
ATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGCAATACCAAGAAGGAGGGTGACCTGATAGCT
GCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAG
GGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGG
CGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAG
CGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGG
GCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAG
AGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTC
CAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCG
GAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTG
GACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGT
GGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGC
TTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAAT
GAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTG
AAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACC
TGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTG
GTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCA
GCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTA
TCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTG
TCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGAC
CCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTAC
ATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAG
ATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCC
AACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAG
GTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTC
TACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTG
GGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAA
GTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCC

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2514nt
ATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGCAATACCAAGAAGGAGGGTGACCTGATAGCT
GCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAG
GGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGG
CGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAG
CGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGG
GCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAG
AGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTC
CAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCG
GAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTG
GACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGT
GGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGC
TTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAAT
GAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTG
AAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACC
TGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTG
GTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCA
GCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTA
TCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTG
TCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGAC
CCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTAC
ATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAG
ATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCC
AACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAG
GTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTC
TACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTG
GGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAA
GTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCC

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2514nt
ATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGCAATACCAAGAAGGAGGGTGACCTGATAGCT
GCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAG
GGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGG
CGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAG
CGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGG
GCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAG
AGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTC
CAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCG
GAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTG
GACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGT
GGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGC
TTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAAT
GAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTG
AAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACC
TGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTG
GTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCA
GCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTA
TCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTG
TCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGAC
CCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTAC
ATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAG
ATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCC
AACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAG
GTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTC
TACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTG
GGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAA
GTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_3936nt
ACTCAGTGTTCGCGGGAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAG
GAGCAAGCCGAGAGCCAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCT
GCCCCGCGGGCAGCGCTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTC
CGCTGTCGCCCACCCGCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGC
GCTCGCTGGAAACGGAGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCG
CCTACGAGGCCGAGCTCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGC
GTGAGGAGTTTAAGGAGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTC
TGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGG
CCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCA
TGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTG
ACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATA
AGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACG
AGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGC
TTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGG
CAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCT
TGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACAC
AGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCG
TGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCA
AGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTG
CAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTC
TCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATG
ACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCC
CAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGC
CTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAA
CTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGA
ATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCC
AGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGA
CGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAG
TGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGA
TGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGA
TGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTA
AGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGA
TCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTG
AGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGA
GGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGA
CTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCT
GCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAG
CCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCA
GCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCA
GGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAA
GGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTG
AATTTTGTCTTCCAGGAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTT
CTCTAGTCACATCATGTGTATACAAGGAAGCCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACA

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_3739nt
ACTCAGTGTTCGCGGGAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAG
GAGCAAGCCGAGAGCCAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCT
GCCCCGCGGGCAGCGCTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTC
CGCTGTCGCCCACCCGCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGC
GCTCGCTGGAAACGGAGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCG
CCTACGAGGCCGAGCTCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGC
GTGAGGAGTTTAAGGAGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTC
TGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGG
CCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCA
TGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTG
ACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATA
AGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACG
AGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGC
TTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGG
CAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCT
TGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACAC
AGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCG
TGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCA
AGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTG
CAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTC
TCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATG
ACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCC
CAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGC
CTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAA
CTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGA
ATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCC
AGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGA
CGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAG
TGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGA
TGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGA
TGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTA
AGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGA
TCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTG
AGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGA
GGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGA
CTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCT
GCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAG
CCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCA
GCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCA
GGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAA
GGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTG

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_3270nt
ACTCAGTGTTCGCGGGAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAG
GAGCAAGCCGAGAGCCAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCT
GCCCCGCGGGCAGCGCTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTC
CGCTGTCGCCCACCCGCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGC
GCTCGCTGGAAACGGAGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCG
CCTACGAGGCCGAGCTCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGC
GTGAGGAGTTTAAGGAGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTC
TGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGG
CCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCA
TGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTG
ACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATA
AGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACG
AGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGC
TTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGG
CAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCT
TGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACAC
AGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCG
TGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCA
AGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTG
CAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTC
TCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATG
ACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCC
CAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGC
CTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAA
CTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGA
ATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCC
AGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGA
CGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAG
TGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGA
TGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGA
TGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTA
AGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGA
TCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTG
AGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGA
GGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGA
CTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCT

