FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19897

FusionGeneSummary for LMNA_IGFBP2

check button Fusion gene summary
Fusion gene informationFusion gene name: LMNA_IGFBP2
Fusion gene ID: 19897
HgeneTgene
Gene symbol

LMNA

IGFBP2

Gene ID

4000

3485

Gene namelamin A/Cinsulin like growth factor binding protein 2
SynonymsCDCD1|CDDC|CMD1A|CMT2B1|EMD2|FPL|FPLD|FPLD2|HGPS|IDC|LDP1|LFP|LGMD1B|LMN1|LMNC|LMNL1|MADA|PRO1IBP2|IGF-BP53
Cytomap

1q22

2q35

Type of geneprotein-codingprotein-coding
Descriptionlamin70 kDa laminlamin A/C-like 1mandibuloacral dysplasia type Aprelamin-A/Crenal carcinoma antigen NY-REN-32insulin-like growth factor-binding protein 2IGF-binding protein 2insulin-like growth factor binding protein 2, 36kDa
Modification date2018052320180523
UniProtAcc

P02545

P18065

Ensembl transtripts involved in fusion geneENST00000368301, ENST00000361308, 
ENST00000347559, ENST00000368300, 
ENST00000368299, ENST00000448611, 
ENST00000368297, ENST00000473598, 
ENST00000392353, ENST00000496738, 
ENST00000233809, ENST00000456764, 
Fusion gene scores* DoF score11 X 12 X 6=7922 X 2 X 2=8
# samples 142
** MAII scorelog2(14/792*10)=-2.50007360313464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: LMNA [Title/Abstract] AND IGFBP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneLMNA

GO:0090343

positive regulation of cell aging

20458013

TgeneIGFBP2

GO:0042104

positive regulation of activated T cell proliferation

15694994


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-EO-A3AY-01ALMNAchr1

156109108

+IGFBP2chr2

217525456

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000368301ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000368301ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000361308ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000361308ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
3UTR-3CDSENST00000347559ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
3UTR-3CDSENST00000347559ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
3UTR-3CDSENST00000368300ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
3UTR-3CDSENST00000368300ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
In-frameENST00000368299ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
In-frameENST00000368299ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000448611ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000448611ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000368297ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000368297ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000473598ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000473598ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000392353ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000392353ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000496738ENST00000233809LMNAchr1

156109108

+IGFBP2chr2

217525456

+
intron-3CDSENST00000496738ENST00000456764LMNAchr1

156109108

+IGFBP2chr2

217525456

+

Top

FusionProtFeatures for LMNA_IGFBP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMNA

P02545

IGFBP2

P18065

Inhibits IGF-mediated growth and developmental rates.IGF-binding proteins prolong the half-life of the IGFs and havebeen shown to either inhibit or stimulate the growth promotingeffects of the IGFs on cell culture. They alter the interaction ofIGFs with their cell surface receptors.{ECO:0000269|PubMed:19081843}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for LMNA_IGFBP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000233809_chr2_217525456_+_864aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQSPQNCSIM_SGTCQAGVGVEASCV
LLTSCPPPALHVMGGGLKPKKNNPLVFFFCIFFSKRSTFLQWFTTEGKTQAKKKKNNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLK
SGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQC

>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000456764_chr2_217525456_+_864aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARK
TLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQTKKELEKTTSAK
LDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGK
FVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQSPQNCSIM_SGTCQAGVGVEASCV
LLTSCPPPALHVMGGGLKPKKNNPLVFFFCIFFSKRSTFLQWFTTEGKTQAKKKKNNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLK
SGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000233809_chr2_217525456_+_2592nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGGCTCCCACTGC
AGCAGCTCGGGGGACCCCGCTGAGTACAACCTGCGCTCGCGCACCGTGCTGTGCGGGACCTGCGGGCAGCCTGCCGACAAGGCATCTGCC
AGCGGCTCAGGAGCCCAGAGCCCCCAGAACTGCAGCATCATGTAATCTGGGACCTGCCAGGCAGGGGTGGGGGTGGAGGCTTCCTGCGTC
CTCCTCACCTCATGCCCACCCCCTGCCCTGCACGTCATGGGAGGGGGCTTGAAGCCAAAGAAAAATAACCCTTTGGTTTTTTTCTTCTGT
ATTTTTTTTTCTAAGAGAAGTTATTTTCTACAGTGGTTTTATACTGAAGGAAAAACACAAGCAAAAAAAAAAAAAAACAATGGCGATGAC
CACTCAGAAGGAGGCCTGGTGGAGAACCACGTGGACAGCACCATGAACATGTTGGGCGGGGGAGGCAGTGCTGGCCGGAAGCCCCTCAAG
TCGGGTATGAAGGAGCTGGCCGTGTTCCGGGAGAAGGTCACTGAGCAGCACCGGCAGATGGGCAAGGGTGGCAAGCATCACCTTGGCCTG
GAGGAGCCCAAGAAGCTGCGACCACCCCCTGCCAGGACTCCCTGCCAACAGGAACTGGACCAGGTCCTGGAGCGGATCTCCACCATGCGC
CTTCCGGATGAGCGGGGCCCTCTGGAGCACCTCTACTCCCTGCACATCCCCAACTGTGACAAGCATGGCCTGTACAACCTCAAACAGTGC
AAGATGTCTCTGAACGGGCAGCGTGGGGAGTGCTGGTGTGTGAACCCCAACACCGGGAAGCTGATCCAGGGAGCCCCCACCATCCGGGGG

>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000456764_chr2_217525456_+_2592nt
ATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCCGCATCACCCGGCTGCAG
GAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGGAGAACGCAGGGCTGCGC
CTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGCTCGGGGATGCCCGCAAG
ACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGGAGCTGAAAGCGCGCAAT
ACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGGAGGCCGCACTGAGCACT
GCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAGCCCTAGGTGAGGCCAAG
AAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGGACTTCCAGAAGAACATC
TACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGCGTGAGTTTGAGAGCCGG
CTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGAAGACTTATTCTGCCAAG
CTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGTCGCGCATCCGCATCGAC
AGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGGACTCACTGGCCCGTGAG
CGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGCAGCTGGACGAGTACCAG
GAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGGAGAGGCTACGCCTGTCC
CCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCGTCACCAAAAAGCGCAAA
CTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGGTGGATGAGGAGGGCAAG
TTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAGATGATCCCTTGCTGACT
TACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCACCCACAGCCCCCCTACC
GACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTGGGGAAGAAGTGGCCATG
CGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACCACCACGGCTCCCACTGC
AGCAGCTCGGGGGACCCCGCTGAGTACAACCTGCGCTCGCGCACCGTGCTGTGCGGGACCTGCGGGCAGCCTGCCGACAAGGCATCTGCC
AGCGGCTCAGGAGCCCAGAGCCCCCAGAACTGCAGCATCATGTAATCTGGGACCTGCCAGGCAGGGGTGGGGGTGGAGGCTTCCTGCGTC
CTCCTCACCTCATGCCCACCCCCTGCCCTGCACGTCATGGGAGGGGGCTTGAAGCCAAAGAAAAATAACCCTTTGGTTTTTTTCTTCTGT
ATTTTTTTTTCTAAGAGAAGTTATTTTCTACAGTGGTTTTATACTGAAGGAAAAACACAAGCAAAAAAAAAAAAAAACAATGGCGATGAC
CACTCAGAAGGAGGCCTGGTGGAGAACCACGTGGACAGCACCATGAACATGTTGGGCGGGGGAGGCAGTGCTGGCCGGAAGCCCCTCAAG
TCGGGTATGAAGGAGCTGGCCGTGTTCCGGGAGAAGGTCACTGAGCAGCACCGGCAGATGGGCAAGGGTGGCAAGCATCACCTTGGCCTG
GAGGAGCCCAAGAAGCTGCGACCACCCCCTGCCAGGACTCCCTGCCAACAGGAACTGGACCAGGTCCTGGAGCGGATCTCCACCATGCGC
CTTCCGGATGAGCGGGGCCCTCTGGAGCACCTCTACTCCCTGCACATCCCCAACTGTGACAAGCATGGCCTGTACAACCTCAAACAGTGC
AAGATGTCTCTGAACGGGCAGCGTGGGGAGTGCTGGTGTGTGAACCCCAACACCGGGAAGCTGATCCAGGGAGCCCCCACCATCCGGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000233809_chr2_217525456_+_2944nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGGCTCCCACTGCAGCAGCTCGGGGGACCCCGCTGAGTACAACCTGCGCTCGCGCACCGTGCTGTGCGGGACCTGCGGGCAGCCTG
CCGACAAGGCATCTGCCAGCGGCTCAGGAGCCCAGAGCCCCCAGAACTGCAGCATCATGTAATCTGGGACCTGCCAGGCAGGGGTGGGGG
TGGAGGCTTCCTGCGTCCTCCTCACCTCATGCCCACCCCCTGCCCTGCACGTCATGGGAGGGGGCTTGAAGCCAAAGAAAAATAACCCTT
TGGTTTTTTTCTTCTGTATTTTTTTTTCTAAGAGAAGTTATTTTCTACAGTGGTTTTATACTGAAGGAAAAACACAAGCAAAAAAAAAAA
AAAAGCATCACCTTGGCCTGGAGGAGCCCAAGAAGCTGCGACCACCCCCTGCCAGGACTCCCTGCCAACAGGAACTGGACCAGGTCCTGG
AGCGGATCTCCACCATGCGCCTTCCGGATGAGCGGGGCCCTCTGGAGCACCTCTACTCCCTGCACATCCCCAACTGTGACAAGCATGGCC
TGTACAACCTCAAACAGTGCAAGATGTCTCTGAACGGGCAGCGTGGGGAGTGCTGGTGTGTGAACCCCAACACCGGGAAGCTGATCCAGG
GAGCCCCCACCATCCGGGGGGACCCCGAGTGTCATCTCTTCTACAATGAGCAGCAGGAGGCTCGCGGGGTGCACACCCAGCGGATGCAGT
AGACCGCAGCCAGCCGGTGCCTGGCGCCCCTGCCCCCCGCCCCTCTCCAAACACCGGCAGAAAACGGAGAGTGCTTGGGTGGTGGGTGCT
GGAGGATTTTCCAGTTCTGACACACGTATTTATATTTGGAAAGAGACCAGCACCGAGCTCGGCACCTCCCCGGCCTCTCTCTTCCCAGCT
GCAGATGCCACACCTGCTCCTTCTTGCTTTCCCCGGGGGAGGAAGGGGGTTGTGGTCGGGGAGCTGGGGTACAGGTTTGGGGAGGGGGAA