>In-frame_LMNA_ENST00000368300_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_3204nt
ACTCAGTGTTCGCGGGAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAG
GAGCAAGCCGAGAGCCAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCT
GCCCCGCGGGCAGCGCTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTC
CGCTGTCGCCCACCCGCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGC
GCTCGCTGGAAACGGAGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCG
CCTACGAGGCCGAGCTCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGC
GTGAGGAGTTTAAGGAGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTC
TGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGG
CCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCA
TGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTG
ACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATA
AGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACG
AGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGC
TTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGG
CAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCT
TGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACAC
AGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCG
TGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCA
AGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTG
CAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTC
TCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATG
ACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCC
CAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGC
CTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAA
CTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGA
ATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCC
AGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGA
CGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAG
TGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGA
TGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGA
TGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTA
AGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGA
TCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTG
AGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGA
GGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGA

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_3921nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCAC
AGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAG
ATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTA
AATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTC
TGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCA
GCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGG
ACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATT
TTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGA
TCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTC
CTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACT
GCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTG
AGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTT
GCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGG
CACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCT
TAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACAT
TCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCT
ACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATG
CATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTC
TGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATT
GGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAG
GAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCAT
GTGTATACAAGGAAGCCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTG

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_3724nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCAC
AGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAG
ATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTA
AATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTC
TGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCA
GCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGG
ACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATT
TTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGA
TCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTC
CTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACT
GCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTG
AGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTT
GCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGG
CACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCT
TAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACAT
TCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCT
ACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATG
CATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTC
TGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATT
GGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAG

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_3255nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCAC
AGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAG
ATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTA
AATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTC
TGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCA
GCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGG
ACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATT
TTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGA
TCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTC
CTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACT
GCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTG
AGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTT
GCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGG
CACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCT
TAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACAT

>In-frame_LMNA_ENST00000368299_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_3189nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCAC
AGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAG
ATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTA
AATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTC
TGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCA
GCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGG
ACTATTTGCATGCAAAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATT
TTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGA
TCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTC
CTTATTCTCACATCAACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACT
GCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTG
AGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTT
GCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGG
CACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCT

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_3432nt
GAGACCCTCTGCTCTTCTGCTCCCTTCCTGTGTGCTGCCTGGCAATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGA
TAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGC
TGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGC
TGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGA
CCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAAC
TGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTG
CTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCC
AGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGC
TGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGG
CCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCA
GCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCA
GCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGT
CCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCA
CCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGA
ACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGA
CTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCAC
CTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCAC
CAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGA
TGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTG
TCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGG
GGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGT
TTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGA
AATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTC
AGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGG
ATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCA
TGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGA
AGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCG
CTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGT
TGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACA
TGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCT
GGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAG
TGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCA
GCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGC
GCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTT
TTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCAT
CTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATGGGGCGGGGCCGCAGGGCCAGCCTTG
TTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCATGTGTATACAAGGAAGCCAGGAATACAGGTTTTCTTGATG
ATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTGATGGTCCCTCAATTATGTTATTTTAATAAAATAAATTAA

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_3235nt
GAGACCCTCTGCTCTTCTGCTCCCTTCCTGTGTGCTGCCTGGCAATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGA
TAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGC
TGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGC
TGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGA
CCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAAC
TGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTG
CTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCC
AGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGC
TGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGG
CCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCA
GCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCA
GCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGT
CCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCA
CCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGA
ACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGA
CTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCAC
CTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCAC
CAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGA
TGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTG
TCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGG
GGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGT
TTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGA
AATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTC
AGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGG
ATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCA
TGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGA
AGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCG
CTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGT
TGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACA
TGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCT
GGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAGGCCCAGCCTTCTGTAGATGCGCAAG
TGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAGAGGAAGTAAGGTAGCAGGCAGTCCA
GCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGGGACTTTCTTCAGAGAGTGGTGCAGC
GCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGGAGCCTGCTTTGGTACTATGGAACTT
TTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCAGGCAAGGCACTCGGCCAATCCGCAT

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2766nt
GAGACCCTCTGCTCTTCTGCTCCCTTCCTGTGTGCTGCCTGGCAATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGA
TAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGC
TGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGC
TGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGA
CCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAAC
TGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTG
CTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCC
AGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGC
TGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGG
CCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCA
GCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCA
GCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGT
CCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCA
CCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGA
ACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGA
CTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCAC
CTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCAC
CAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGA
TGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTG
TCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGG
GGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGT
TTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGA
AATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTC
AGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGG
ATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCA
TGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGA
AGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCG
CTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGT
TGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACA
TGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCT

>In-frame_LMNA_ENST00000448611_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2700nt
GAGACCCTCTGCTCTTCTGCTCCCTTCCTGTGTGCTGCCTGGCAATGGGGAACTCTGAGGGCTGCAATACCAAGAAGGAGGGTGACCTGA
TAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGC
TGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGC
TGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGA
CCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAAC
TGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTG
CTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCC
AGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGC
TGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGG
CCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCA
GCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCA
GCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGT
CCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCA
CCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGA
ACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGA
CTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATTCGAAGTCACAGCGAATCAGCCTCAC
CTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCCGTGCCAGCACAAAGAGAGCGGGCAC
CAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTATTGGGAAATAGAAGCCAGTGAAGTGA
TGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGATGTTGCAGTAAAGATCCTAAAGGTTG
TCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGGCATGTGAACATTCTGCTTTTCATGG
GGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAACACCTGCATGTCCAGGAGACCAAGT
TTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCAAAGAACATCATCCATAGAGACATGA
AATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACAGTAAAGTCACGCTGGAGTGGTTCTC
AGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGATAACAACCCATTCAGTTTCCAGTCGG
ATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATCAACAACCGAGATCAGATCATCTTCA
TGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATGAAGAGGCTGGTAGCTGACTGTGTGA
AGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACACTCTCTACCGAAGATCAACCGGAGCG
CTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACGTCCCCGAGGCTGCCTGTCTTCTAGT
TGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGCTCCCTTTCTCCAGAGGCAGAACACA
TGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGCCTTCTTTTCTATCCCTTTGGGCCCT

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000251849_chr3_12641914_-_3547nt
AAACAGCCCCAAGGGCCCGGGCCTGCTGCAGCTGGGGAGCCGGACTTCCTTGTCCCACCAGGCACAGCTCTTCAGACCCCTGCCTTGGGT
CACATTTGGAGGCTTAAAGCTGGGGCCCAGATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGC
AATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGC
ACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCC
AAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAAC
ATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGC
CGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCC
AAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATC
GACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGT
GAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTAC
CAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTG
TCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGC
AAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGC
AAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTG
ACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCT
ACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCC
ATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATT
CGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCC
GTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTAT
TGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGAT
GTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGG
CATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAA
CACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCA
AAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACA
GTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGAT
AACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATC
AACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATG
AAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACAC
TCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACG
TCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGC
TCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGC
CTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAG
GCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAG
AGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGG
GACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGG
AGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCA
GGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATG
GGGCGGGGCCGCAGGGCCAGCCTTGTTTCTCTAACAAACAAACAAACAAACAGCCTTGTTTCTCTAGTCACATCATGTGTATACAAGGAA
GCCAGGAATACAGGTTTTCTTGATGATTTGGGTTTTAATTTTGTTTTTATTGCACCTGACAAAATACAGTTATCTGATGGTCCCTCAATT