>In-frame_LMNA_ENST00000368299_chr1_156109108_+_IGFBP2_ENST00000456764_chr2_217525456_+_2793nt
GAGCGCCGCACCTACACCAGCCAACCCAGATCCCGAGGTCCGACAGCGCCCGGCCCAGATCCCCACGCCTGCCAGGAGCAAGCCGAGAGC
CAGCCGGCCGGCGCACTCCGACTCCGAGCAGTCTCTGTCCTTCGACCCGAGCCCCGCGCCCTTTCCGGGACCCCTGCCCCGCGGGCAGCG
CTGCCAACCTGCCGGCCATGGAGACCCCGTCCCAGCGGCGCGCCACCCGCAGCGGGGCGCAGGCCAGCTCCACTCCGCTGTCGCCCACCC
GCATCACCCGGCTGCAGGAGAAGGAGGACCTGCAGGAGCTCAATGATCGCTTGGCGGTCTACATCGACCGTGTGCGCTCGCTGGAAACGG
AGAACGCAGGGCTGCGCCTTCGCATCACCGAGTCTGAAGAGGTGGTCAGCCGCGAGGTGTCCGGCATCAAGGCCGCCTACGAGGCCGAGC
TCGGGGATGCCCGCAAGACCCTTGACTCAGTAGCCAAGGAGCGCGCCCGCCTGCAGCTGGAGCTGAGCAAAGTGCGTGAGGAGTTTAAGG
AGCTGAAAGCGCGCAATACCAAGAAGGAGGGTGACCTGATAGCTGCTCAGGCTCGGCTGAAGGACCTGGAGGCTCTGCTGAACTCCAAGG
AGGCCGCACTGAGCACTGCTCTCAGTGAGAAGCGCACGCTGGAGGGCGAGCTGCATGATCTGCGGGGCCAGGTGGCCAAGCTTGAGGCAG
CCCTAGGTGAGGCCAAGAAGCAACTTCAGGATGAGATGCTGCGGCGGGTGGATGCTGAGAACAGGCTGCAGACCATGAAGGAGGAACTGG
ACTTCCAGAAGAACATCTACAGTGAGGAGCTGCGTGAGACCAAGCGCCGTCATGAGACCCGACTGGTGGAGATTGACAATGGGAAGCAGC
GTGAGTTTGAGAGCCGGCTGGCGGATGCGCTGCAGGAACTGCGGGCCCAGCATGAGGACCAGGTGGAGCAGTATAAGAAGGAGCTGGAGA
AGACTTATTCTGCCAAGCTGGACAATGCCAGGCAGTCTGCTGAGAGGAACAGCAACCTGGTGGGGGCTGCCCACGAGGAGCTGCAGCAGT
CGCGCATCCGCATCGACAGCCTCTCTGCCCAGCTCAGCCAGCTCCAGAAGCAGCTGGCAGCCAAGGAGGCGAAGCTTCGAGACCTGGAGG
ACTCACTGGCCCGTGAGCGGGACACCAGCCGGCGGCTGCTGGCGGAAAAGGAGCGGGAGATGGCCGAGATGCGGGCAAGGATGCAGCAGC
AGCTGGACGAGTACCAGGAGCTTCTGGACATCAAGCTGGCCCTGGACATGGAGATCCACGCCTACCGCAAGCTCTTGGAGGGCGAGGAGG
AGAGGCTACGCCTGTCCCCCAGCCCTACCTCGCAGCGCAGCCGTGGCCGTGCTTCCTCTCACTCATCCCAGACACAGGGTGGGGGCAGCG
TCACCAAAAAGCGCAAACTGGAGTCCACTGAGAGCCGCAGCAGCTTCTCACAGCACGCACGCACTAGCGGGCGCGTGGCCGTGGAGGAGG
TGGATGAGGAGGGCAAGTTTGTCCGGCTGCGCAACAAGTCCAATGAGGACCAGTCCATGGGCAATTGGCAGATCAAGCGCCAGAATGGAG
ATGATCCCTTGCTGACTTACCGGTTCCCACCAAAGTTCACCCTGAAGGCTGGGCAGGTGGTGACGATCTGGGCTGCAGGAGCTGGGGCCA
CCCACAGCCCCCCTACCGACCTGGTGTGGAAGGCACAGAACACCTGGGGCTGCGGGAACAGCCTGCGTACGGCTCTCATCAACTCCACTG
GGGAAGAAGTGGCCATGCGCAAGCTGGTGCGCTCAGTGACTGTGGTTGAGGACGACGAGGATGAGGATGGAGATGACCTGCTCCATCACC
ACCACGGCTCCCACTGCAGCAGCTCGGGGGACCCCGCTGAGTACAACCTGCGCTCGCGCACCGTGCTGTGCGGGACCTGCGGGCAGCCTG
CCGACAAGGCATCTGCCAGCGGCTCAGGAGCCCAGAGCCCCCAGAACTGCAGCATCATGTAATCTGGGACCTGCCAGGCAGGGGTGGGGG
TGGAGGCTTCCTGCGTCCTCCTCACCTCATGCCCACCCCCTGCCCTGCACGTCATGGGAGGGGGCTTGAAGCCAAAGAAAAATAACCCTT
TGGTTTTTTTCTTCTGTATTTTTTTTTCTAAGAGAAGTTATTTTCTACAGTGGTTTTATACTGAAGGAAAAACACAAGCAAAAAAAAAAA
AAAAGCATCACCTTGGCCTGGAGGAGCCCAAGAAGCTGCGACCACCCCCTGCCAGGACTCCCTGCCAACAGGAACTGGACCAGGTCCTGG
AGCGGATCTCCACCATGCGCCTTCCGGATGAGCGGGGCCCTCTGGAGCACCTCTACTCCCTGCACATCCCCAACTGTGACAAGCATGGCC
TGTACAACCTCAAACAGTGCAAGATGTCTCTGAACGGGCAGCGTGGGGAGTGCTGGTGTGTGAACCCCAACACCGGGAAGCTGATCCAGG
GAGCCCCCACCATCCGGGGGGACCCCGAGTGTCATCTCTTCTACAATGAGCAGCAGGAGGCTCGCGGGGTGCACACCCAGCGGATGCAGT
AGACCGCAGCCAGCCGGTGCCTGGCGCCCCTGCCCCCCGCCCCTCTCCAAACACCGGCAGAAAACGGAGAGTGCTTGGGTGGTGGGTGCT
GGAGGATTTTCCAGTTCTGACACACGTATTTATATTTGGAAAGAGACCAGCACCGAGCTCGGCACCTCCCCGGCCTCTCTCTTCCCAGCT