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000442415_chr3_12641914_-_3350nt
AAACAGCCCCAAGGGCCCGGGCCTGCTGCAGCTGGGGAGCCGGACTTCCTTGTCCCACCAGGCACAGCTCTTCAGACCCCTGCCTTGGGT
CACATTTGGAGGCTTAAAGCTGGGGCCCAGATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGC
AATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGC
ACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCC
AAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAAC
ATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGC
CGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCC
AAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATC
GACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGT
GAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTAC
CAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTG
TCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGC
AAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGC
AAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTG
ACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCT
ACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCC
ATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATT
CGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCC
GTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTAT
TGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGAT
GTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGG
CATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAA
CACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCA
AAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACA
GTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGAT
AACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATC
AACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATG
AAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACAC
TCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACG
TCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGC
TCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGC
CTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAG
GCCCAGCCTTCTGTAGATGCGCAAGTGGATGTTGATGGTAGTACAAAAAGCAGGGGCCCAGCCCCAGCTGTTGGCTACATGAGTATTTAG
AGGAAGTAAGGTAGCAGGCAGTCCAGCCCTGATGTGGAGACACATGGGATTTTGGAAATCAGCTTCTGGAGGAATGCATGTCACAGGCGG
GACTTTCTTCAGAGAGTGGTGCAGCGCCAGACATTTTGCACATAAGGCACCAAACAGCCCAGGACTGCCGAGACTCTGGCCGCCCGAAGG
AGCCTGCTTTGGTACTATGGAACTTTTCTTAGGGGACACGTCCTCCTTTCACAGCTTCTAAGGTGTCCAGTGCATTGGGATGGTTTTCCA
GGCAAGGCACTCGGCCAATCCGCATCTCAGCCCTCTCAGGGAGCAGTCTTCCATCATGCTGAATTTTGTCTTCCAGGAGCTGCCCCTATG

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000534997_chr3_12641914_-_2881nt
AAACAGCCCCAAGGGCCCGGGCCTGCTGCAGCTGGGGAGCCGGACTTCCTTGTCCCACCAGGCACAGCTCTTCAGACCCCTGCCTTGGGT
CACATTTGGAGGCTTAAAGCTGGGGCCCAGATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGC
AATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGC
ACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCC
AAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAAC
ATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGC
CGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCC
AAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATC
GACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGT
GAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTAC
CAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTG
TCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGC
AAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGC
AAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTG
ACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCT
ACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCC
ATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATT
CGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCC
GTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTAT
TGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGAT
GTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGG
CATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAA
CACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCA
AAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACA
GTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGAT
AACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATC
AACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATG
AAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACAC
TCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACG
TCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGC
TCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGC
CTTCTTTTCTATCCCTTTGGGCCCTGGGAGAAGGAAGCCATTTGCAGTGCTGGTGTGTCCTGCTCCCTCCCCACATTCCCCATGCTCAAG

>In-frame_LMNA_ENST00000473598_chr1_156107534_+_RAF1_ENST00000542177_chr3_12641914_-_2815nt
AAACAGCCCCAAGGGCCCGGGCCTGCTGCAGCTGGGGAGCCGGACTTCCTTGTCCCACCAGGCACAGCTCTTCAGACCCCTGCCTTGGGT
CACATTTGGAGGCTTAAAGCTGGGGCCCAGATGGACCTGGAGGCCTGGGATCCACATCTGGAACCAGATGCTGAGGCTATGGTAGATGGC
AATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGC
ACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCC
AAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAAC
ATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGC
CGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCC
AAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATC
GACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGT
GAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTAC
CAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTG
TCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGC
AAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGC
AAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTG
ACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCT
ACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCC
ATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGATGCAATT
CGAAGTCACAGCGAATCAGCCTCACCTTCAGCCCTGTCCAGTAGCCCCAACAATCTGAGCCCAACAGGCTGGTCACAGCCGAAAACCCCC
GTGCCAGCACAAAGAGAGCGGGCACCAGTATCTGGGACCCAGGAGAAAAACAAAATTAGGCCTCGTGGACAGAGAGATTCAAGCTATTAT
TGGGAAATAGAAGCCAGTGAAGTGATGCTGTCCACTCGGATTGGGTCAGGCTCTTTTGGAACTGTTTATAAGGGTAAATGGCACGGAGAT
GTTGCAGTAAAGATCCTAAAGGTTGTCGACCCAACCCCAGAGCAATTCCAGGCCTTCAGGAATGAGGTGGCTGTTCTGCGCAAAACACGG
CATGTGAACATTCTGCTTTTCATGGGGTACATGACAAAGGACAACCTGGCAATTGTGACCCAGTGGTGCGAGGGCAGCAGCCTCTACAAA
CACCTGCATGTCCAGGAGACCAAGTTTCAGATGTTCCAGCTAATTGACATTGCCCGGCAGACGGCTCAGGGAATGGACTATTTGCATGCA
AAGAACATCATCCATAGAGACATGAAATCCAACAATATATTTCTCCATGAAGGCTTAACAGTGAAAATTGGAGATTTTGGTTTGGCAACA
GTAAAGTCACGCTGGAGTGGTTCTCAGCAGGTTGAACAACCTACTGGCTCTGTCCTCTGGATGGCCCCAGAGGTGATCCGAATGCAGGAT
AACAACCCATTCAGTTTCCAGTCGGATGTCTACTCCTATGGCATCGTATTGTATGAACTGATGACGGGGGAGCTTCCTTATTCTCACATC
AACAACCGAGATCAGATCATCTTCATGGTGGGCCGAGGATATGCCTCCCCAGATCTTAGTAAGCTATATAAGAACTGCCCCAAAGCAATG
AAGAGGCTGGTAGCTGACTGTGTGAAGAAAGTAAAGGAAGAGAGGCCTCTTTTTCCCCAGATCCTGTCTTCCATTGAGCTGCTCCAACAC
TCTCTACCGAAGATCAACCGGAGCGCTTCCGAGCCATCCTTGCATCGGGCAGCCCACACTGAGGATATCAATGCTTGCACGCTGACCACG
TCCCCGAGGCTGCCTGTCTTCTAGTTGACTTTGCACCTGTCTTCAGGCTGCCAGGGGAGGAGGAGAAGCCAGCAGGCACCACTTTTCTGC
TCCCTTTCTCCAGAGGCAGAACACATGTTTTCAGAGAAGCTGCTGCTAAGGACCTTCTAGACTGCTCACAGGGCCTTAACTTCATGTTGC


Top

FusionGenePPI for LMNA_RAF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMNALMNB1, SREBF1, NARF, EMD, KAT5, TMPO, ZNF239, SYNE1, RB1, ALOX12, PRKCA, TOR1A, TOR1AIP1, FYCO1, BANF1, RBBP4, ING1, CTNNB1, SRRM1, SRRM2, MORF4L1, MORF4L2, MRGBP, H2AFX, MYC, UCHL5, YWHAQ, MME, CTCF, SVIL, PRKDC, STAC, SIRT7, ISG15, PPP1CC, CDK2, PCBP1, EGF, LMNA, UBE2I, PCGF2, MRPS26, FLNA, UNC13D, SF3B3, WDR18, HNRNPM, SLC25A6, PMS2, SLC25A5, NONO, GZMB, GZMA, VCP, MLIP, FN1, VCAM1, CDH1, ITGA4, URB2, PHB, LEMD3, FAM169A, LBR, TMEM201, NUMA1, ANLN, LMNB2, NUP153, NUP50, AHCTF1, POM121, TPR, NUP98, NUP155, RANBP2, NUP133, RANGAP1, MCM3AP, NUP214, HIST1H4G, SAP30BP, SCML2, HP1BP3, ZBTB33, TOX4, TRIM28, FHL1, NELFE, ZNF280C, H2AFY, GTF2A1, BAZ1B, ORC2, GTF2F2, CHD8, SUPT5H, RUVBL1, SMARCA5, PML, TOP2A, MTDH, THRAP3, CXorf56, TAGLN2, TMEM230, ARPIN, C9orf78, PDAP1, CCDC47, DNAJC1, WDR70, RNF113A, YKT6, VRK2, CISD2, CTTN, LRRC59, CD2AP, EIF5, PCMT1, SRPRB, ACE, ALDH3A2, PDLIM3, FASN, CDKAL1, HNRNPA1, DDX46, HNRNPA0, DDX42, SUGP1, HNRNPA2B1, PAPOLA, RBM10, FUS, GPATCH1, SF1, U2SURP, DGCR14, HNRNPR, TFIP11, DDX3X, PPM1G, CPSF6, PDCD5, PCNP, TPX2, WWOX, MKI67, MASTL, HCFC1, CRK, SDCBP, PGRMC2, CRKL, HN1L, GPKOW, FAM192A, NPLOC4, PARP1, MRE11A, MDC1, XRCC6, RIF1, BRIP1, TIPRL, UBE2M, SENP1, USP15, SENP6, NCL, GNL2, CDK16, FBXO6, PARK2, KCTD12, KIAA0196, KPNA6, EEF1D, GMPPB, PSMD10, ZW10, ROCK2, TP53, RAPGEF2, DUSP13, KRTAP10-7, KRTAP10-3, ENO1, SHMT2, MOV10, NXF1, C17orf49, CUL7, OBSL1, CCDC8, EED, SIRT6, ILK, IRAK1, LIMK2, MAST3, ABCE1, USP7, DYNLT1, RPA1, NTRK1, SCARNA22, ANKRA2, RFXANK, STX5, HERC2, SRPK2, CLK1, CC2D2A, HIST1H3E, PPME1, MCM2, MCM5, SNW1, CDC5L, SMURF1, BMI1, CA5A, EGFR, SUN2, CYLD, SPTA1, EIF2AK2, DLST, PDHA1, SDHA, SOD1, TRIM25, G3BP1, ANXA6, APOA2, APOD, AQP1, AQP3, ASGR1, ATP6V0C, BCL2L2, BNIP2, BNIP3, BNIP3L, BYSL, C5, CACNG1, CCNG1, MS4A1, SCARB2, ENTPD3, CD72, CD81, CD52, CETN3, CLCN7, COL8A2, CRY2, CYB561, F2RL1, FCER1A, FCER1G, FDFT1, GALNT2, GJB2, GJB5, GPR25, GRM2, HCK, HMOX1, HMOX2, IFIT2, IGFBP5, ITGAM, KCNK1, KPNA1, KPNA3, KPNA4, KRT6A, LAMB1, LCP2, SMAD1, MAL, MEOX1, MFAP1, MGST3, MIP, MUTYH