Top

FusionGenePPI for LMNA_IGFBP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMNALMNB1, SREBF1, NARF, EMD, KAT5, TMPO, ZNF239, SYNE1, RB1, ALOX12, PRKCA, TOR1A, TOR1AIP1, FYCO1, BANF1, RBBP4, ING1, CTNNB1, SRRM1, SRRM2, MORF4L1, MORF4L2, MRGBP, H2AFX, MYC, UCHL5, YWHAQ, MME, CTCF, SVIL, PRKDC, STAC, SIRT7, ISG15, PPP1CC, CDK2, PCBP1, EGF, LMNA, UBE2I, PCGF2, MRPS26, FLNA, UNC13D, SF3B3, WDR18, HNRNPM, SLC25A6, PMS2, SLC25A5, NONO, GZMB, GZMA, VCP, MLIP, FN1, VCAM1, CDH1, ITGA4, URB2, PHB, LEMD3, FAM169A, LBR, TMEM201, NUMA1, ANLN, LMNB2, NUP153, NUP50, AHCTF1, POM121, TPR, NUP98, NUP155, RANBP2, NUP133, RANGAP1, MCM3AP, NUP214, HIST1H4G, SAP30BP, SCML2, HP1BP3, ZBTB33, TOX4, TRIM28, FHL1, NELFE, ZNF280C, H2AFY, GTF2A1, BAZ1B, ORC2, GTF2F2, CHD8, SUPT5H, RUVBL1, SMARCA5, PML, TOP2A, MTDH, THRAP3, CXorf56, TAGLN2, TMEM230, ARPIN, C9orf78, PDAP1, CCDC47, DNAJC1, WDR70, RNF113A, YKT6, VRK2, CISD2, CTTN, LRRC59, CD2AP, EIF5, PCMT1, SRPRB, ACE, ALDH3A2, PDLIM3, FASN, CDKAL1, HNRNPA1, DDX46, HNRNPA0, DDX42, SUGP1, HNRNPA2B1, PAPOLA, RBM10, FUS, GPATCH1, SF1, U2SURP, DGCR14, HNRNPR, TFIP11, DDX3X, PPM1G, CPSF6, PDCD5, PCNP, TPX2, WWOX, MKI67, MASTL, HCFC1, CRK, SDCBP, PGRMC2, CRKL, HN1L, GPKOW, FAM192A, NPLOC4, PARP1, MRE11A, MDC1, XRCC6, RIF1, BRIP1, TIPRL, UBE2M, SENP1, USP15, SENP6, NCL, GNL2, CDK16, FBXO6, PARK2, KCTD12, KIAA0196, KPNA6, EEF1D, GMPPB, PSMD10, ZW10, ROCK2, TP53, RAPGEF2, DUSP13, KRTAP10-7, KRTAP10-3, ENO1, SHMT2, MOV10, NXF1, C17orf49, CUL7, OBSL1, CCDC8, EED, SIRT6, ILK, IRAK1, LIMK2, MAST3, ABCE1, USP7, DYNLT1, RPA1, NTRK1, SCARNA22, ANKRA2, RFXANK, STX5, HERC2, SRPK2, CLK1, CC2D2A, HIST1H3E, PPME1, MCM2, MCM5, SNW1, CDC5L, SMURF1, BMI1, CA5A, EGFR, SUN2, CYLD, SPTA1, EIF2AK2, DLST, PDHA1, SDHA, SOD1, TRIM25, G3BP1, ANXA6, APOA2, APOD, AQP1, AQP3, ASGR1, ATP6V0C, BCL2L2, BNIP2, BNIP3, BNIP3L, BYSL, C5, CACNG1, CCNG1, MS4A1, SCARB2, ENTPD3, CD72, CD81, CD52, CETN3, CLCN7, COL8A2, CRY2, CYB561, F2RL1, FCER1A, FCER1G, FDFT1, GALNT2, GJB2, GJB5, GPR25, GRM2, HCK, HMOX1, HMOX2, IFIT2, IGFBP5, ITGAM, KCNK1, KPNA1, KPNA3, KPNA4, KRT6A, LAMB1, LCP2, SMAD1, MAL, MEOX1, MFAP1, MGST3, MIP, MUTYH, NAB2, NEU1, NINJ2, NKG7, SERPINE1, PCNA, PIK3R2, PKD2, FXYD3, PLP1, PLP2, PMP22, PNLIPRP1, CTSA, PRNP, PTPN9, RHAG, RTN1, SFTPC, SIAH1, SLC1A1, SLC2A5, SLC7A1, SLN, SPN, STX3, STX4, VAMP1, VAMP2, SYPL1, TAP1, TCEA2, TCEB3, TDO2, TFRC, THBD, TSPAN7, TNF, UPK1B, ZNF3, ZNF69, ZNF138, TRIM26, SLC30A2, SLC30A3, MALL, STX7, CHST1, AOC3, EIF3G, VAMP4, TNFSF12, CDS2, TNFRSF10C, TMEM11, NAT8, PIAS2, CLDN10, USP2, SYNGR1, PTPLA, ZMYM6, VAMP3, ITM2B, STX8, CXCL14, SEC22B, GOSR2, ZSCAN12, RANBP9, TSPAN2, LINC01587, ALG3, STX6, RTN3, ABCA9, BTN2A2, WFDC2, FAM3C, CREB3, VTI1B, SLC35A1, RABAC1, SLU7, SLMO1, VAMP5, MTHFD2, FAXDC2, USP20, STARD3, MAPRE2, CYB561D2, C14orf1, PNKP, ACOT7, MGLL, CLCA4, SACM1L, ARL6IP1, LEPROTL1, LPAR3, STX12, APOL2, IFFO1, UNC50, LRP10, OSTF1, SEC22A, FETUB, LAT, SERP1, ARHGEF16, TMEM14A, TMEM208, EMR2, CLEC4A, DERL2, GOLT1B, PLLP, SBDS, INSIG2, CLEC1A, SPG21, AIG1, SCARA3, TMEM14C, FXYD6, C11orf24, SMIM11, YIPF1, GIN1, PAQR5, CLN6, PARPBP, TMEM51, WDYHV1, FAIM, SLC38A7, TMEM140, CSGALNACT2, DDX43, UBE2Q1, LIMS2, USE1, DBNDD2, UNC45A, TMEM234, RPRM, TMPRSS4, TRIM39, KCNK13, GPR108, DUS3L, SMCO4, DDX24, AGTRAP, RTN4, NIPAL3, ZNF490, CXCL16, SELK, SENP2, TNMD, EDDM3B, LMBR1, RGS18, C5orf28, SPANXD, SPANXC, C16orf58, SLC13A3, VKORC1, ALG8, TMEM109, DERL1, FA2H, TMEM243, TMEM43, C17orf62, C3orf52, ZC2HC1C, TM4SF20, CYBRD1, GOLGA2P10, ADAM33, TSGA10, CYB5B, CFHR5, VMP1, TMEM14B, MARVELD1, TMEM222, SLC41A2, FAM161A, DNAJC30, TMEM107, JAGN1, PERM1, GPR128, SLC35B4, MFSD5, COX14, TMEM128, TMEM60, AQP10, FATE1, CCDC120, TMEM41A, ZNF439, MYADM, REEP6, SYCE1, ORMDL1, ORMDL3, TMEM203, CMTM7, KIF12, TMEM54, SLC35A4, OSBPL8, C1QTNF1, CMTM5, CMTM3, CLDND2, ZNF440, IZUMO2, C20orf141, TMEM42, TRAM1L1, DEFB127, UBQLNL, CWF19L2, TMEM86A, TMEM120B, TMEM199, CCDC155, ZNF569, SYT6, CNIH3, RMDN2, SH3RF2, TMEM65, TMEM74, ZDHHC15, SGMS2, SLC30A8, TCEANC, FAM9B, PPAPDC1A, OSTCP1, TSNARE1, AQPEP, ZNF25, TMEM218, MMD2, LHFPL5, ZDHHC24, NALCN, BRICD5, VSTM1, YIPF6, TSPAN33, STAC2, SLC35B2, SFT2D2, SERP2, C2orf82, C4orf3, CENPP, ANKRD20A5P, BRCA1, EFTUD2, LUC7L3, NPM1, PRPF19, RNPS1, SRSF1, SRSF3, SRSF4, TRA2B, ALYREF, U2AF2, MYO1C, DKC1, FBL, GAR1, NHP2, NOP58, SFPQ, MATR3, HNRNPU, HIST1H1A, HIST1H1B, HIST1H1C, HIST1H2BB, HIST1H3A, HIST2H2AB, HIST1H4H, H2AFZ, TTN, DDX23, DDX5, DHX15, HNRNPA1L2, HNRNPA3, HNRNPC, HNRNPH1, HNRNPK, PRPF6, RALY, SF3B1, SNRNP40, SNRPD1, SNRPD2, SNRPD3, YBX1, ACIN1, DDX18, DDX21, ILF2, ILF3, MYBBP1A, NOP2, NOP56, RPF2, RPL5, RPL6, RPL11, RPS3A, RPS6, RPS7, RPS25, RSL1D1, SRSF5, SRSF9, TOP1, UBTF, CD2BP2, CSNK2A1, ELAVL1, HNRNPL, PHB2, RPS2, SAP18, SSRP1, URI1, TP53BP1IGFBP2IGF1, INO80B, GSDMB, EGFR, DEFA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMNA_IGFBP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LMNA_IGFBP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLMNAC0410190Autosomal Dominant Emery-Dreifuss Muscular Dystrophy (disorder)19ORPHANET;UNIPROT
HgeneLMNAC1449563Cardiomyopathy, Familial Idiopathic17ORPHANET;UNIPROT
HgeneLMNAC0033300Progeria14CTD_human;ORPHANET;UNIPROT
HgeneLMNAC1720860Familial Partial Lipodystrophy, Type 210ORPHANET;UNIPROT
HgeneLMNAC1834653MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 1B (disorder)7CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0432291Mandibuloacral dysostosis5CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0271694Familial partial lipodystrophy4CTD_human
HgeneLMNAC0007193Cardiomyopathy, Dilated3CTD_human;HPO
HgeneLMNAC0796031Malouf syndrome3ORPHANET;UNIPROT
HgeneLMNAC2750035Emery-Dreifuss Muscular Dystrophy 32UNIPROT
HgeneLMNAC2750785MUSCULAR DYSTROPHY, CONGENITAL, LMNA-RELATED (disorder)2CTD_human;ORPHANET;UNIPROT
HgeneLMNAC0016508Congenital Foot Deformity1CTD_human
HgeneLMNAC0018566Congenital Hand Deformities1CTD_human
HgeneLMNAC0018794Heart Block1CTD_human
HgeneLMNAC0032460Polycystic Ovary Syndrome1CTD_human;HPO
HgeneLMNAC0036420Localized scleroderma1CTD_human
HgeneLMNAC0037188Sinoatrial Block1CTD_human
HgeneLMNAC0042514Tachycardia, Ventricular1CTD_human
HgeneLMNAC0085298Sudden Cardiac Death1CTD_human;HPO
HgeneLMNAC0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneLMNAC0376634Craniofacial Abnormalities1CTD_human
HgeneLMNAC0410189Muscular Dystrophy, Emery-Dreifuss1CTD_human
HgeneLMNAC0686353Muscular Dystrophies, Limb-Girdle1CTD_human;HPO
HgeneLMNAC1136321HIV-Associated Lipodystrophy Syndrome1CTD_human
HgeneLMNAC1854154Charcot-Marie-Tooth disease, Type 2B11CTD_human;ORPHANET;UNIPROT
TgeneIGFBP2C0005586Bipolar Disorder3PSYGENET
TgeneIGFBP2C0023893Liver Cirrhosis, Experimental2CTD_human
TgeneIGFBP2C0010606Adenoid Cystic Carcinoma1CTD_human
TgeneIGFBP2C0011616Contact Dermatitis1CTD_human
TgeneIGFBP2C0021655Insulin Resistance1CTD_human
TgeneIGFBP2C0023890Liver Cirrhosis1CTD_human
TgeneIGFBP2C0028754Obesity1CTD_human
TgeneIGFBP2C0036095Salivary Gland Neoplasms1CTD_human