, NAB2, NEU1, NINJ2, NKG7, SERPINE1, PCNA, PIK3R2, PKD2, FXYD3, PLP1, PLP2, PMP22, PNLIPRP1, CTSA, PRNP, PTPN9, RHAG, RTN1, SFTPC, SIAH1, SLC1A1, SLC2A5, SLC7A1, SLN, SPN, STX3, STX4, VAMP1, VAMP2, SYPL1, TAP1, TCEA2, TCEB3, TDO2, TFRC, THBD, TSPAN7, TNF, UPK1B, ZNF3, ZNF69, ZNF138, TRIM26, SLC30A2, SLC30A3, MALL, STX7, CHST1, AOC3, EIF3G, VAMP4, TNFSF12, CDS2, TNFRSF10C, TMEM11, NAT8, PIAS2, CLDN10, USP2, SYNGR1, PTPLA, ZMYM6, VAMP3, ITM2B, STX8, CXCL14, SEC22B, GOSR2, ZSCAN12, RANBP9, TSPAN2, LINC01587, ALG3, STX6, RTN3, ABCA9, BTN2A2, WFDC2, FAM3C, CREB3, VTI1B, SLC35A1, RABAC1, SLU7, SLMO1, VAMP5, MTHFD2, FAXDC2, USP20, STARD3, MAPRE2, CYB561D2, C14orf1, PNKP, ACOT7, MGLL, CLCA4, SACM1L, ARL6IP1, LEPROTL1, LPAR3, STX12, APOL2, IFFO1, UNC50, LRP10, OSTF1, SEC22A, FETUB, LAT, SERP1, ARHGEF16, TMEM14A, TMEM208, EMR2, CLEC4A, DERL2, GOLT1B, PLLP, SBDS, INSIG2, CLEC1A, SPG21, AIG1, SCARA3, TMEM14C, FXYD6, C11orf24, SMIM11, YIPF1, GIN1, PAQR5, CLN6, PARPBP, TMEM51, WDYHV1, FAIM, SLC38A7, TMEM140, CSGALNACT2, DDX43, UBE2Q1, LIMS2, USE1, DBNDD2, UNC45A, TMEM234, RPRM, TMPRSS4, TRIM39, KCNK13, GPR108, DUS3L, SMCO4, DDX24, AGTRAP, RTN4, NIPAL3, ZNF490, CXCL16, SELK, SENP2, TNMD, EDDM3B, LMBR1, RGS18, C5orf28, SPANXD, SPANXC, C16orf58, SLC13A3, VKORC1, ALG8, TMEM109, DERL1, FA2H, TMEM243, TMEM43, C17orf62, C3orf52, ZC2HC1C, TM4SF20, CYBRD1, GOLGA2P10, ADAM33, TSGA10, CYB5B, CFHR5, VMP1, TMEM14B, MARVELD1, TMEM222, SLC41A2, FAM161A, DNAJC30, TMEM107, JAGN1, PERM1, GPR128, SLC35B4, MFSD5, COX14, TMEM128, TMEM60, AQP10, FATE1, CCDC120, TMEM41A, ZNF439, MYADM, REEP6, SYCE1, ORMDL1, ORMDL3, TMEM203, CMTM7, KIF12, TMEM54, SLC35A4, OSBPL8, C1QTNF1, CMTM5, CMTM3, CLDND2, ZNF440, IZUMO2, C20orf141, TMEM42, TRAM1L1, DEFB127, UBQLNL, CWF19L2, TMEM86A, TMEM120B, TMEM199, CCDC155, ZNF569, SYT6, CNIH3, RMDN2, SH3RF2, TMEM65, TMEM74, ZDHHC15, SGMS2, SLC30A8, TCEANC, FAM9B, PPAPDC1A, OSTCP1, TSNARE1, AQPEP, ZNF25, TMEM218, MMD2, LHFPL5, ZDHHC24, NALCN, BRICD5, VSTM1, YIPF6, TSPAN33, STAC2, SLC35B2, SFT2D2, SERP2, C2orf82, C4orf3, CENPP, ANKRD20A5P, BRCA1, EFTUD2, LUC7L3, NPM1, PRPF19, RNPS1, SRSF1, SRSF3, SRSF4, TRA2B, ALYREF, U2AF2, MYO1C, DKC1, FBL, GAR1, NHP2, NOP58, SFPQ, MATR3, HNRNPU, HIST1H1A, HIST1H1B, HIST1H1C, HIST1H2BB, HIST1H3A, HIST2H2AB, HIST1H4H, H2AFZ, TTN, DDX23, DDX5, DHX15, HNRNPA1L2, HNRNPA3, HNRNPC, HNRNPH1, HNRNPK, PRPF6, RALY, SF3B1, SNRNP40, SNRPD1, SNRPD2, SNRPD3, YBX1, ACIN1, DDX18, DDX21, ILF2, ILF3, MYBBP1A, NOP2, NOP56, RPF2, RPL5, RPL6, RPL11, RPS3A, RPS6, RPS7, RPS25, RSL1D1, SRSF5, SRSF9, TOP1, UBTF, CD2BP2, CSNK2A1, ELAVL1, HNRNPL, PHB2, RPS2, SAP18, SSRP1, URI1, TP53BP1RAF1YWHAQ, YWHAG, YWHAZ, SFN, HRAS, VDAC1, PEBP4, CNKSR1, RASD2, CNKSR2, ERAS, SPRY4, SPRY2, YWHAB, OIP5, PHKA2, CCT3, MYC, AR, MRAS, KRAS, LRPAP1, RRAS2, SHOC2, TSC22D3, STK26, MAPK1, MAPK3, PRKCE, BCL2, BCL2L1, PEBP1, MAP2K1, GRB10, NRAS, MAPK8IP3, AKT1, HSP90AA1, GNG4, GNB2, VAV1, RHEB, RAP1A, SRC, FYN, RB1, RBL2, PRKG1, JAK2, YWHAH, CFLAR, CDC25A, BRAF, MAP3K1, PDGFRB, MAP3K5, MAPK7, PHB, BAG1, PAK1, PRKCZ, RRAS, PRPF6, UBE2D2, YWHAE, NR3C1, LCK, LTK, JAK1, XIAP, BIRC2, BIRC3, STUB1, EEF1A1, HSPA8, HSPA5, CALM1, SGK1, NEDD4, SCNN1B, NEDD4L, STK3, BRAP, WDR83, KSR1, LATS1, MAP2K2, RFXANK, PPP1CC, VCP, HSPD1, BAD, BCL6, BIRC7, PIN1, MMS19, PPP2R1A, PPP2R2B, PPP2CA, HSPA4, RAF1, PPP2CB, MAPK8, RBBP8, YY1, PKM, CDK20, HIPK4, TBXA2R, SH3KBP1, ILK, GPRASP2, CDC37, IRS4, FAM96B, HUWE1, RANBP9, TMEM70, PACSIN3, NPLOC4, PRKAR1A, DCAF8, PURA, FYCO1, MYBPC1, COPS7A, MOV10, NXF1, EGFR, CALU, CCT8, DNAJA1, EMD, TIMM50, LOX, ARRB2, AGTR1, CASZ1, MRC2, PDLIM2, HERC2, XPO1, ACOX1, PCDH7, MAD2L1, SYNPO, TMEM63B, EEF1E1, COPS5, SS18L2, NUP133, RPGRIP1L, NCAPG2, NUP107, MSH2, LAS1L, AMER1, NUP160, EIF3D, SPATA7, NPHP4, DYNLL2, DYNLL1, IQCB1, RMDN3, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMNA_RAF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneRAF1P04049DB08896RegorafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved
TgeneRAF1P04049DB00398SorafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational
TgeneRAF1P04049DB08862CholecystokininRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational
TgeneRAF1P04049DB08912DabrafenibRAF proto-oncogene serine/threonine-protein kinasesmall moleculeapproved|investigational

Top

RelatedDiseases for LMNA_RAF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLMNAC0410190Autosomal Dominant Emery-Dreifuss Muscular Dystrophy (disorder)19ORPHANET;UNIPROT
HgeneLMNAC1449563Cardiomyopathy, Familial Idiopathic17ORPHANET;UNIPROT
HgeneLMNAC0033300Progeria14CTD_human;ORPHANET;UNIPROT
HgeneLMNAC1720860Familial Partial Lipodystrophy, Type 210ORPHANET;UNIPROT
HgeneLMNAC1834653MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 1B (disorder)7CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0432291Mandibuloacral dysostosis5CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0271694Familial partial lipodystrophy4CTD_human
HgeneLMNAC0007193Cardiomyopathy, Dilated3CTD_human;HPO
HgeneLMNAC0796031Malouf syndrome3ORPHANET;UNIPROT
HgeneLMNAC2750035Emery-Dreifuss Muscular Dystrophy 32UNIPROT
HgeneLMNAC2750785MUSCULAR DYSTROPHY, CONGENITAL, LMNA-RELATED (disorder)2CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0016508Congenital Foot Deformity1CTD_human
HgeneLMNAC0018566Congenital Hand Deformities1CTD_human
HgeneLMNAC0018794Heart Block1CTD_human
HgeneLMNAC0032460Polycystic Ovary Syndrome1CTD_human;HPO
HgeneLMNAC0036420Localized scleroderma1CTD_human
HgeneLMNAC0037188Sinoatrial Block1CTD_human
HgeneLMNAC0042514Tachycardia, Ventricular1CTD_human
HgeneLMNAC0085298Sudden Cardiac Death1CTD_human;HPO
HgeneLMNAC0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneLMNAC0376634Craniofacial Abnormalities1CTD_human
HgeneLMNAC0410189Muscular Dystrophy, Emery-Dreifuss1CTD_human
HgeneLMNAC0686353Muscular Dystrophies, Limb-Girdle1CTD_human;HPO
HgeneLMNAC1136321HIV-Associated Lipodystrophy Syndrome1CTD_human
HgeneLMNAC1854154Charcot-Marie-Tooth disease, Type 2B11CTD_human;ORPHANET;UNIPROT
TgeneRAF1C1969057Noonan Syndrome 53CTD_human;UNIPROT
TgeneRAF1C0007194Hypertrophic Cardiomyopathy2CTD_human;HPO
TgeneRAF1C0028326Noonan Syndrome2CTD_human;ORPHANET
TgeneRAF1C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneRAF1C0007193Cardiomyopathy, Dilated1CTD_human;HPO
TgeneRAF1C0017638Glioma1CTD_human
TgeneRAF1C0020429Hyperalgesia1CTD_human
TgeneRAF1C0022665Kidney Neoplasm1CTD_human
TgeneRAF1C0023903Liver neoplasms1CTD_human
TgeneRAF1C0024121Lung Neoplasms1CTD_human
TgeneRAF1C0175704LEOPARD Syndrome1CTD_human;ORPHANET
TgeneRAF1C0345967Malignant mesothelioma1CTD_human
TgeneRAF1C1458155Mammary Neoplasms1CTD_human
TgeneRAF1C4014656CARDIOMYOPATHY, DILATED, 1NN1UNIPROT